diff --git a/docs/examples/networks.md b/docs/examples/networks.md deleted file mode 100644 index e69de29b..00000000 diff --git a/docs/examples/setup_local_blast.md b/docs/examples/setup_local_blast.md deleted file mode 100644 index e69de29b..00000000 diff --git a/docs/installation/docker.md b/docs/installation/docker.md deleted file mode 100644 index 95506131..00000000 --- a/docs/installation/docker.md +++ /dev/null @@ -1,5 +0,0 @@ ---- -icon: simple/docker ---- - -# Installation with Docker \ No newline at end of file diff --git a/docs/installation/pip.md b/docs/installation/install_pyeed.md similarity index 88% rename from docs/installation/pip.md rename to docs/installation/install_pyeed.md index f94b3c2c..bfc1317e 100644 --- a/docs/installation/pip.md +++ b/docs/installation/install_pyeed.md @@ -1,7 +1,3 @@ ---- -icon: simple/python ---- - # Installation via `pip` PyEED can be installed from Github via pip. @@ -13,3 +9,7 @@ Alternatively, you can install the latest stable release from PyPI. ```bash ``` + + +# Installation with Docker + diff --git a/docs/installation/setup_local_blast.md b/docs/installation/setup_local_blast.md new file mode 100644 index 00000000..81fbc55c --- /dev/null +++ b/docs/installation/setup_local_blast.md @@ -0,0 +1,6 @@ +# Setup a Local BLAST Database + +This tutorial will guide you through the process of setting up a local BLAST database. This is useful if you have a large number of sequences that you need to search against, or if you want to search against a custom database. + +1. Hi +2. Hello \ No newline at end of file diff --git a/docs/examples/alignments.md b/docs/quick_start/alignments.md similarity index 91% rename from docs/examples/alignments.md rename to docs/quick_start/alignments.md index 620b44ac..c62afabd 100644 --- a/docs/examples/alignments.md +++ b/docs/quick_start/alignments.md @@ -54,13 +54,20 @@ alignment = Alignment.from_sequences(list_of_sequences) tem109 = ProteinInfo.from_ncbi("AAT46413.1") # Create and run alignment - alignment = PairwiseAlignment([tem1, tem109], aligner=PairwiseAligner) + alignment = PairwiseAlignment([tem1, tem109], aligner=PairwiseAligner, mode="local") ``` === "Global Alignment" ``` py from pyeed.core import ProteinInfo, PairwiseAlignment - from pyeed.aligners import NeedlemanWunsch + from pyeed.aligners import PairwiseAligner + + # Get two ProteinInfo objects + tem1 = ProteinInfo.from_ncbi("QGC48744.1") + tem109 = ProteinInfo.from_ncbi("AAT46413.1") + + # Create and run alignment + alignment = PairwiseAlignment([tem1, tem109], aligner=PairwiseAligner, mode="global") ``` diff --git a/docs/examples/basics.md b/docs/quick_start/basics.md similarity index 100% rename from docs/examples/basics.md rename to docs/quick_start/basics.md diff --git a/docs/examples/blast.md b/docs/quick_start/blast.md similarity index 100% rename from docs/examples/blast.md rename to docs/quick_start/blast.md diff --git a/docs/examples/clustering.md b/docs/quick_start/clustering.md similarity index 100% rename from docs/examples/clustering.md rename to docs/quick_start/clustering.md diff --git a/docs/quick_start/index.md b/docs/quick_start/index.md new file mode 100644 index 00000000..621031b8 --- /dev/null +++ b/docs/quick_start/index.md @@ -0,0 +1,20 @@ +--- +hide: + - navigation + - footer +--- + +# Quick Start + +
+ +- :material-walk: __[Basics]__ – How to work with sequence data +- :octicons-search-16: __[Search Sequences]__ – How to search for individual sequences or search using BLAST +- :fontawesome-solid-align-justify: __[Alignments]__ – How to make different alignments +- :material-dots-grid: __[Networks]__ – How to construct sequence networks + +
+ [Basics]: basics.md + [Search Sequences]: blast.md + [Alignments]: alignments.md + [Networks]: networks.md \ No newline at end of file diff --git a/docs/quick_start/networks.md b/docs/quick_start/networks.md new file mode 100644 index 00000000..e73d798f --- /dev/null +++ b/docs/quick_start/networks.md @@ -0,0 +1,83 @@ +# Creating Sequence Networks + +A `SequenceNetwork` is created using a list of `PairwiseAlignment` objects, and a list of `AbstractSequences`. Additionally, the way the network is constructed is influenced by the `weight` and `threshold` attributes. The `weight` determines which attribute of the `PairwiseAlignment` object is used to calculate the distance between the sequences of the network. The `threshold` determines the minimum value of the `weight` attribute for an edge to be created. Furthermore, a `color` can be determined based on the attributes of an `AbstractSequence` object in which the nodes of the network will be colored. + +## Visualization + +=== "2D" + + ```py + from pyeed.core import ProteinInfo, Alignment + from pyeed.aligners import PairwiseAligner + from pyeed.network import SequenceNetwork + + # Accessions from different methionine adenyltransferases + mat_accessions = [ + "MBP1912539.1", + "SEV92896.1", + "MBO8174569.1", + "WP_042680787.1", + "NPA47376.1", + "WP_167889085.1", + "WP_048165429.1", + "ACS90033.1", + ] + mats = ProteinInfo.from_ncbi(mat_accessions) + + # Create pairwise alignments between all sequences + alignments = Alignment.from_sequences(mats, aligner=PairwiseAligner) + + # Create a network + network = SequenceNetwork( + sequences=mats, + pairwise_alignments=alignments, + weight="identity", + threshold=0.9, + dimensions=2, + color="taxonomy_id", + ) + + # Visualize the network + network.visualize() + ``` + +=== "3D" + + ```py + from pyeed.core import ProteinInfo, Alignment + from pyeed.aligners import PairwiseAligner + from pyeed.network import SequenceNetwork + + # Accessions from different methionine adenyltransferases + mat_accessions = [ + "MBP1912539.1", + "SEV92896.1", + "MBO8174569.1", + "WP_042680787.1", + "NPA47376.1", + "WP_167889085.1", + "WP_048165429.1", + "ACS90033.1", + ] + mats = ProteinInfo.from_ncbi(mat_accessions) + + # Create pairwise alignments between all sequences + alignments = Alignment.from_sequences(mats, aligner=PairwiseAligner) + + # Create a network + network = SequenceNetwork( + sequences=mats, + pairwise_alignments=alignments, + weight="identity", + threshold=0.9, + dimensions=3, + color="taxonomy_id", + ) + + # Visualize the network + network.visualize() + ``` + +## Network Analysis + +Upon the `SequenceNetwork` is instantiated the `graph` property is created. This property is a `networkx` graph object that can be used to perform network analysis. For example, the `degree()` method can be used to calculate the degree of each node in the network. diff --git a/examples/networks/alignment_network.ipynb b/examples/networks/alignment_network.ipynb deleted file mode 100644 index ce57995b..00000000 --- a/examples/networks/alignment_network.ipynb +++ /dev/null @@ -1,2394 +0,0 @@ -{ - "cells": [ - { - "cell_type": "code", - "execution_count": 1, - "metadata": {}, - "outputs": [], - "source": [ - "from pyEED.core import ProteinInfo\n", - "from pyEED.alignment.pairwise import multi_pairwise_alignment\n", - "from pyEED.network import pairwise_network\n", - "from pyEED.ncbi.utils import load_accessions" - ] - }, - { - "cell_type": "markdown", - "metadata": {}, - "source": [ - "# Visualize networks of pairwise sequence alignments\n", - "\n", - "In the following example, a protein BLAST search is conducted based on TEM-1 and TEM-109 variant of beta-lactamase. After pairwise alignment of all sequences, a network is constructed based on the alignment scores and then visualized.\n", - "\n", - "## PBLAST search for seed sequences\n", - "\n", - "Results from the BLAST search are renamed based to the name of query protein variant." - ] - }, - { - "cell_type": "code", - "execution_count": 2, - "metadata": {}, - "outputs": [ - { - "name": "stdout", - "output_type": "stream", - "text": [ - "πŸƒπŸΌβ€β™€οΈ Running PBLAST\n", - "╭── protein name: TEM family beta-lactamase\n", - "β”œβ”€β”€ accession: QGC48744.1\n", - "β”œβ”€β”€ organism: Escherichia coli\n", - "β”œβ”€β”€ e-value: 0.05\n", - "╰── max hits: 15\n" - ] - }, - { - "name": "stderr", - "output_type": "stream", - "text": [ - "⬇️ Fetching protein sequences: 100%|β–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆ| 15/15 [00:11<00:00, 1.30it/s]\n" - ] - }, - { - "name": "stdout", - "output_type": "stream", - "text": [ - "πŸŽ‰ Done\n", - "\n", - "πŸƒπŸΌβ€β™€οΈ Running PBLAST\n", - "╭── protein name: beta-lactamase TEM-109\n", - "β”œβ”€β”€ accession: AAT46413.1\n", - "β”œβ”€β”€ organism: Escherichia coli\n", - "β”œβ”€β”€ e-value: 0.05\n", - "╰── max hits: 15\n" - ] - }, - { - "name": "stderr", - "output_type": "stream", - "text": [ - "⬇️ Fetching protein sequences: 100%|β–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆ| 15/15 [00:13<00:00, 1.13it/s]" - ] - }, - { - "name": "stdout", - "output_type": "stream", - "text": [ - "πŸŽ‰ Done\n", - "\n" - ] - }, - { - "name": "stderr", - "output_type": "stream", - "text": [ - "\n" - ] - } - ], - "source": [ - "tem1 = ProteinInfo.from_ncbi(\"QGC48744.1\")\n", - "tem109 = ProteinInfo.from_ncbi(\"AAT46413.1\")\n", - "\n", - "blast_results = []\n", - "for tem in [tem1, tem109]:\n", - " sequences = tem.pblast(\n", - " e_value=0.05, n_hits=15, api_key=\"161e6eb71dcc94511d2d0e2fc5336c1af709\"\n", - " )\n", - "\n", - " for sequence in sequences:\n", - " sequence.name = tem.name\n", - "\n", - " blast_results.extend(sequences)\n", - " blast_results.append(tem)" - ] - }, - { - "cell_type": "markdown", - "metadata": {}, - "source": [ - "## Pairwise alignment of unique sequence pairs" - ] - }, - { - "cell_type": "code", - "execution_count": 3, - "metadata": {}, - "outputs": [ - { - "name": "stderr", - "output_type": "stream", - "text": [ - "⛓️ Aligning sequences: 100%|β–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆ| 496/496 [00:01<00:00, 342.87it/s]\n" - ] - } - ], - "source": [ - "alignments = multi_pairwise_alignment(\n", - " blast_results,\n", - " mode=\"global\",\n", - " match=1,\n", - " mismatch=-1,\n", - " gap_open=-1,\n", - " gap_extend=0,\n", - " n_jobs=8,\n", - ")" - ] - }, - { - "cell_type": "markdown", - "metadata": {}, - "source": [ - "## Visualize the alignment network" - ] - }, - { - "cell_type": "code", - "execution_count": 4, - "metadata": {}, - "outputs": [ - { - "name": "stdout", - "output_type": "stream", - "text": [ - "{'TEM family beta-lactamase': 'blue', 'beta-lactamase TEM-109': 'red'}\n" - ] - }, - { - "data": { - "application/vnd.plotly.v1+json": { - "config": { - "plotlyServerURL": "https://plot.ly" - }, - "data": [ - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - -0.6914588236656009, - -0.7475822584708567 - ], - "y": [ - 0.6937671259213628, - 0.6618414989828777 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - -0.2448563136899791, - -0.1203321469905742 - ], - "y": [ - 0.14734002900774362, - 0.0763339976053082 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - -0.0811932367392075, - -0.1203321469905742 - ], - "y": [ - 0.17382567240497152, - 0.0763339976053082 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - -0.0811932367392075, - -0.04940126911688077 - ], - "y": [ - 0.17382567240497152, - 0.09651404384278645 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - -0.24901003045346679, - -0.1203321469905742 - ], - "y": [ - 0.08803189773933258, - 0.0763339976053082 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - -0.24901003045346679, - -0.25034481810980186 - ], - "y": [ - 0.08803189773933258, - 0.041927515691288705 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - -0.1203321469905742, - -0.14872233118607536 - ], - "y": [ - 0.0763339976053082, - 0.21452566279960705 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - -0.1203321469905742, - -0.25034481810980186 - ], - "y": [ - 0.0763339976053082, - 0.041927515691288705 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - -0.1203321469905742, - -0.20297634886068033 - ], - "y": [ - 0.0763339976053082, - 0.18693913882560567 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "0.5", - "type": "scatter", - "x": [ - -0.1203321469905742, - -0.04029013809870461 - ], - "y": [ - 0.0763339976053082, - 0.02061650287648177 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - -0.1203321469905742, - -0.04940126911688077 - ], - "y": [ - 0.0763339976053082, - 0.09651404384278645 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - -0.1203321469905742, - 0.08532296081240384 - ], - "y": [ - 0.0763339976053082, - -0.012041709630483113 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - -0.1203321469905742, - -0.03936001583320556 - ], - "y": [ - 0.0763339976053082, - -0.09737039857521942 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "0.5", - "type": "scatter", - "x": [ - -0.04029013809870461, - -0.04940126911688077 - ], - "y": [ - 0.02061650287648177, - 0.09651404384278645 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "0.5", - "type": "scatter", - "x": [ - -0.04029013809870461, - 0.08532296081240384 - ], - "y": [ - 0.02061650287648177, - -0.012041709630483113 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "0.5", - "type": "scatter", - "x": [ - -0.04029013809870461, - -0.03936001583320556 - ], - "y": [ - 0.02061650287648177, - -0.09737039857521942 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "0.125", - "type": "scatter", - "x": [ - 0.0026449758300490615, - -0.04940126911688077 - ], - "y": [ - -0.008140028460294475, - 0.09651404384278645 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "0.5", - "type": "scatter", - "x": [ - 0.0026449758300490615, - 0.05466675915745448 - ], - "y": [ - -0.008140028460294475, - -0.07452750708175072 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "0.16666666666666666", - "type": "scatter", - "x": [ - 0.0026449758300490615, - 0.03719026190426883 - ], - "y": [ - -0.008140028460294475, - -0.03440182426628215 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "0.5", - "type": "scatter", - "x": [ - 0.0026449758300490615, - 0.015862547165238553 - ], - "y": [ - -0.008140028460294475, - -0.08038463467503207 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "0.125", - "type": "scatter", - "x": [ - 0.0026449758300490615, - 0.08532296081240384 - ], - "y": [ - -0.008140028460294475, - -0.012041709630483113 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "0.125", - "type": "scatter", - "x": [ - 0.0026449758300490615, - -0.03936001583320556 - ], - "y": [ - -0.008140028460294475, - -0.09737039857521942 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "0.14285714285714285", - "type": "scatter", - "x": [ - 0.05466675915745448, - 0.03719026190426883 - ], - "y": [ - -0.07452750708175072, - -0.03440182426628215 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - 0.05466675915745448, - 0.015862547165238553 - ], - "y": [ - -0.07452750708175072, - -0.08038463467503207 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "0.1111111111111111", - "type": "scatter", - "x": [ - 0.05466675915745448, - 0.08532296081240384 - ], - "y": [ - -0.07452750708175072, - -0.012041709630483113 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "0.1111111111111111", - "type": "scatter", - "x": [ - 0.05466675915745448, - -0.03936001583320556 - ], - "y": [ - -0.07452750708175072, - -0.09737039857521942 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "0.3333333333333333", - "type": "scatter", - "x": [ - 0.03719026190426883, - 0.08532296081240384 - ], - "y": [ - -0.03440182426628215, - -0.012041709630483113 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "0.3333333333333333", - "type": "scatter", - "x": [ - 0.03719026190426883, - -0.03936001583320556 - ], - "y": [ - -0.03440182426628215, - -0.09737039857521942 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "0.1111111111111111", - "type": "scatter", - "x": [ - 0.015862547165238553, - 0.08532296081240384 - ], - "y": [ - -0.08038463467503207, - -0.012041709630483113 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "0.1111111111111111", - "type": "scatter", - "x": [ - 0.015862547165238553, - -0.03936001583320556 - ], - "y": [ - -0.08038463467503207, - -0.09737039857521942 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - 0.10869915026731872, - 0.13935595294492717 - ], - "y": [ - -0.20339682223411076, - -0.33393696367943215 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - 0.10869915026731872, - 0.26039027346222837 - ], - "y": [ - -0.20339682223411076, - -0.20052479110151572 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - 0.10869915026731872, - 0.08532296081240384 - ], - "y": [ - -0.20339682223411076, - -0.012041709630483113 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - 0.10869915026731872, - 0.19830431202433105 - ], - "y": [ - -0.20339682223411076, - -0.2973813824634891 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - 0.10869915026731872, - 0.008570759579562364 - ], - "y": [ - -0.20339682223411076, - -0.2105015087825045 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - 0.10869915026731872, - -0.03936001583320556 - ], - "y": [ - -0.20339682223411076, - -0.09737039857521942 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - 0.10869915026731872, - 0.09091010554453571 - ], - "y": [ - -0.20339682223411076, - -0.3346823296174025 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - 0.13935595294492717, - 0.09091010554453571 - ], - "y": [ - -0.33393696367943215, - -0.3346823296174025 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - 0.26039027346222837, - 0.21563899967860206 - ], - "y": [ - -0.20052479110151572, - -0.09392104519463836 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - 0.26039027346222837, - 0.37605156079029445 - ], - "y": [ - -0.20052479110151572, - -0.2538592706809643 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - 0.08532296081240384, - 0.24756102331286348 - ], - "y": [ - -0.012041709630483113, - 0.07640918883750153 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - 0.08532296081240384, - 0.21563899967860206 - ], - "y": [ - -0.012041709630483113, - -0.09392104519463836 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - 0.08532296081240384, - 0.16541824687796045 - ], - "y": [ - -0.012041709630483113, - 0.0824591456151757 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - 0.24756102331286348, - 0.3583179045125126 - ], - "y": [ - 0.07640918883750153, - 0.14097172029107072 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - 0.008570759579562364, - -0.03936001583320556 - ], - "y": [ - -0.2105015087825045, - -0.09737039857521942 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - -0.03936001583320556, - -0.1173148443114023 - ], - "y": [ - -0.09737039857521942, - -0.20833803540467175 - ] - }, - { - "hoverinfo": "text", - "line": { - "color": "rgba(128, 128, 128, 0.1)", - "width": 1 - }, - "mode": "lines", - "text": "1.0", - "type": "scatter", - "x": [ - -0.03936001583320556, - -0.1611856606532563 - ], - "y": [ - -0.09737039857521942, - -0.1544174738187897 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "blue", - "size": 10 - }, - "mode": "markers", - "text": "Enterobacter hormaechei", - "type": "scatter", - "x": [ - -0.6914588236656009 - ], - "y": [ - 0.6937671259213628 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "blue", - "size": 10 - }, - "mode": "markers", - "text": "synthetic construct", - "type": "scatter", - "x": [ - -0.2448563136899791 - ], - "y": [ - 0.14734002900774362 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "blue", - "size": 10 - }, - "mode": "markers", - "text": "Shigella sonnei", - "type": "scatter", - "x": [ - -0.0811932367392075 - ], - "y": [ - 0.17382567240497152 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "blue", - "size": 10 - }, - "mode": "markers", - "text": "Enterobacteriaceae", - "type": "scatter", - "x": [ - -0.24901003045346679 - ], - "y": [ - 0.08803189773933258 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "blue", - "size": 10 - }, - "mode": "markers", - "text": "Bacteria", - "type": "scatter", - "x": [ - -0.1203321469905742 - ], - "y": [ - 0.0763339976053082 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "blue", - "size": 10 - }, - "mode": "markers", - "text": "Escherichia coli", - "type": "scatter", - "x": [ - -0.14872233118607536 - ], - "y": [ - 0.21452566279960705 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "blue", - "size": 10 - }, - "mode": "markers", - "text": "synthetic construct", - "type": "scatter", - "x": [ - -0.25034481810980186 - ], - "y": [ - 0.041927515691288705 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "blue", - "size": 10 - }, - "mode": "markers", - "text": "Salmonella enterica subsp. enterica serovar Ohio", - "type": "scatter", - "x": [ - -0.20297634886068033 - ], - "y": [ - 0.18693913882560567 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "blue", - "size": 10 - }, - "mode": "markers", - "text": "Klebsiella pneumoniae", - "type": "scatter", - "x": [ - 0.38370160070995796 - ], - "y": [ - 0.8963225852254685 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "blue", - "size": 10 - }, - "mode": "markers", - "text": "Klebsiella pneumoniae", - "type": "scatter", - "x": [ - -0.7475822584708567 - ], - "y": [ - 0.6618414989828777 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "blue", - "size": 10 - }, - "mode": "markers", - "text": "Enterobacteriaceae", - "type": "scatter", - "x": [ - -0.04029013809870461 - ], - "y": [ - 0.02061650287648177 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "blue", - "size": 10 - }, - "mode": "markers", - "text": "Enterobacterales", - "type": "scatter", - "x": [ - 0.0026449758300490615 - ], - "y": [ - -0.008140028460294475 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "blue", - "size": 10 - }, - "mode": "markers", - "text": "Salmonella enterica", - "type": "scatter", - "x": [ - -0.04940126911688077 - ], - "y": [ - 0.09651404384278645 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "blue", - "size": 10 - }, - "mode": "markers", - "text": "Escherichia coli", - "type": "scatter", - "x": [ - 0.05466675915745448 - ], - "y": [ - -0.07452750708175072 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "blue", - "size": 10 - }, - "mode": "markers", - "text": "Pseudomonadota", - "type": "scatter", - "x": [ - 0.03719026190426883 - ], - "y": [ - -0.03440182426628215 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "blue", - "size": 10 - }, - "mode": "markers", - "text": "Escherichia coli", - "type": "scatter", - "x": [ - 0.015862547165238553 - ], - "y": [ - -0.08038463467503207 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "red", - "size": 10 - }, - "mode": "markers", - "text": "Escherichia coli", - "type": "scatter", - "x": [ - 0.10869915026731872 - ], - "y": [ - -0.20339682223411076 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "red", - "size": 10 - }, - "mode": "markers", - "text": "Escherichia coli", - "type": "scatter", - "x": [ - 0.13935595294492717 - ], - "y": [ - -0.33393696367943215 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "red", - "size": 10 - }, - "mode": "markers", - "text": "Klebsiella pneumoniae", - "type": "scatter", - "x": [ - 0.26039027346222837 - ], - "y": [ - -0.20052479110151572 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "red", - "size": 10 - }, - "mode": "markers", - "text": "Gammaproteobacteria", - "type": "scatter", - "x": [ - 0.08532296081240384 - ], - "y": [ - -0.012041709630483113 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "red", - "size": 10 - }, - "mode": "markers", - "text": "Klebsiella pneumoniae", - "type": "scatter", - "x": [ - 0.19830431202433105 - ], - "y": [ - -0.2973813824634891 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "red", - "size": 10 - }, - "mode": "markers", - "text": "Escherichia coli", - "type": "scatter", - "x": [ - 0.24756102331286348 - ], - "y": [ - 0.07640918883750153 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "red", - "size": 10 - }, - "mode": "markers", - "text": "Proteus mirabilis", - "type": "scatter", - "x": [ - 0.21563899967860206 - ], - "y": [ - -0.09392104519463836 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "red", - "size": 10 - }, - "mode": "markers", - "text": "Gammaproteobacteria", - "type": "scatter", - "x": [ - 0.008570759579562364 - ], - "y": [ - -0.2105015087825045 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "red", - "size": 10 - }, - "mode": "markers", - "text": "Capnocytophaga ochracea", - "type": "scatter", - "x": [ - -0.03936001583320556 - ], - "y": [ - -0.09737039857521942 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "red", - "size": 10 - }, - "mode": "markers", - "text": "synthetic construct", - "type": "scatter", - "x": [ - 0.3954208416051821 - ], - "y": [ - -0.9999999999999999 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "red", - "size": 10 - }, - "mode": "markers", - "text": "Klebsiella pneumoniae", - "type": "scatter", - "x": [ - 0.16541824687796045 - ], - "y": [ - 0.0824591456151757 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "red", - "size": 10 - }, - "mode": "markers", - "text": "synthetic construct", - "type": "scatter", - "x": [ - -0.1173148443114023 - ], - "y": [ - -0.20833803540467175 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "red", - "size": 10 - }, - "mode": "markers", - "text": "Klebsiella pneumoniae", - "type": "scatter", - "x": [ - 0.3583179045125126 - ], - "y": [ - 0.14097172029107072 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "red", - "size": 10 - }, - "mode": "markers", - "text": "synthetic construct", - "type": "scatter", - "x": [ - -0.1611856606532563 - ], - "y": [ - -0.1544174738187897 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "red", - "size": 10 - }, - "mode": "markers", - "text": "Citrobacter koseri", - "type": "scatter", - "x": [ - 0.37605156079029445 - ], - "y": [ - -0.2538592706809643 - ] - }, - { - "hoverinfo": "text", - "marker": { - "color": "red", - "size": 10 - }, - "mode": "markers", - "text": "Escherichia coli", - "type": "scatter", - "x": [ - 0.09091010554453571 - ], - "y": [ - -0.3346823296174025 - ] - } - ], - "layout": { - "hovermode": "closest", - "margin": { - "b": 0, - "l": 0, - "r": 0, - "t": 0 - }, - "plot_bgcolor": "white", - "showlegend": false, - "template": { - "data": { - "bar": [ - { - "error_x": { - "color": "#2a3f5f" - }, - "error_y": { - "color": "#2a3f5f" - }, - "marker": { - "line": { - "color": "#E5ECF6", - "width": 0.5 - }, - "pattern": { - "fillmode": "overlay", - "size": 10, - "solidity": 0.2 - } - }, - "type": "bar" - } - ], - "barpolar": [ - { - "marker": { - "line": { - "color": "#E5ECF6", - "width": 0.5 - }, - "pattern": { - "fillmode": "overlay", - "size": 10, - "solidity": 0.2 - } - }, - "type": "barpolar" - } - ], - "carpet": [ - { - "aaxis": { - "endlinecolor": "#2a3f5f", - "gridcolor": "white", - "linecolor": "white", - "minorgridcolor": "white", - "startlinecolor": "#2a3f5f" - }, - "baxis": { - "endlinecolor": "#2a3f5f", - "gridcolor": "white", - "linecolor": "white", - "minorgridcolor": "white", - "startlinecolor": "#2a3f5f" - }, - "type": "carpet" - } - ], - "choropleth": [ - { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - }, - "type": "choropleth" - } - ], - "contour": [ - { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - }, - "colorscale": [ - [ - 0, - "#0d0887" - ], - [ - 0.1111111111111111, - "#46039f" - ], - [ - 0.2222222222222222, - "#7201a8" - ], - [ - 0.3333333333333333, - "#9c179e" - ], - [ - 0.4444444444444444, - "#bd3786" - ], - [ - 0.5555555555555556, - "#d8576b" - ], - [ - 0.6666666666666666, - "#ed7953" - ], - [ - 0.7777777777777778, - "#fb9f3a" - ], - [ - 0.8888888888888888, - "#fdca26" - ], - [ - 1, - "#f0f921" - ] - ], - "type": "contour" - } - ], - "contourcarpet": [ - { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - }, - "type": "contourcarpet" - } - ], - "heatmap": [ - { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - }, - "colorscale": [ - [ - 0, - "#0d0887" - ], - [ - 0.1111111111111111, - "#46039f" - ], - [ - 0.2222222222222222, - "#7201a8" - ], - [ - 0.3333333333333333, - "#9c179e" - ], - [ - 0.4444444444444444, - "#bd3786" - ], - [ - 0.5555555555555556, - "#d8576b" - ], - [ - 0.6666666666666666, - "#ed7953" - ], - [ - 0.7777777777777778, - "#fb9f3a" - ], - [ - 0.8888888888888888, - "#fdca26" - ], - [ - 1, - "#f0f921" - ] - ], - "type": "heatmap" - } - ], - "heatmapgl": [ - { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - }, - "colorscale": [ - [ - 0, - "#0d0887" - ], - [ - 0.1111111111111111, - "#46039f" - ], - [ - 0.2222222222222222, - "#7201a8" - ], - [ - 0.3333333333333333, - "#9c179e" - ], - [ - 0.4444444444444444, - "#bd3786" - ], - [ - 0.5555555555555556, - "#d8576b" - ], - [ - 0.6666666666666666, - "#ed7953" - ], - [ - 0.7777777777777778, - "#fb9f3a" - ], - [ - 0.8888888888888888, - "#fdca26" - ], - [ - 1, - "#f0f921" - ] - ], - "type": "heatmapgl" - } - ], - "histogram": [ - { - "marker": { - "pattern": { - "fillmode": "overlay", - "size": 10, - "solidity": 0.2 - } - }, - "type": "histogram" - } - ], - "histogram2d": [ - { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - }, - "colorscale": [ - [ - 0, - "#0d0887" - ], - [ - 0.1111111111111111, - "#46039f" - ], - [ - 0.2222222222222222, - "#7201a8" - ], - [ - 0.3333333333333333, - "#9c179e" - ], - [ - 0.4444444444444444, - "#bd3786" - ], - [ - 0.5555555555555556, - "#d8576b" - ], - [ - 0.6666666666666666, - "#ed7953" - ], - [ - 0.7777777777777778, - "#fb9f3a" - ], - [ - 0.8888888888888888, - "#fdca26" - ], - [ - 1, - "#f0f921" - ] - ], - "type": "histogram2d" - } - ], - "histogram2dcontour": [ - { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - }, - "colorscale": [ - [ - 0, - "#0d0887" - ], - [ - 0.1111111111111111, - "#46039f" - ], - [ - 0.2222222222222222, - "#7201a8" - ], - [ - 0.3333333333333333, - "#9c179e" - ], - [ - 0.4444444444444444, - "#bd3786" - ], - [ - 0.5555555555555556, - "#d8576b" - ], - [ - 0.6666666666666666, - "#ed7953" - ], - [ - 0.7777777777777778, - "#fb9f3a" - ], - [ - 0.8888888888888888, - "#fdca26" - ], - [ - 1, - "#f0f921" - ] - ], - "type": "histogram2dcontour" - } - ], - "mesh3d": [ - { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - }, - "type": "mesh3d" - } - ], - "parcoords": [ - { - "line": { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - } - }, - "type": "parcoords" - } - ], - "pie": [ - { - "automargin": true, - "type": "pie" - } - ], - "scatter": [ - { - "fillpattern": { - "fillmode": "overlay", - "size": 10, - "solidity": 0.2 - }, - "type": "scatter" - } - ], - "scatter3d": [ - { - "line": { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - } - }, - "marker": { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - } - }, - "type": "scatter3d" - } - ], - "scattercarpet": [ - { - "marker": { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - } - }, - "type": "scattercarpet" - } - ], - "scattergeo": [ - { - "marker": { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - } - }, - "type": "scattergeo" - } - ], - "scattergl": [ - { - "marker": { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - } - }, - "type": "scattergl" - } - ], - "scattermapbox": [ - { - "marker": { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - } - }, - "type": "scattermapbox" - } - ], - "scatterpolar": [ - { - "marker": { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - } - }, - "type": "scatterpolar" - } - ], - "scatterpolargl": [ - { - "marker": { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - } - }, - "type": "scatterpolargl" - } - ], - "scatterternary": [ - { - "marker": { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - } - }, - "type": "scatterternary" - } - ], - "surface": [ - { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - }, - "colorscale": [ - [ - 0, - "#0d0887" - ], - [ - 0.1111111111111111, - "#46039f" - ], - [ - 0.2222222222222222, - "#7201a8" - ], - [ - 0.3333333333333333, - "#9c179e" - ], - [ - 0.4444444444444444, - "#bd3786" - ], - [ - 0.5555555555555556, - "#d8576b" - ], - [ - 0.6666666666666666, - "#ed7953" - ], - [ - 0.7777777777777778, - "#fb9f3a" - ], - [ - 0.8888888888888888, - "#fdca26" - ], - [ - 1, - "#f0f921" - ] - ], - "type": "surface" - } - ], - "table": [ - { - "cells": { - "fill": { - "color": "#EBF0F8" - }, - "line": { - "color": "white" - } - }, - "header": { - "fill": { - "color": "#C8D4E3" - }, - "line": { - "color": "white" - } - }, - "type": "table" - } - ] - }, - "layout": { - "annotationdefaults": { - "arrowcolor": "#2a3f5f", - "arrowhead": 0, - "arrowwidth": 1 - }, - "autotypenumbers": "strict", - "coloraxis": { - "colorbar": { - "outlinewidth": 0, - "ticks": "" - } - }, - "colorscale": { - "diverging": [ - [ - 0, - "#8e0152" - ], - [ - 0.1, - "#c51b7d" - ], - [ - 0.2, - "#de77ae" - ], - [ - 0.3, - "#f1b6da" - ], - [ - 0.4, - "#fde0ef" - ], - [ - 0.5, - "#f7f7f7" - ], - [ - 0.6, - "#e6f5d0" - ], - [ - 0.7, - "#b8e186" - ], - [ - 0.8, - "#7fbc41" - ], - [ - 0.9, - "#4d9221" - ], - [ - 1, - "#276419" - ] - ], - "sequential": [ - [ - 0, - "#0d0887" - ], - [ - 0.1111111111111111, - "#46039f" - ], - [ - 0.2222222222222222, - "#7201a8" - ], - [ - 0.3333333333333333, - "#9c179e" - ], - [ - 0.4444444444444444, - "#bd3786" - ], - [ - 0.5555555555555556, - "#d8576b" - ], - [ - 0.6666666666666666, - "#ed7953" - ], - [ - 0.7777777777777778, - "#fb9f3a" - ], - [ - 0.8888888888888888, - "#fdca26" - ], - [ - 1, - "#f0f921" - ] - ], - "sequentialminus": [ - [ - 0, - "#0d0887" - ], - [ - 0.1111111111111111, - "#46039f" - ], - [ - 0.2222222222222222, - "#7201a8" - ], - [ - 0.3333333333333333, - "#9c179e" - ], - [ - 0.4444444444444444, - "#bd3786" - ], - [ - 0.5555555555555556, - "#d8576b" - ], - [ - 0.6666666666666666, - "#ed7953" - ], - [ - 0.7777777777777778, - "#fb9f3a" - ], - [ - 0.8888888888888888, - "#fdca26" - ], - [ - 1, - "#f0f921" - ] - ] - }, - "colorway": [ - "#636efa", - "#EF553B", - "#00cc96", - "#ab63fa", - "#FFA15A", - "#19d3f3", - "#FF6692", - "#B6E880", - "#FF97FF", - "#FECB52" - ], - "font": { - "color": "#2a3f5f" - }, - "geo": { - "bgcolor": "white", - "lakecolor": "white", - "landcolor": "#E5ECF6", - "showlakes": true, - "showland": true, - "subunitcolor": "white" - }, - "hoverlabel": { - "align": "left" - }, - "hovermode": "closest", - "mapbox": { - "style": "light" - }, - "paper_bgcolor": "white", - "plot_bgcolor": "#E5ECF6", - "polar": { - "angularaxis": { - "gridcolor": "white", - "linecolor": "white", - "ticks": "" - }, - "bgcolor": "#E5ECF6", - "radialaxis": { - "gridcolor": "white", - "linecolor": "white", - "ticks": "" - } - }, - "scene": { - "xaxis": { - "backgroundcolor": "#E5ECF6", - "gridcolor": "white", - "gridwidth": 2, - "linecolor": "white", - "showbackground": true, - "ticks": "", - "zerolinecolor": "white" - }, - "yaxis": { - "backgroundcolor": "#E5ECF6", - "gridcolor": "white", - "gridwidth": 2, - "linecolor": "white", - "showbackground": true, - "ticks": "", - "zerolinecolor": "white" - }, - "zaxis": { - "backgroundcolor": "#E5ECF6", - "gridcolor": "white", - "gridwidth": 2, - "linecolor": "white", - "showbackground": true, - "ticks": "", - "zerolinecolor": "white" - } - }, - "shapedefaults": { - "line": { - "color": "#2a3f5f" - } - }, - "ternary": { - "aaxis": { - "gridcolor": "white", - "linecolor": "white", - "ticks": "" - }, - "baxis": { - "gridcolor": "white", - "linecolor": "white", - "ticks": "" - }, - "bgcolor": "#E5ECF6", - "caxis": { - "gridcolor": "white", - "linecolor": "white", - "ticks": "" - } - }, - "title": { - "x": 0.05 - }, - "xaxis": { - "automargin": true, - "gridcolor": "white", - "linecolor": "white", - "ticks": "", - "title": { - "standoff": 15 - }, - "zerolinecolor": "white", - "zerolinewidth": 2 - }, - "yaxis": { - "automargin": true, - "gridcolor": "white", - "linecolor": "white", - "ticks": "", - "title": { - "standoff": 15 - }, - "zerolinecolor": "white", - "zerolinewidth": 2 - } - } - }, - "xaxis": { - "visible": false - }, - "yaxis": { - "visible": false - } - } - } - }, - "metadata": {}, - "output_type": "display_data" - } - ], - "source": [ - "pairwise_network(\n", - " alignments=alignments,\n", - " weight=\"identity\",\n", - " color=\"name\",\n", - " label=\"organism\",\n", - " cutoff=0.996,\n", - ")" - ] - } - ], - "metadata": { - "kernelspec": { - "display_name": "pye", - "language": "python", - "name": "python3" - }, - "language_info": { - "codemirror_mode": { - "name": "ipython", - "version": 3 - }, - "file_extension": ".py", - "mimetype": "text/x-python", - "name": "python", - "nbconvert_exporter": "python", - "pygments_lexer": "ipython3", - "version": "3.10.13" - } - }, - "nbformat": 4, - "nbformat_minor": 2 -} diff --git a/examples/networks/tem109_accession.toml b/examples/networks/tem109_accession.toml deleted file mode 100644 index 2f1eee6e..00000000 --- a/examples/networks/tem109_accession.toml +++ /dev/null @@ -1,102 +0,0 @@ -tem109_ids = [ - "WP_063864949.1", - "WP_063864799.1", - "WP_063864870.1", - "WP_032490103.1", - "WP_063864912.1", - "WP_063864909.1", - "WP_063864800.1", - "WP_047028173.1", - "WP_063864877.1", - "ANG18301.1", - "WP_063864805.1", - "ARF39029.1", - "WP_032490956.1", - "ARF31230.1", - "HBQ2613975.1", - "WP_063864852.1", - "WP_063864859.1", - "WP_063864865.1", - "AMM70781.1", - "HCF8861892.1", - "WP_013279314.1", - "EKW4005960.1", - "EJG7116187.1", - "ARF31817.1", - "HAI5030310.1", - "HBX5023813.1", - "WP_042065300.1", - "WP_000027057.1", - "WP_063864833.1", - "WP_063864797.1", - "HCO3480053.1", - "WP_032072208.1", - "ARF38043.1", - "ARF26548.1", - "HBX5023809.1", - "ARF39336.1", - "WP_063864851.1", - "WP_188240090.1", - "WP_063865030.1", - "ANG32478.1", - "ANG13631.1", - "ANG17132.1", - "ARF28164.1", - "WP_015379489.1", - "ARF29524.1", - "HBW1251876.1", - "ARF30334.1", - "ANG31477.1", - "ANG23480.1", - "ANG31365.1", - "HDN1137928.1", - "WP_021526512.1", - "HCH7488344.1", - "WP_148044473.1", - "ANG10160.1", - "ANG11443.1", - "HEA0912696.1", - "ECJ9431290.1", - "ARF30434.1", - "ARF37114.1", - "WP_261627585.1", - "ANG09566.1", - "ANG14490.1", - "WP_240078874.1", - "WP_032492108.1", - "ANG25686.1", - "ANG10517.1", - "ANG09900.1", - "ARF31156.1", - "ANG10619.1", - "EGO7072685.1", - "ANG10571.1", - "ANG10941.1", - "ANG14225.1", - "ANG10332.1", - "ANG18929.1", - "ANG23932.1", - "ANG09482.1", - "ARF44464.1", - "ANG09950.1", - "ANG11187.1", - "ANG16208.1", - "ANG17092.1", - "WP_063864863.1", - "WP_215748091.1", - "ANG11172.1", - "ANG14661.1", - "ANG23677.1", - "ANG30415.1", - "ANG29235.1", - "ANG24073.1", - "ANG18696.1", - "ANG10864.1", - "WP_063864796.1", - "ANG22868.1", - "EBP5465763.1", - "ANG11672.1", - "ANG31159.1", - "ARF47333.1", - "WP_161654968.1" -] diff --git a/examples/networks/tem1_accessions.toml b/examples/networks/tem1_accessions.toml deleted file mode 100644 index 2579cb42..00000000 --- a/examples/networks/tem1_accessions.toml +++ /dev/null @@ -1,102 +0,0 @@ -tem1_ids = [ - "EKW4005960.1", - "EJG7116187.1", - "AMM70781.1", - "HBQ2613975.1", - "WP_000311242.1", - "EHY2097385.1", - "HAI5030310.1", - "WP_000027057.1", - "HEC0884360.1", - "HCO3480053.1", - "WP_215748091.1", - "ANG14661.1", - "ANG10160.1", - "ANG11443.1", - "ANG18696.1", - "ANG10864.1", - "ANG11672.1", - "WP_161654968.1", - "WP_261627585.1", - "ANG09566.1", - "WP_240078874.1", - "ANG27598.1", - "ANG13700.1", - "ANG10517.1", - "ANG09900.1", - "ANG12641.1", - "ANG10619.1", - "ANG10571.1", - "ANG10941.1", - "ANG14225.1", - "ANG10332.1", - "ANG10321.1", - "WP_117043934.1", - "ANG09482.1", - "WP_094320566.1", - "ANG09950.1", - "ANG11187.1", - "ANG16208.1", - "ANG14159.1", - "ANG15082.1", - "WP_223234097.1", - "ANG09696.1", - "ANG13191.1", - "HDN1137928.1", - "ANG11172.1", - "WP_015058867.1", - "HCH7488344.1", - "ANG29235.1", - "HEA0912696.1", - "ANG24073.1", - "EBP5465763.1", - "HCQ0586696.1", - "ANG26441.1", - "ARF47333.1", - "ANG32962.1", - "EHC9934517.1", - "ANG12753.1", - "ANG14490.1", - "ELK1047634.1", - "ANG09477.1", - "HBC1239896.1", - "ANG32427.1", - "ANG10038.1", - "ANG15290.1", - "ANG31811.1", - "ANG18929.1", - "ANG24592.1", - "ANG19121.1", - "ANG22186.1", - "ANG17092.1", - "HAI6872260.1", - "HAS9376541.1", - "ANG23677.1", - "ANG30415.1", - "ANG12696.1", - "ANG24706.1", - "ANG31363.1", - "ANG25919.1", - "ANG17861.1", - "ANG18665.1", - "ANG31159.1", - "WP_241312872.1", - "ANG17982.1", - "ANG23579.1", - "EDC4633317.1", - "ANG23305.1", - "ANG19419.1", - "HAW5807676.1", - "ANG22525.1", - "WP_249866686.1", - "ANG24558.1", - "ANG20310.1", - "ANG29078.1", - "ANG24407.1", - "ANG14724.1", - "ANG17944.1", - "MDV1392406.1", - "ANG25733.1", - "WP_109791210.1", - "ANG09890.1", -] diff --git a/examples/networks/test.ipynb b/examples/networks/test.ipynb new file mode 100644 index 00000000..dfdaca10 --- /dev/null +++ b/examples/networks/test.ipynb @@ -0,0 +1,14988 @@ +{ + "cells": [ + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "# Network Visualization" + ] + }, + { + "cell_type": "code", + "execution_count": 1, + "metadata": {}, + "outputs": [], + "source": [ + "%reload_ext autoreload\n", + "%autoreload 2\n", + "from pyeed.core import ProteinInfo, Alignment\n", + "from pyeed.aligners import ClustalOmega, PairwiseAligner\n", + "from pyeed.network import SequenceNetwork" + ] + }, + { + "cell_type": "code", + "execution_count": 2, + "metadata": {}, + "outputs": [], + "source": [ + "# Get a query sequence from NCBI\n", + "metTK = ProteinInfo.from_ncbi(\"WP_011249500.1\")" + ] + }, + { + "cell_type": "code", + "execution_count": 3, + "metadata": {}, + "outputs": [ + { + "name": "stdout", + "output_type": "stream", + "text": [ + "πŸƒ Running BLAST\n" + ] + }, + { + "name": "stderr", + "output_type": "stream", + "text": [ + "⬇️ Fetching protein sequences: 100%|β–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–‰| 499/500 [00:53<00:00, 9.38it/s]\n" + ] + } + ], + "source": [ + "# Run local blastp search\n", + "blast_results = metTK.blastp(\n", + " db_path=\"/Users/max/Documents/GitHub/blast-db/data/source\",\n", + " n_hits=500,\n", + " ncbi_key=\"fc08205c4aad544871863f0eb134f5524707\",\n", + ")" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "## MSA with Clustal Omega" + ] + }, + { + "cell_type": "code", + "execution_count": 4, + "metadata": {}, + "outputs": [ + { + "name": "stdout", + "output_type": "stream", + "text": [ + "πŸƒ Running CLUSTALO\n", + "\u001b[4mStandardNumbering\u001b[0m\n", + "β”œβ”€β”€ \u001b[94mid\u001b[0m = standardnumbering456\n", + "β”œβ”€β”€ \u001b[94mreference_id\u001b[0m = MBP1912539.1\n", + "β”œβ”€β”€ \u001b[94mnumbered_id\u001b[0m = WP_254809959.1\n", + "└── \u001b[94mnumbering\u001b[0m = [0.1, 0.2, 0.3, 0.4, 0.5, ...]\n", + "\n" + ] + } + ], + "source": [ + "alignment = Alignment.from_sequences(blast_results, aligner=ClustalOmega)\n", + "print(alignment.standard_numberings[456])" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "## Multi Pairwise Alignment" + ] + }, + { + "cell_type": "code", + "execution_count": 5, + "metadata": {}, + "outputs": [ + { + "name": "stderr", + "output_type": "stream", + "text": [ + "⛓️ Running pairwise alignments: 100%|β–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆ| 124251/124251 [00:31<00:00, 3922.61it/s]\n" + ] + } + ], + "source": [ + "# Create and run alignment\n", + "multi_parwise_alignments = Alignment.from_sequences(\n", + " blast_results, aligner=PairwiseAligner)" + ] + }, + { + "cell_type": "code", + "execution_count": 21, + "metadata": {}, + "outputs": [ + { + "data": { + "application/vnd.plotly.v1+json": { + "config": { + "plotlyServerURL": "https://plot.ly" + }, + "data": [ + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Thermococcus stetteri", + "Euryarchaeota", + "Thermococcales", + "MBP1912539.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(56, 87, 139)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.028675575339694632 + ], + "y": [ + -0.05914303983996185 + ], + "z": [ + 0.035138402930357054 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermococcus thioreducens", + "Euryarchaeota", + "Thermococcales", + "SEV92896.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(218, 227, 40)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.031616695097073634 + ], + "y": [ + -0.049983867562733174 + ], + "z": [ + 0.03479305031478188 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermococcus sp.", + "Euryarchaeota", + "Thermococcales", + "MBO8174569.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(187, 223, 43)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.049424926856601645 + ], + "y": [ + -0.04400606477685095 + ], + "z": [ + 0.017100117184334525 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermococcus paralvinellae", + "Euryarchaeota", + "Thermococcales", + "WP_042680787.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(54, 92, 140)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.044851386532041425 + ], + "y": [ + -0.0312957547386347 + ], + "z": [ + 0.003476282301678805 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermococci archaeon", + "Euryarchaeota", + null, + "NPA47376.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(37, 135, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.0799945093933448 + ], + "y": [ + -0.03137989754200982 + ], + "z": [ + 0.039980577968213575 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermococcus sp. MV5", + "Euryarchaeota", + "Thermococcales", + "WP_167889085.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(56, 88, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.030288387015158083 + ], + "y": [ + -0.02059042323356212 + ], + "z": [ + 0.03333762743571547 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Palaeococcus pacificus", + "Euryarchaeota", + "Thermococcales", + "WP_048165429.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(62, 73, 137)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.03832358661127394 + ], + "y": [ + -0.02555257945087879 + ], + "z": [ + 0.03198043495880474 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Thermococcus sibiricus MM 739", + "Euryarchaeota", + "Thermococcales", + "ACS90033.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(45, 113, 142)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.044764506206828106 + ], + "y": [ + -0.041360329676408424 + ], + "z": [ + 0.0398077313905213 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Palaeococcus ferrophilus", + "Euryarchaeota", + "Thermococcales", + "WP_048148317.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(168, 219, 51)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.04883716039647858 + ], + "y": [ + -0.05134837792638096 + ], + "z": [ + 0.052350402137325676 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Palaeococcus sp. (in: euryarchaeotes)", + "Euryarchaeota", + "Thermococcales", + "MCD6559773.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(46, 111, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.039367353296982974 + ], + "y": [ + -0.0335234905362738 + ], + "z": [ + 0.025014982055787477 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Pyrococcus yayanosii", + "Euryarchaeota", + "Thermococcales", + "WP_013904864.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(37, 134, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.04188541034518397 + ], + "y": [ + -0.0491229572124836 + ], + "z": [ + 0.0740839237776107 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase (EC 2.5.1.6)", + "Pyrococcus abyssi GE5", + "Euryarchaeota", + "Thermococcales", + "CAB49302.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 46, 123)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase (EC 2.5.1.6)", + "type": "scatter3d", + "x": [ + 0.06866289397638518 + ], + "y": [ + -0.02978800846263075 + ], + "z": [ + 0.038812415096958756 + ] + }, + { + "customdata": [ + [ + "404aa long hypothetical protein", + "Pyrococcus horikoshii OT3", + "Euryarchaeota", + "Thermococcales", + "BAA30943.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(66, 60, 130)", + "size": 7 + }, + "mode": "markers", + "text": "404aa long hypothetical protein", + "type": "scatter3d", + "x": [ + 0.08366271055485379 + ], + "y": [ + -0.02068551686293689 + ], + "z": [ + 0.040606221253392596 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "NOZ59931.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.010701535178269064 + ], + "y": [ + -0.04144038652594561 + ], + "z": [ + 0.0014901504148083487 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Desulfocapsa sp.", + "Thermodesulfobacteriota", + "Desulfobulbales", + "RUM44621.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(36, 137, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.07437635104807512 + ], + "y": [ + -0.019643238224396363 + ], + "z": [ + -0.012139829023534648 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanocaldococcus villosus", + "Euryarchaeota", + "Methanococci", + "WP_004590981.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(91, 198, 99)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.013417036391145899 + ], + "y": [ + -0.06832459069420671 + ], + "z": [ + 0.027695836449154045 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanocaldococcus infernus", + "Euryarchaeota", + "Methanococci", + "WP_013100562.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(239, 229, 38)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.006485300214870387 + ], + "y": [ + -0.03872127523294707 + ], + "z": [ + 0.03418189432493001 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Diapherotrites archaeon", + "Candidatus Diapherotrites", + null, + "NPA76954.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(156, 216, 59)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.08609401571230285 + ], + "y": [ + -0.044319143703572 + ], + "z": [ + 0.07535351638238537 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Archaeoglobales archaeon", + "Euryarchaeota", + "Archaeoglobales", + "RLI88365.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(42, 120, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.10893543004628325 + ], + "y": [ + -0.019302088378659037 + ], + "z": [ + -0.030897221084917496 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Archaeoglobus veneficus", + "Euryarchaeota", + "Archaeoglobales", + "WP_013683710.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(68, 4, 87)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.10052871914543009 + ], + "y": [ + -0.015908654151138082 + ], + "z": [ + -0.016804775626263774 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Hadesarchaea archaeon CG08_land_8_20_14_0_20_51_8", + "Candidatus Hadarchaeota", + null, + "PIU13897.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 19, 101)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.14747741286042912 + ], + "y": [ + 0.10134272869553156 + ], + "z": [ + 0.2874758230590554 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Archaeoglobus profundus", + "Euryarchaeota", + "Archaeoglobales", + "HIP58397.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(68, 3, 86)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.09359286417257973 + ], + "y": [ + -0.027453189181744185 + ], + "z": [ + -0.008170245515089467 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Geoglobus acetivorans", + "Euryarchaeota", + "Archaeoglobales", + "MBE8539338.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 190, 110)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.0854582222349352 + ], + "y": [ + -0.022866568726110734 + ], + "z": [ + -0.00537414522264022 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "NPA75857.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.1638554696839962 + ], + "y": [ + -0.15461559685326173 + ], + "z": [ + 0.0747309378619657 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Geoglobus ahangari", + "Euryarchaeota", + "Archaeoglobales", + "WP_048096291.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(61, 74, 137)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.0761899675558273 + ], + "y": [ + -0.016743539837154743 + ], + "z": [ + -0.003429534380549993 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "HIQ10138.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.0850099337833169 + ], + "y": [ + -0.04645980949776353 + ], + "z": [ + 0.11210190719355945 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Archaeoglobales archaeon", + "Euryarchaeota", + "Archaeoglobales", + "RLI75855.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(42, 120, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.10311250389629902 + ], + "y": [ + -0.04221364341931126 + ], + "z": [ + 0.0025840150802398493 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Archaeoglobales archaeon", + "Euryarchaeota", + "Archaeoglobales", + "RLI80102.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(42, 120, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.08042483963614347 + ], + "y": [ + -0.03223963497457793 + ], + "z": [ + -0.0011959680922410778 + ] + }, + { + "customdata": [ + [ + "Methionine adenosyltransferase", + "Methanotorris formicicus Mc-S-70", + "Euryarchaeota", + "Methanococci", + "EHP84035.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(71, 35, 115)", + "size": 7 + }, + "mode": "markers", + "text": "Methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.021371171215151454 + ], + "y": [ + -0.04238749287292927 + ], + "z": [ + 0.020246127404231852 + ] + }, + { + "customdata": [ + [ + "Chain A, S-adenosylmethionine synthase", + "Methanocaldococcus jannaschii DSM 2661", + "Euryarchaeota", + "Methanococci", + "7P82_A" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 20, 102)", + "size": 7 + }, + "mode": "markers", + "text": "Chain A, S-adenosylmethionine synthase", + "type": "scatter3d", + "x": [ + 0.006232108147667765 + ], + "y": [ + -0.06084446473004582 + ], + "z": [ + 0.03804770210232047 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Archaeoglobales archaeon", + "Euryarchaeota", + "Archaeoglobales", + "NHW22645.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(42, 120, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.08450861422367133 + ], + "y": [ + -0.0010986100262206356 + ], + "z": [ + 0.03210138613497796 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Archaeoglobus sulfaticallidus", + "Euryarchaeota", + "Archaeoglobales", + "WP_015589840.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(65, 63, 132)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.12346471072296446 + ], + "y": [ + -0.023186608198186093 + ], + "z": [ + -0.03417498644708647 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Archaeoglobus neptunius", + "Euryarchaeota", + "Archaeoglobales", + "WP_202319859.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(232, 228, 39)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.11074014002737599 + ], + "y": [ + -0.02534085838243956 + ], + "z": [ + 0.009452864988432006 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Archaeoglobus sp.", + "Euryarchaeota", + "Archaeoglobales", + "MBO8182227.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(199, 224, 41)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.06546585754654233 + ], + "y": [ + -0.03129373312803644 + ], + "z": [ + 0.0006469344275514806 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Archaeoglobaceae archaeon", + "Euryarchaeota", + "Archaeoglobales", + "MCS7144229.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(51, 180, 123)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.08115418433601117 + ], + "y": [ + -0.043223014361073876 + ], + "z": [ + 0.025050330439572832 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Mnemosynella bozhongmuii", + "Euryarchaeota", + "Candidatus Mnemosynellales", + "MBC7114233.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(43, 119, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.06464359093197061 + ], + "y": [ + -0.03920990260852762 + ], + "z": [ + 0.015670282645506864 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "RLG20733.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 21, 103)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1122325250135049 + ], + "y": [ + -0.003236333773074673 + ], + "z": [ + -0.025616219187483733 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "archaeon BMS3Bbin15", + null, + null, + "GBE54704.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(68, 53, 126)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.03421803446283126 + ], + "y": [ + -0.05380906128109972 + ], + "z": [ + -0.0232153770399014 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanothrix sp.", + "Euryarchaeota", + "Methanomicrobia", + "MBK7386953.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(164, 218, 54)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.19716415196308 + ], + "y": [ + 0.030923929750481836 + ], + "z": [ + -0.01699499503640588 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoprotei archaeon", + "Thermoproteota", + null, + "RLF18434.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(183, 222, 43)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.17426691656091914 + ], + "y": [ + 0.0771392621728698 + ], + "z": [ + 0.013426606977589916 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Methanoperedens nitroreducens", + "Euryarchaeota", + "Methanomicrobia", + "WP_048092961.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(64, 68, 134)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.13410614854259986 + ], + "y": [ + 0.0021264229406386483 + ], + "z": [ + -0.05814944227260199 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "UZE92607.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 21, 103)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.12445425249463167 + ], + "y": [ + -0.027618930059259094 + ], + "z": [ + -0.048865594832052765 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Aciduliprofundum boonei T469", + "Candidatus Thermoplasmatota", + "Aciduliprofundum", + "EDY36469.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(33, 152, 138)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.2135283421354843 + ], + "y": [ + -0.2059801408401477 + ], + "z": [ + 0.08740196081599269 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthase", + "Methanosaeta sp. PtaB.Bin039", + "Euryarchaeota", + "Methanomicrobia", + "OPX77490.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(71, 28, 109)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthase", + "type": "scatter3d", + "x": [ + -0.21385735090411642 + ], + "y": [ + 0.03286049488384262 + ], + "z": [ + -0.015409281932549484 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methermicoccus shengliensis", + "Euryarchaeota", + "Methanomicrobia", + "WP_042687265.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(44, 172, 128)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.11782783374265722 + ], + "y": [ + -0.02276075055290794 + ], + "z": [ + -0.017199873100469325 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Archaeoglobus sp.", + "Euryarchaeota", + "Archaeoglobales", + "RUM35208.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(199, 224, 41)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.11950214689321906 + ], + "y": [ + -0.030122015976170778 + ], + "z": [ + 0.023540797616974734 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "MBU4491309.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1423740123120926 + ], + "y": [ + -0.009037198344798172 + ], + "z": [ + -0.042382731396733146 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanothrix", + "Euryarchaeota", + "Methanomicrobia", + "WP_011695912.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(38, 130, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1744467217653833 + ], + "y": [ + 0.010747020028385089 + ], + "z": [ + 0.0021129471278614714 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Archaeoglobus veneficus", + "Euryarchaeota", + "Archaeoglobales", + "HDD36689.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(68, 4, 87)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.12824734631872375 + ], + "y": [ + -0.01841016246026658 + ], + "z": [ + -0.007912137218673858 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanothermus fervidus", + "Euryarchaeota", + "Methanobacteria", + "WP_013414187.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(166, 219, 52)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.06626250530399498 + ], + "y": [ + -0.01663244526525872 + ], + "z": [ + -0.08980170125996155 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Archaeoglobales archaeon", + "Euryarchaeota", + "Archaeoglobales", + "RLI84851.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(42, 120, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.11973321136064793 + ], + "y": [ + -0.024732809160443715 + ], + "z": [ + 0.03603371161823332 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanohalophilus sp. RSK", + "Euryarchaeota", + "Methanomicrobia", + "WP_123137136.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(152, 215, 61)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.14841558927220785 + ], + "y": [ + -0.01968769434312013 + ], + "z": [ + -0.056928525252301826 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Methanoperedens sp.", + "Euryarchaeota", + "Methanomicrobia", + "MCE8423993.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(45, 114, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.13484870962314233 + ], + "y": [ + -0.011412024482289507 + ], + "z": [ + -0.04268061496931407 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Archaeoglobales archaeon ex4484_92", + "Euryarchaeota", + "Archaeoglobales", + "OYT33403.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(69, 13, 95)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.12018451421367363 + ], + "y": [ + -0.04707262747968173 + ], + "z": [ + 0.026579785748234563 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "MBI5252857.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.0017836843574728885 + ], + "y": [ + -0.04834356455977197 + ], + "z": [ + 0.04764362132134663 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanocellales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MCD5409487.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(68, 5, 88)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.14749152171913743 + ], + "y": [ + -0.0020403905497471163 + ], + "z": [ + 0.005270125360743181 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcina sp. DH2", + "Euryarchaeota", + "Methanomicrobia", + "WP_229389494.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(69, 16, 97)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.17051480397426466 + ], + "y": [ + -0.02800669086439097 + ], + "z": [ + -0.051943767564206905 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthase", + "uncultured archaeon", + "environmental samples", + null, + "VVB88143.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(35, 162, 134)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthase", + "type": "scatter3d", + "x": [ + -0.14429453575373655 + ], + "y": [ + 0.009815298200922137 + ], + "z": [ + -0.05272984912892373 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcina sp. MTP4", + "Euryarchaeota", + "Methanomicrobia", + "WP_048181864.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(59, 81, 138)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.15021405908524704 + ], + "y": [ + -0.002311546925185018 + ], + "z": [ + -0.06693221326758166 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "NYT01285.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 21, 103)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.19191091347116368 + ], + "y": [ + 0.04110931631589917 + ], + "z": [ + -0.04708814236890892 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "MCI4364258.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.11949200622959372 + ], + "y": [ + -0.11568945856796145 + ], + "z": [ + 0.10387897672137622 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Archaeoglobales archaeon", + "Euryarchaeota", + "Archaeoglobales", + "NHW89294.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(42, 120, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.12867821719087305 + ], + "y": [ + -0.03066065753120214 + ], + "z": [ + 0.018974548095716283 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthase", + "Methanosaeta sp. PtaU1.Bin060", + "Euryarchaeota", + "Methanomicrobia", + "OPY54184.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(109, 206, 88)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthase", + "type": "scatter3d", + "x": [ + -0.19242928593640776 + ], + "y": [ + 0.020290961750487523 + ], + "z": [ + -0.05390568887558912 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanococcus vannielii", + "Euryarchaeota", + "Methanococci", + "WP_012065777.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(32, 155, 138)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.007839449757103626 + ], + "y": [ + -0.05511328573131355 + ], + "z": [ + -0.0199217673628612 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoprotei archaeon", + "Thermoproteota", + null, + "RLF24428.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(183, 222, 43)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.18614181688288073 + ], + "y": [ + 0.08886743329872115 + ], + "z": [ + 0.025008057827424816 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "MCI4360054.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.1370417223420742 + ], + "y": [ + -0.14281762425853023 + ], + "z": [ + 0.10776345738340747 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanothrix sp.", + "Euryarchaeota", + "Methanomicrobia", + "MCK9441463.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(164, 218, 54)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.20183946684930779 + ], + "y": [ + 0.026809425149816532 + ], + "z": [ + -0.042832751064901045 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MBW6470267.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(38, 131, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1771389624518166 + ], + "y": [ + -0.006791088821448662 + ], + "z": [ + -0.04798190191607273 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Archaeoglobaceae archaeon", + "Euryarchaeota", + "Archaeoglobales", + "MCS7122278.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(51, 180, 123)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.11363644615098606 + ], + "y": [ + -0.04398401640267559 + ], + "z": [ + 0.04070403304985813 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthase", + "uncultured archaeon", + "environmental samples", + null, + "VVB92588.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(35, 162, 134)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthase", + "type": "scatter3d", + "x": [ + -0.12561592963316726 + ], + "y": [ + -0.016628109702191966 + ], + "z": [ + -0.048465556132277154 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobacterium alcaliphilum", + "Euryarchaeota", + "Methanobacteria", + "WP_248611105.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(130, 210, 76)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.11722773893633405 + ], + "y": [ + 0.009754358535794755 + ], + "z": [ + -0.1196332539460114 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosalsum zhilinae", + "Euryarchaeota", + "Methanomicrobia", + "WP_048815409.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(123, 209, 80)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.17002002050107184 + ], + "y": [ + -0.0007660712936008951 + ], + "z": [ + -0.029798309163708736 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Archaeoglobaceae archaeon", + "Euryarchaeota", + "Archaeoglobales", + "HID43215.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(51, 180, 123)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1080161242981231 + ], + "y": [ + -0.014348138128589928 + ], + "z": [ + -0.017916765344304746 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanotrichaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "NPV61856.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(33, 160, 136)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.16687516514604725 + ], + "y": [ + 0.01656728885951054 + ], + "z": [ + -0.020152944008661754 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "MBU4077635.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.14861527753309517 + ], + "y": [ + 0.005745997515156888 + ], + "z": [ + -0.03638828251634966 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanotrichaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MBN1323584.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(33, 160, 136)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.19583837121851752 + ], + "y": [ + 0.020083071092354434 + ], + "z": [ + -0.019284611787619216 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthase", + "uncultured archaeon", + "environmental samples", + null, + "VVB62794.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(35, 162, 134)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthase", + "type": "scatter3d", + "x": [ + -0.1837613406423114 + ], + "y": [ + 0.036010481776322954 + ], + "z": [ + -0.05383791981449384 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Bathyarchaeota archaeon", + "Candidatus Bathyarchaeota", + null, + "RLG99681.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(55, 184, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.13182240628498057 + ], + "y": [ + -0.02134845504475399 + ], + "z": [ + -0.006677244190201808 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanothrix sp.", + "Euryarchaeota", + "Methanomicrobia", + "NMC09821.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(164, 218, 54)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.16150055121821183 + ], + "y": [ + 0.002332852549033516 + ], + "z": [ + -0.020878293099882813 + ] + }, + { + "customdata": [ + [ + "conserved protein", + "Methanothermobacter thermautotrophicus str. Delta H", + "Euryarchaeota", + "Methanobacteria", + "AAB85853.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(136, 212, 72)", + "size": 7 + }, + "mode": "markers", + "text": "conserved protein", + "type": "scatter3d", + "x": [ + -0.10165207356589565 + ], + "y": [ + 0.00021835944657785084 + ], + "z": [ + -0.09437256131666757 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "uncultured organism", + "environmental samples", + null, + "AGF93535.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(113, 207, 86)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.30509697577372197 + ], + "y": [ + 0.33464319162465295 + ], + "z": [ + 0.5949240523997081 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Methanosarcinales archaeon ex4572_44", + "Euryarchaeota", + "Methanomicrobia", + "PHP46028.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 36, 116)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.15997127354002005 + ], + "y": [ + -0.024596356211131917 + ], + "z": [ + -0.041056068784639306 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanotrichaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MCJ7444871.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(33, 160, 136)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.15735233625831171 + ], + "y": [ + 0.01867967076510215 + ], + "z": [ + -0.015521500647484901 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanolobus profundi", + "Euryarchaeota", + "Methanomicrobia", + "WP_091935294.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(95, 200, 97)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.16434881828749384 + ], + "y": [ + -0.008167803642008408 + ], + "z": [ + -0.05936833886044737 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanothrix sp.", + "Euryarchaeota", + "Methanomicrobia", + "MBP7070042.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(164, 218, 54)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.19857172539619822 + ], + "y": [ + 0.003731225716596555 + ], + "z": [ + -0.024004092866657268 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "MCI4324893.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.11396322305145991 + ], + "y": [ + -0.11517508383825341 + ], + "z": [ + 0.08952590077397163 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobacteriaceae archaeon", + "Euryarchaeota", + "Methanobacteria", + "NYB27336.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(150, 215, 63)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1159464445874244 + ], + "y": [ + 0.004900997490069885 + ], + "z": [ + -0.10948620830254878 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "RLF67685.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.0887914279556507 + ], + "y": [ + -0.12689910812340505 + ], + "z": [ + 0.1131605690485117 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Methanolobus sp. T82-4", + "Euryarchaeota", + "Methanomicrobia", + "KXS44515.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(35, 141, 140)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.16613466162273277 + ], + "y": [ + -0.004088962522939051 + ], + "z": [ + -0.063906470782751 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MCD4704385.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(38, 131, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.16184436689568765 + ], + "y": [ + 0.008117639273246116 + ], + "z": [ + -0.06666634426916421 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthase", + "Methanomethylovorans sp. PtaU1.Bin093", + "Euryarchaeota", + "Methanomicrobia", + "OPY20232.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(71, 32, 113)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthase", + "type": "scatter3d", + "x": [ + -0.1868463273073264 + ], + "y": [ + -0.005369740436586959 + ], + "z": [ + -0.055410736477271225 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Methanococcus maripaludis", + "Euryarchaeota", + "Methanococci", + "AVB76578.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(71, 30, 111)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.005880938941084088 + ], + "y": [ + -0.08945405170001257 + ], + "z": [ + -0.018406948209041887 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "HJH29718.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(38, 131, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1642125892558234 + ], + "y": [ + -0.017303786416171134 + ], + "z": [ + -0.054735635470718066 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Archaeoglobaceae archaeon", + "Euryarchaeota", + "Archaeoglobales", + "MCS7143645.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(51, 180, 123)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.08515725058210763 + ], + "y": [ + -0.03134424558367831 + ], + "z": [ + 0.03639065725014678 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanothrix sp.", + "Euryarchaeota", + "Methanomicrobia", + "MBP8624531.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(164, 218, 54)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.16982214784854088 + ], + "y": [ + 0.008742630911699778 + ], + "z": [ + -0.03863867837875655 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobacterium alkalithermotolerans", + "Euryarchaeota", + "Methanobacteria", + "WP_211532318.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(189, 223, 42)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.0959118146511117 + ], + "y": [ + -0.014011358874037197 + ], + "z": [ + -0.09912847183937619 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MBN2110251.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(38, 131, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1584213817518695 + ], + "y": [ + -0.009903630884124943 + ], + "z": [ + -0.06717662788970788 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanohalophilus levihalophilus", + "Euryarchaeota", + "Methanomicrobia", + "WP_245312871.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(39, 167, 131)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.14854391357346586 + ], + "y": [ + -0.009021596349734352 + ], + "z": [ + -0.06961859058289133 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Methanoperedens sp. BLZ2", + "Euryarchaeota", + "Methanomicrobia", + "WP_097297927.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(63, 71, 136)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.14659150867117618 + ], + "y": [ + 0.004836302314429766 + ], + "z": [ + -0.06506936809066578 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "MBU2617480.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.10547233514527216 + ], + "y": [ + -0.03073759047990853 + ], + "z": [ + -0.0017148090959857008 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "HID28100.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 21, 103)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.15147732304593262 + ], + "y": [ + -0.024770516614231842 + ], + "z": [ + -0.025926865673923893 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobacterium sp.", + "Euryarchaeota", + "Methanobacteria", + "MCE5214126.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(44, 115, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.10545276416123912 + ], + "y": [ + 0.00008921738132678636 + ], + "z": [ + -0.12234741833333147 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Altiarchaeota archaeon", + "Candidatus Altarchaeota", + null, + "MBN2014929.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(80, 194, 106)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.015176482590192953 + ], + "y": [ + -0.04358666295745576 + ], + "z": [ + 0.167127941764437 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoprotei archaeon", + "Thermoproteota", + null, + "MCD6510857.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(183, 222, 43)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.22710393719211208 + ], + "y": [ + 0.14073759702008687 + ], + "z": [ + -0.004065861167016623 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "HJH31947.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(38, 131, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1675291086001379 + ], + "y": [ + -0.007132970970393257 + ], + "z": [ + -0.05577323022595608 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanolobus chelungpuianus", + "Euryarchaeota", + "Methanomicrobia", + "WP_256622243.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(251, 231, 37)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.13991920319601744 + ], + "y": [ + -0.01668525849872159 + ], + "z": [ + -0.07185803468160545 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Methanoperedenaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "HIH44319.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(205, 225, 41)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1664310260551494 + ], + "y": [ + -0.004399332077353898 + ], + "z": [ + -0.024377617358988315 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Nanopusillus sp.", + "Nanoarchaeota", + "Nanoarchaeales", + "HIP90423.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(66, 58, 129)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.03221144407756771 + ], + "y": [ + -0.0786075146470378 + ], + "z": [ + 0.045022077058054354 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "NLI62906.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(38, 131, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.12065827687904654 + ], + "y": [ + -0.02300825487376208 + ], + "z": [ + -0.032031886314911696 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MBO4302570.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(38, 131, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1477972275378231 + ], + "y": [ + 0.007635487523777142 + ], + "z": [ + -0.042746219738975536 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "MCD6502674.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.13871422048958143 + ], + "y": [ + -0.15425990327470115 + ], + "z": [ + 0.054875666540619684 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Aenigmarchaeota archaeon", + "Candidatus Aenigmarchaeota", + null, + "MBI2971037.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(85, 196, 103)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.7316955890335949 + ], + "y": [ + -0.7689958377265071 + ], + "z": [ + -0.8273934355894998 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanococcus voltae", + "Euryarchaeota", + "Methanococci", + "WP_209631652.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(69, 8, 90)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.00874669865468458 + ], + "y": [ + -0.10507514090102442 + ], + "z": [ + 0.006676919192234695 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Candidatus Syntrophoarchaeum caldarius", + "Euryarchaeota", + "Methanomicrobia", + "OFV67108.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(50, 102, 142)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.15825679109009405 + ], + "y": [ + -0.04236557131649251 + ], + "z": [ + -0.011714545277134386 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthase", + "Candidatus Methanoperedenaceae archaeon GB37", + "Euryarchaeota", + "Methanomicrobia", + "CAD7775635.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(86, 196, 102)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthase", + "type": "scatter3d", + "x": [ + -0.15824828608861205 + ], + "y": [ + -0.014512671889932908 + ], + "z": [ + -0.03233405283973844 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoprotei archaeon", + "Thermoproteota", + null, + "MCD6095735.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(183, 222, 43)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.1722635611235355 + ], + "y": [ + 0.07388366594362433 + ], + "z": [ + 0.01363687033721926 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Alkanophagales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "RLG39174.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(224, 227, 39)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.19897929480815174 + ], + "y": [ + -0.07526862113283189 + ], + "z": [ + 0.05047200099717791 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobacterium aggregans", + "Euryarchaeota", + "Methanobacteria", + "WP_209583443.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(68, 1, 84)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.090546688048149 + ], + "y": [ + -0.002345913351296194 + ], + "z": [ + -0.09821734828080012 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "MCI4352892.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.11282271796842143 + ], + "y": [ + -0.13265378986814852 + ], + "z": [ + 0.11695899263280493 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Methanobacterium sp. BRmetb2", + "Euryarchaeota", + "Methanobacteria", + "AXV37642.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(37, 132, 142)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.10909500645011525 + ], + "y": [ + -0.0025347125375425853 + ], + "z": [ + -0.12975075751345108 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanothermococcus okinawensis", + "Euryarchaeota", + "Methanococci", + "HIQ32451.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(42, 170, 129)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.041981302373887176 + ], + "y": [ + -0.07877453739594639 + ], + "z": [ + 0.03497136165569438 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Euryarchaeota archaeon RBG_19FT_COMBO_69_17", + "Euryarchaeota", + null, + "OGS64371.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(174, 221, 47)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.1952593099636586 + ], + "y": [ + -0.19607031668252936 + ], + "z": [ + 0.11765428471979096 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoprotei archaeon", + "Thermoproteota", + null, + "RLE54635.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(183, 222, 43)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.23680129399496494 + ], + "y": [ + 0.11360200717857691 + ], + "z": [ + -0.0023823784888495044 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanothermobacter tenebrarum", + "Euryarchaeota", + "Methanobacteria", + "WP_112094483.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(127, 210, 77)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.05302314873314141 + ], + "y": [ + -0.015086048983142905 + ], + "z": [ + -0.10128257729916113 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Methanoperedenaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MBE0521418.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(205, 225, 41)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1563359968086937 + ], + "y": [ + 0.011659989790767433 + ], + "z": [ + -0.05074945680060356 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobrevibacter sp.", + "Euryarchaeota", + "Methanobacteria", + "MCL2114715.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(35, 142, 140)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.07792100382142753 + ], + "y": [ + -0.00042151854522804567 + ], + "z": [ + -0.10475879492549077 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanolobus", + "Euryarchaeota", + "Methanomicrobia", + "WP_023845034.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(207, 225, 41)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.16968943103797068 + ], + "y": [ + -0.00212801409496949 + ], + "z": [ + -0.0723000126855892 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "MCI4340171.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.14797778966311698 + ], + "y": [ + -0.1611366076707721 + ], + "z": [ + 0.14252477835754554 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanimicrococcus blatticola", + "Euryarchaeota", + "Methanomicrobia", + "WP_133517937.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(142, 213, 68)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.16927977211387488 + ], + "y": [ + -0.01980568179165152 + ], + "z": [ + -0.04897236525965892 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "MCI4332674.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.11055203727224927 + ], + "y": [ + -0.12685751828316616 + ], + "z": [ + 0.09833673122073619 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthase", + "Methanonatronarchaeales archaeon", + "Euryarchaeota", + "Methanonatronarchaeales", + "MBS1263960.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(67, 189, 113)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthase", + "type": "scatter3d", + "x": [ + -0.05360200533865334 + ], + "y": [ + 0.04952331414660547 + ], + "z": [ + -0.016303149360144847 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanonatronarchaeum thermophilum", + "Euryarchaeota", + "Methanonatronarchaeales", + "WP_086636802.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(65, 188, 114)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.35462602461557335 + ], + "y": [ + -0.1779233339572418 + ], + "z": [ + -0.019033175032879684 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthase", + "Candidatus Methanobinarius endosymbioticus", + "Euryarchaeota", + "Methanobacteria", + "RBQ22678.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(69, 7, 89)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthase", + "type": "scatter3d", + "x": [ + -0.0631714425370439 + ], + "y": [ + -0.002574357466363141 + ], + "z": [ + -0.10837153549467482 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "MCI4350047.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.14249035122442957 + ], + "y": [ + -0.11954524773950408 + ], + "z": [ + 0.12847824388089069 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanothermococcus okinawensis", + "Euryarchaeota", + "Methanococci", + "WP_013866510.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(42, 170, 129)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.024197519941884665 + ], + "y": [ + -0.09486445309007328 + ], + "z": [ + 0.04273130829091148 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Desulfurococcales archaeon", + "Thermoproteota", + "Desulfurococcales", + "HIQ03509.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(52, 97, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.24557690103183105 + ], + "y": [ + 0.1433013535746454 + ], + "z": [ + -0.003157537113872325 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MCL5678960.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.21479560342095114 + ], + "y": [ + -0.17121845486626572 + ], + "z": [ + 0.06265472727334104 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobacterium", + "Euryarchaeota", + "Methanobacteria", + "WP_069583781.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 48, 124)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.09316648869301598 + ], + "y": [ + -0.007153199677038329 + ], + "z": [ + -0.1392122963882012 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Ignisphaera sp.", + "Thermoproteota", + "Desulfurococcales", + "HID80336.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(55, 89, 140)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.21536575401618768 + ], + "y": [ + 0.10381000364249961 + ], + "z": [ + 0.015488352937796686 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Methanobacteriales archaeon HGW-Methanobacteriales-1", + "Euryarchaeota", + "Methanobacteria", + "PKL67098.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(31, 156, 137)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.09291948475891493 + ], + "y": [ + 0.0038402431462824503 + ], + "z": [ + -0.11200331225539714 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanothermococcus", + "Euryarchaeota", + "Methanococci", + "WP_018154351.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(63, 187, 115)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.02746290158782535 + ], + "y": [ + -0.06665136816761695 + ], + "z": [ + -0.004125252437532542 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanothermococcus okinawensis", + "Euryarchaeota", + "Methanococci", + "HIP16080.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(42, 170, 129)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.034806549167802556 + ], + "y": [ + -0.09154837519569771 + ], + "z": [ + 0.031077759124105556 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanimicrococcus sp.", + "Euryarchaeota", + "Methanomicrobia", + "MCL2863353.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(32, 159, 136)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.14800215161679592 + ], + "y": [ + -0.01651891754285943 + ], + "z": [ + -0.06958985867207028 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "MCI4331890.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.12021460168151984 + ], + "y": [ + -0.12403006197482656 + ], + "z": [ + 0.12767053957184404 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "HDJ38237.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 21, 103)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.14696129494109383 + ], + "y": [ + 0.012464343226967635 + ], + "z": [ + -0.048785393297839486 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MCD6146309.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 21, 103)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.12601980803034105 + ], + "y": [ + 0.03049306394032127 + ], + "z": [ + -0.0401931151709949 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "MBI5000778.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.1678499163443128 + ], + "y": [ + -0.1881889199169077 + ], + "z": [ + 0.12650897399621402 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MBN2488116.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(38, 131, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1779702304045189 + ], + "y": [ + -0.00980450336606035 + ], + "z": [ + -0.06993890018197632 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "MCI4365484.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.14565001629409113 + ], + "y": [ + -0.1411017608416584 + ], + "z": [ + 0.15623123388944077 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobrevibacter cuticularis", + "Euryarchaeota", + "Methanobacteria", + "WP_067260239.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(61, 76, 137)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.10400832098558453 + ], + "y": [ + 0.008489362210027768 + ], + "z": [ + -0.1405962383239295 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "NYT19736.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 21, 103)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.16879792703088775 + ], + "y": [ + -0.015936907401244964 + ], + "z": [ + -0.03698034449498897 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanogenium sp.", + "Euryarchaeota", + "Methanomicrobia", + "MCK4269415.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(71, 31, 112)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.18756218501893857 + ], + "y": [ + -0.046470333538457566 + ], + "z": [ + -0.08779583663169724 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanotrichaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "HII06378.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(33, 160, 136)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.2017922078139833 + ], + "y": [ + 0.026866272783150385 + ], + "z": [ + -0.03248397785742827 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Altiarchaeales archaeon", + "Candidatus Altarchaeota", + null, + "HIE33825.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(195, 224, 42)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.06969477814210154 + ], + "y": [ + -0.06856256048959092 + ], + "z": [ + 0.2416421564104299 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MCD5425932.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(38, 131, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.14477250406200107 + ], + "y": [ + -0.0118725881270079 + ], + "z": [ + -0.06562145295236818 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MCL4338039.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.24764875642402912 + ], + "y": [ + -0.212492666152551 + ], + "z": [ + 0.07800911505345234 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobacterium paludis", + "Euryarchaeota", + "Methanobacteria", + "WP_013826834.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(75, 192, 108)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.10462061173114819 + ], + "y": [ + -0.0033843621258078447 + ], + "z": [ + -0.14302609729740245 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Ignisphaera aggregans DSM 17230", + "Thermoproteota", + "Desulfurococcales", + "ADM28331.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(158, 217, 58)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.21795741142848096 + ], + "y": [ + 0.10649453582891345 + ], + "z": [ + -0.0018537640193095862 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobacterium sp.", + "Euryarchaeota", + "Methanobacteria", + "MBI5679298.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(44, 115, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.0865347291667926 + ], + "y": [ + 0.018801582446306014 + ], + "z": [ + -0.1288545989124389 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoprotei archaeon", + "Thermoproteota", + null, + "RLG86775.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(183, 222, 43)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.23129944403255356 + ], + "y": [ + 0.12775897583647183 + ], + "z": [ + -0.010672118593177302 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanospirillum sp.", + "Euryarchaeota", + "Methanomicrobia", + "NLX49570.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(47, 176, 125)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.2069493325845314 + ], + "y": [ + -0.029850735690129918 + ], + "z": [ + -0.06644650496592647 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanocalculus chunghsingensis", + "Euryarchaeota", + "Methanomicrobia", + "WP_211530438.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(68, 189, 112)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.19483003210561553 + ], + "y": [ + -0.04364077326561369 + ], + "z": [ + -0.08984687065939558 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanolinea sp.", + "Euryarchaeota", + "Methanomicrobia", + "MCQ8894229.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(48, 107, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.20365030454484867 + ], + "y": [ + -0.018768456800657547 + ], + "z": [ + -0.06905448826957801 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanothermococcus sp. SCGC AD-155-N22", + "Euryarchaeota", + "Methanococci", + "MBW9220344.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(226, 228, 39)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.00697542498036542 + ], + "y": [ + -0.08552038801379758 + ], + "z": [ + 0.036852856025140136 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthase", + "Candidatus Argoarchaeum ethanivorans", + "Euryarchaeota", + "Methanomicrobia", + "CAD6493058.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 18, 100)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthase", + "type": "scatter3d", + "x": [ + -0.17562512714342143 + ], + "y": [ + 0.01917198761724613 + ], + "z": [ + -0.04551034113936281 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "HDN65233.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 21, 103)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.12885558645881293 + ], + "y": [ + 0.034168223181985584 + ], + "z": [ + -0.044606368111615245 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoprotei archaeon", + "Thermoproteota", + null, + "RLF08155.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(183, 222, 43)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.3411242229172502 + ], + "y": [ + 0.1955827556735402 + ], + "z": [ + 0.010596214477701892 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanococcoides sp.", + "Euryarchaeota", + "Methanomicrobia", + "NOQ48507.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(31, 157, 137)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.16574362413803 + ], + "y": [ + 0.012552987805514235 + ], + "z": [ + -0.06290226599891066 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoprotei archaeon", + "Thermoproteota", + null, + "RLE93954.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(183, 222, 43)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.23085157663469544 + ], + "y": [ + 0.10495776041391242 + ], + "z": [ + -0.0048471106380660045 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MCK4652251.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 21, 103)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.12563671987426422 + ], + "y": [ + 0.012779291842688436 + ], + "z": [ + -0.0427602506039745 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Verstraetearchaeota archaeon", + "Candidatus Verstraetearchaeota", + null, + "RLE48238.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(49, 179, 124)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.24770902893094301 + ], + "y": [ + 0.13896877957401957 + ], + "z": [ + -0.024268978155830654 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "archaeon SCG-AAA382B04", + null, + null, + "PTD93741.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(247, 230, 38)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.2457052738687439 + ], + "y": [ + -0.10787161800370966 + ], + "z": [ + -0.016732905404876847 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanoregulaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MCU0630815.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(36, 136, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.18124066353105675 + ], + "y": [ + -0.024990582221361718 + ], + "z": [ + -0.07506853080681558 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Thermofilum sp. ex4484_79", + "Thermoproteota", + "Thermofilales", + "OYT30676.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(117, 208, 83)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.28685566374194166 + ], + "y": [ + 0.15885768908874445 + ], + "z": [ + 0.010087926507622899 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanopyrus sp. KOL6", + "Euryarchaeota", + "Methanopyri", + "WP_088334627.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(34, 145, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.008059218496446316 + ], + "y": [ + 0.0279403753956204 + ], + "z": [ + 0.05887586717639593 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanomassiliicoccales archaeon", + "Candidatus Thermoplasmatota", + "Methanomassiliicoccales", + "NYT15305.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(33, 148, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.19407322438777438 + ], + "y": [ + -0.25116884635645503 + ], + "z": [ + 0.11355853731085083 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanonatronarchaeum sp. AMET6-2", + "Euryarchaeota", + "Methanonatronarchaeales", + "WP_247139346.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(67, 57, 129)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.36437971345757975 + ], + "y": [ + -0.16564214362494467 + ], + "z": [ + -0.010711333041154342 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Euryarchaeota archaeon RBG_16_67_27", + "Euryarchaeota", + null, + "OGS47575.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(121, 209, 81)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.19032886923685238 + ], + "y": [ + -0.192111578020866 + ], + "z": [ + 0.12324181594315371 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "MCU0852918.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.19216941142931396 + ], + "y": [ + -0.22385173693294635 + ], + "z": [ + 0.11506117655792947 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanomicrobiales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "NLV26673.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(58, 83, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.22403235695824872 + ], + "y": [ + -0.05538947978079897 + ], + "z": [ + -0.10622228585361415 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halanaeroarchaeum sulfurireducens", + "Euryarchaeota", + "Halobacteria", + "WP_050048754.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(55, 89, 140)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.02429343285158319 + ], + "y": [ + 0.1081669857102651 + ], + "z": [ + 0.00628429098397937 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Methanosphaera sp. rholeuAM74", + "Euryarchaeota", + "Methanobacteria", + "RAP48284.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(71, 27, 108)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.07957278174148531 + ], + "y": [ + 0.015340672363790032 + ], + "z": [ + -0.16297012266534813 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "MCD6462054.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.13295796512517621 + ], + "y": [ + -0.18218893338498002 + ], + "z": [ + 0.0894071465244476 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Altiarchaeales archaeon", + "Candidatus Altarchaeota", + null, + "RLI92042.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(195, 224, 42)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.04948230577928174 + ], + "y": [ + -0.06107199453400009 + ], + "z": [ + 0.16228798748617804 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmatales archaeon", + "Candidatus Thermoplasmatota", + "Thermoplasmatales", + "MCG2826556.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(162, 218, 55)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.17869440476341683 + ], + "y": [ + -0.2386021064193096 + ], + "z": [ + 0.11238184441351842 + ] + }, + { + "customdata": [ + [ + "Archaeal S-adenosylmethionine synthetase", + "Candidatus Methanohalarchaeum thermophilum", + "Euryarchaeota", + "Methanonatronarchaeales", + "OKY79041.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(53, 95, 141)", + "size": 7 + }, + "mode": "markers", + "text": "Archaeal S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.2336597158158538 + ], + "y": [ + -0.0891174554820183 + ], + "z": [ + -0.02499880553363204 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobacterium", + "Euryarchaeota", + "Methanobacteria", + "WP_048072774.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 48, 124)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.09410591572499323 + ], + "y": [ + 0.017804928223093718 + ], + "z": [ + -0.15539907532975245 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobacterium", + "Euryarchaeota", + "Methanobacteria", + "WP_100905321.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 48, 124)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.0758790210357579 + ], + "y": [ + 0.011243636006566865 + ], + "z": [ + -0.1479552654165619 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Picrophilus oshimae DSM 9789", + "Candidatus Thermoplasmatota", + "Thermoplasmatales", + "AAT43329.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(68, 54, 127)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.22253608905877492 + ], + "y": [ + -0.20766536501841856 + ], + "z": [ + 0.06163195439623853 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "archaeon", + null, + null, + "MCQ2972576.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(34, 147, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.08892090616772735 + ], + "y": [ + 0.014913588127451267 + ], + "z": [ + -0.1730756308978188 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "candidate division MSBL1 archaeon SCGC-AAA259B11", + "Euryarchaeota", + null, + "KXA90431.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(41, 122, 142)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.29099684021725636 + ], + "y": [ + 0.3246292356995954 + ], + "z": [ + 0.5978617826769219 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halapricum salinum", + "Euryarchaeota", + "Halobacteria", + "WP_049992581.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(54, 183, 121)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.01714175050004612 + ], + "y": [ + 0.14654606722994007 + ], + "z": [ + 0.010338094070339246 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosalsum natronophilum", + "Euryarchaeota", + "Methanomicrobia", + "WP_259135288.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(33, 151, 138)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1823842851340802 + ], + "y": [ + 0.007389022026663876 + ], + "z": [ + -0.06304771212923665 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobacterium sp. SMA-27", + "Euryarchaeota", + "Methanobacteria", + "WP_048191960.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 23, 105)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.10315432889045272 + ], + "y": [ + 0.014648012427053497 + ], + "z": [ + -0.12744191891900908 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Altiarchaeales archaeon", + "Candidatus Altarchaeota", + null, + "RLI88430.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(195, 224, 42)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.06953070201914466 + ], + "y": [ + -0.07617276616336964 + ], + "z": [ + 0.1718870278060451 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MCL4330426.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.23701984743471635 + ], + "y": [ + -0.18951519256842844 + ], + "z": [ + 0.08250687881840552 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "MCU0859210.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.18484475008717932 + ], + "y": [ + -0.20642002869830187 + ], + "z": [ + 0.13166776985840936 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "MBE0519066.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.16836650212791548 + ], + "y": [ + -0.21222050058098213 + ], + "z": [ + 0.12131076989437146 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanothrix sp.", + "Euryarchaeota", + "Methanomicrobia", + "MCR3884112.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(164, 218, 54)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.18684689890855508 + ], + "y": [ + 0.01639512507397615 + ], + "z": [ + -0.023855574631132342 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobrevibacter arboriphilus", + "Euryarchaeota", + "Methanobacteria", + "WP_054834771.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(39, 127, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.08488085862807515 + ], + "y": [ + -0.009369397150949355 + ], + "z": [ + -0.115310510197178 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MCL5731097.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.20904740932378235 + ], + "y": [ + -0.18399391364882794 + ], + "z": [ + 0.07127672575631301 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Aciduliprofundum sp.", + "Candidatus Thermoplasmatota", + "Aciduliprofundum", + "PMP73360.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(62, 72, 137)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.18235982200115802 + ], + "y": [ + -0.17191099156516731 + ], + "z": [ + 0.07883346705267746 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "HII39977.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.1777562975803727 + ], + "y": [ + -0.19902232164359626 + ], + "z": [ + 0.09375381811241569 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobacterium petrolearium", + "Euryarchaeota", + "Methanobacteria", + "WP_209624290.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(37, 133, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.10679574045649633 + ], + "y": [ + 0.018250267155412832 + ], + "z": [ + -0.1474906880282934 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MCL4328217.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.24494309423539093 + ], + "y": [ + -0.20316769176096122 + ], + "z": [ + 0.08120894479781908 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanocalculus sp. MSAO_Arc2", + "Euryarchaeota", + "Methanomicrobia", + "RQD85122.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(39, 167, 131)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.21523769846607446 + ], + "y": [ + -0.01782503441862869 + ], + "z": [ + -0.10934897257645215 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosphaera stadtmanae", + "Euryarchaeota", + "Methanobacteria", + "MBE6493246.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(69, 9, 91)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.08088682408744123 + ], + "y": [ + -0.009458862540939198 + ], + "z": [ + -0.1650347691988043 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Altiarchaeota archaeon", + "Candidatus Altarchaeota", + null, + "MBU0761834.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(80, 194, 106)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.11332742503636067 + ], + "y": [ + -0.05331006784671043 + ], + "z": [ + 0.1678265838728497 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanolinea mesophila", + "Euryarchaeota", + "Methanomicrobia", + "WP_209675974.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(64, 65, 133)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.21026931449716788 + ], + "y": [ + -0.013321187554352708 + ], + "z": [ + -0.07654572131199307 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanococcus aeolicus", + "Euryarchaeota", + "Methanococci", + "WP_011973179.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(32, 156, 137)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.00510196285798241 + ], + "y": [ + -0.07134983716701272 + ], + "z": [ + -0.01611679148741486 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halobacterium zhouii", + "Euryarchaeota", + "Halobacteria", + "WP_232685737.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 37, 117)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.017162747555887304 + ], + "y": [ + 0.1350515009712641 + ], + "z": [ + 0.02782966167934065 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Altiarchaeota archaeon", + "Candidatus Altarchaeota", + null, + "MBN2251254.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(80, 194, 106)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.0950750962923393 + ], + "y": [ + -0.07321600384014099 + ], + "z": [ + 0.23304014041150656 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MCL4343227.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.24251544545733 + ], + "y": [ + -0.19113169915442277 + ], + "z": [ + 0.0717869933288511 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanimicrococcus sp.", + "Euryarchaeota", + "Methanomicrobia", + "MCL2142194.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(32, 159, 136)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.15862896847075028 + ], + "y": [ + -0.029993169071903532 + ], + "z": [ + -0.04939759919091712 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosphaera sp. BMS", + "Euryarchaeota", + "Methanobacteria", + "WP_112123877.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(68, 53, 127)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.08866785199804664 + ], + "y": [ + 0.02855832193950032 + ], + "z": [ + -0.13945011174836328 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanophagales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MCD6203804.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(63, 70, 135)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.25318376983863766 + ], + "y": [ + -0.08594194569466573 + ], + "z": [ + 0.07412004405604884 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Aenigmarchaeota archaeon", + "Candidatus Aenigmarchaeota", + null, + "MBI5355160.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(85, 196, 103)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.6235854916316999 + ], + "y": [ + 0.052979547354738456 + ], + "z": [ + -1 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanoregula boonei", + "Euryarchaeota", + "Methanomicrobia", + "WP_012106609.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 45, 123)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.18956024103706004 + ], + "y": [ + -0.026277002241698984 + ], + "z": [ + -0.09914426677946774 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobacterium sp.", + "Euryarchaeota", + "Methanobacteria", + "TMS42793.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(44, 115, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.07152757356539298 + ], + "y": [ + -0.008593226094988764 + ], + "z": [ + -0.11954565720333386 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "MCI4339003.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.12701480435833404 + ], + "y": [ + -0.1115458322330519 + ], + "z": [ + 0.11720277749814689 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Candidatus Altiarchaeales archaeon ex4484_2", + "Candidatus Altarchaeota", + null, + "OYT54135.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 190, 111)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.05907508954051159 + ], + "y": [ + -0.06148508745345584 + ], + "z": [ + 0.20697897108058555 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Bathyarchaeota archaeon", + "Candidatus Bathyarchaeota", + null, + "HID91237.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(55, 184, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.2936359775614522 + ], + "y": [ + 0.15926301954730052 + ], + "z": [ + -0.014637521744538164 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthase", + "Candidatus Odinarchaeum yellowstonii", + "Asgard group", + "Candidatus Odinarchaeum", + "OLS17286.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(69, 11, 93)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthase", + "type": "scatter3d", + "x": [ + 0.19106480279780325 + ], + "y": [ + 0.05502731920605156 + ], + "z": [ + -0.02472997545776927 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Candidatus Altiarchaeales archaeon ex4484_43", + "Candidatus Altarchaeota", + null, + "OYT42366.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(71, 42, 121)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.07162426540681063 + ], + "y": [ + -0.050558111184112436 + ], + "z": [ + 0.11149105519128472 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MBU0685844.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.18128525146785282 + ], + "y": [ + -0.21912741297442814 + ], + "z": [ + 0.13134638416484948 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MCL5988943.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.2571489537711813 + ], + "y": [ + -0.20725060859848954 + ], + "z": [ + 0.0494392203188269 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Methanophagales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "PXF52344.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(63, 70, 135)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.24347788114436134 + ], + "y": [ + -0.0869478360896956 + ], + "z": [ + 0.061023162143018686 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halanaeroarchaeum sp. HSR-CO", + "Euryarchaeota", + "Halobacteria", + "WP_259517606.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(69, 10, 92)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.009436113980865787 + ], + "y": [ + 0.11270588433842152 + ], + "z": [ + -0.0019463473917633901 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanoregula sp.", + "Euryarchaeota", + "Methanomicrobia", + "WAC05702.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(41, 169, 130)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.20651320877613308 + ], + "y": [ + -0.03615130911138148 + ], + "z": [ + -0.06929522927342138 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanocorpusculum sp.", + "Euryarchaeota", + "Methanomicrobia", + "MCQ2376414.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(36, 164, 133)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.22352767019573802 + ], + "y": [ + -0.03129631782304481 + ], + "z": [ + -0.10853013890568607 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MCL4412140.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.19642124399985803 + ], + "y": [ + -0.18670402382519488 + ], + "z": [ + 0.07459843392697157 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasma acidophilum", + "Candidatus Thermoplasmatota", + "Thermoplasmatales", + "WP_010900487.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(119, 208, 82)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.17512694623999506 + ], + "y": [ + -0.15721774699227076 + ], + "z": [ + 0.0609763800021421 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanolinea sp.", + "Euryarchaeota", + "Methanomicrobia", + "MBP7119977.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(48, 107, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.19457074307841174 + ], + "y": [ + -0.03686962353900894 + ], + "z": [ + -0.08092345670117096 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MCL4307262.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.2511828945611908 + ], + "y": [ + -0.18737691987552937 + ], + "z": [ + 0.0761508363972082 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanoregulaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "HIH26777.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(36, 136, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.21981754692654554 + ], + "y": [ + -0.0273208202768999 + ], + "z": [ + -0.0746476808786789 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthase", + "Methanoregula sp. PtaU1.Bin051", + "Euryarchaeota", + "Methanomicrobia", + "OPY37925.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(230, 228, 39)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthase", + "type": "scatter3d", + "x": [ + -0.1971828159053864 + ], + "y": [ + -0.017583336619942578 + ], + "z": [ + -0.0916374962093725 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halorubrum sp. CSM-61", + "Euryarchaeota", + "Halobacteria", + "WP_123620683.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(43, 118, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.026921113391955617 + ], + "y": [ + 0.1575564414291553 + ], + "z": [ + 0.011468410795795492 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoprotei archaeon", + "Thermoproteota", + null, + "RLE83126.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(183, 222, 43)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.2447010250540391 + ], + "y": [ + 0.11853798683937572 + ], + "z": [ + -0.01770448095919252 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanomicrobiales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "NYT05008.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(58, 83, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.18804006224412229 + ], + "y": [ + -0.012591215620160155 + ], + "z": [ + -0.09275825400013356 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Candidatus Proteinoplasmatales archaeon SG8-5", + "Euryarchaeota", + null, + "KYK27320.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(69, 12, 94)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.14635023317290818 + ], + "y": [ + -0.16902588825201703 + ], + "z": [ + 0.10074177834368857 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanomicrobiales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "NYT16651.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(58, 83, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.19458622895692024 + ], + "y": [ + -0.021397407363011052 + ], + "z": [ + -0.07232616565406294 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Pyrolobus fumarii", + "Thermoproteota", + "Desulfurococcales", + "WP_014025700.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(49, 178, 124)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.19504706201772198 + ], + "y": [ + 0.08936953424312488 + ], + "z": [ + 0.012244792357749461 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobacteriaceae archaeon", + "Euryarchaeota", + "Methanobacteria", + "MBX7076341.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(150, 215, 63)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.06601236190873577 + ], + "y": [ + -0.002604193131185231 + ], + "z": [ + -0.1256202043569615 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MCL5803311.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.22058599985660715 + ], + "y": [ + -0.17502386486014987 + ], + "z": [ + 0.0442190150871675 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "bacterium", + null, + null, + "MBC7329287.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(49, 104, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.7071385571692924 + ], + "y": [ + 0.2160521535260765 + ], + "z": [ + -0.663136253676513 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanolinea sp.", + "Euryarchaeota", + "Methanomicrobia", + "MCA9702766.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(48, 107, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.18663491863137144 + ], + "y": [ + -0.027689214567445244 + ], + "z": [ + -0.08969036064012298 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobacterium lacus", + "Euryarchaeota", + "Methanobacteria", + "WP_013643758.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(33, 149, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.09277943659666349 + ], + "y": [ + -0.004339679141932813 + ], + "z": [ + -0.1412802538636221 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthase", + "uncultured archaeon", + "environmental samples", + null, + "VVB53498.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(35, 162, 134)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthase", + "type": "scatter3d", + "x": [ + -0.08790712948375057 + ], + "y": [ + -0.08305000467061205 + ], + "z": [ + 0.2412675426309672 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanomicrobiaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MBN1193910.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(52, 182, 122)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1851147972864281 + ], + "y": [ + -0.025247267108734813 + ], + "z": [ + -0.10311961245228399 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "MBA3045157.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.17235797008712808 + ], + "y": [ + -0.1961594117046314 + ], + "z": [ + 0.12312006269547106 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MCL4438150.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.23947836940322348 + ], + "y": [ + -0.21164923194665622 + ], + "z": [ + 0.07102073945425771 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobrevibacter sp. TMH8", + "Euryarchaeota", + "Methanobacteria", + "WP_224424997.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(78, 193, 106)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.0640797713679513 + ], + "y": [ + -0.011455869750117035 + ], + "z": [ + -0.10335933307002368 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "uncultured archaeon", + "environmental samples", + null, + "AKA48505.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(35, 162, 134)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.21264528675227992 + ], + "y": [ + -0.17227712186579547 + ], + "z": [ + 0.07187758927713898 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanoplanus limicola", + "Euryarchaeota", + "Methanomicrobia", + "WP_004079284.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(243, 230, 38)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.17716667735009164 + ], + "y": [ + -0.003878058767072416 + ], + "z": [ + -0.08753514884775981 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanocalculus alkaliphilus", + "Euryarchaeota", + "Methanomicrobia", + "WP_253487760.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(36, 140, 140)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1859951748964471 + ], + "y": [ + -0.03613506364866549 + ], + "z": [ + -0.09760111389304556 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Pyrodictium sp.", + "Thermoproteota", + "Desulfurococcales", + "HIQ11171.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(181, 222, 43)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.2246290743214313 + ], + "y": [ + 0.13021567197028439 + ], + "z": [ + 0.015710803356584153 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Ignisphaera sp.", + "Thermoproteota", + "Desulfurococcales", + "MCS7111770.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(55, 89, 140)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.25057545933579606 + ], + "y": [ + 0.12946207670159435 + ], + "z": [ + 0.03017599256708988 + ] + }, + { + "customdata": [ + [ + "Methionine adenosyltransferase", + "Methanocalculus sp. 52_23", + "Euryarchaeota", + "Methanomicrobia", + "KUK69770.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(201, 225, 41)", + "size": 7 + }, + "mode": "markers", + "text": "Methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.19302765587016743 + ], + "y": [ + -0.04162418291090389 + ], + "z": [ + -0.10501271717313246 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobrevibacter filiformis", + "Euryarchaeota", + "Methanobacteria", + "WP_066971865.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(42, 122, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.059050649855080205 + ], + "y": [ + -0.0009091745847492555 + ], + "z": [ + -0.14681257276024265 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Thermocladium sp. ECH_B", + "Thermoproteota", + "Thermoproteales", + "KUO92138.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(68, 52, 126)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.23597406649976144 + ], + "y": [ + 0.15009299529936543 + ], + "z": [ + 0.025572323765492858 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halorubrum salipaludis", + "Euryarchaeota", + "Halobacteria", + "WP_095635812.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(57, 185, 119)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.0016153835248518878 + ], + "y": [ + 0.1374234214878863 + ], + "z": [ + -0.006589733002159062 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natronorubrum aibiense", + "Euryarchaeota", + "Halobacteria", + "WP_152942600.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(60, 186, 117)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.04355971834325176 + ], + "y": [ + 0.12055887817437104 + ], + "z": [ + -0.014760113262669813 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MCJ2532667.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.18404111393917288 + ], + "y": [ + -0.22791946990818981 + ], + "z": [ + 0.10931181255100704 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "MCI4337281.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.1433229216911012 + ], + "y": [ + -0.13581013410164763 + ], + "z": [ + 0.13331702809633095 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanocorpusculum sp.", + "Euryarchaeota", + "Methanomicrobia", + "MBR4987432.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(36, 164, 133)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.21505089348524645 + ], + "y": [ + -0.047234709126332826 + ], + "z": [ + -0.11587112345723136 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "MCI4323287.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.13702457462036952 + ], + "y": [ + -0.15294673412533458 + ], + "z": [ + 0.1550065918326405 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthase", + "Methanoregulaceae archaeon PtaU1.Bin222", + "Euryarchaeota", + "Methanomicrobia", + "OPY40252.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(40, 125, 142)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthase", + "type": "scatter3d", + "x": [ + -0.21051584941211368 + ], + "y": [ + -0.013044950737158063 + ], + "z": [ + -0.08799847522962784 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "candidate division MSBL1 archaeon SCGC-AAA382C18", + "Euryarchaeota", + null, + "KXB06412.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(101, 202, 93)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.2919208752613412 + ], + "y": [ + 0.34504097464085426 + ], + "z": [ + 0.572195785398516 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobacteriaceae archaeon", + "Euryarchaeota", + "Methanobacteria", + "MCC7553004.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(150, 215, 63)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.09220562553694155 + ], + "y": [ + 0.006305984807289603 + ], + "z": [ + -0.14262052181460932 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanospirillum", + "Euryarchaeota", + "Methanomicrobia", + "WP_214418350.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(35, 144, 140)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.2344012355205545 + ], + "y": [ + -0.04293660017513558 + ], + "z": [ + -0.09841370000032025 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobrevibacter boviskoreani", + "Euryarchaeota", + "Methanobacteria", + "WP_040682159.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(38, 132, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.07154828160527867 + ], + "y": [ + 0.012396338000659524 + ], + "z": [ + -0.16312199457423407 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanomicrobiaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MCC7566513.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(52, 182, 122)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1445910706070935 + ], + "y": [ + 0.022000914041237832 + ], + "z": [ + -0.06463400053940001 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Altiarchaeales archaeon", + "Candidatus Altarchaeota", + null, + "HHQ45179.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(195, 224, 42)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.09250569504503349 + ], + "y": [ + -0.0789720828907959 + ], + "z": [ + 0.2774835053544436 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "TLZ82776.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.19311050620011394 + ], + "y": [ + -0.22619345502265562 + ], + "z": [ + 0.10021809820526452 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoproteota archaeon", + "Thermoproteota", + null, + "NOZ89357.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(179, 221, 45)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.23908570400937118 + ], + "y": [ + 0.13608207234366548 + ], + "z": [ + -0.0026412902424689105 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natrinema marinum", + "Euryarchaeota", + "Halobacteria", + "WP_254763865.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(37, 136, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.03671082882538628 + ], + "y": [ + 0.1256160349745486 + ], + "z": [ + 0.022334335330691388 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Burkholderiaceae bacterium", + "Pseudomonadota", + "Burkholderiales", + "MCC7467724.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(46, 112, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.21315259656429034 + ], + "y": [ + -0.019246059142890536 + ], + "z": [ + -0.07091249166384661 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Vulcanisaeta moutnovskia", + "Thermoproteota", + "Thermoproteales", + "WP_013604332.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(65, 62, 131)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.2471368672402526 + ], + "y": [ + 0.12772176096637783 + ], + "z": [ + 0.002421328954253542 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanoregula sp.", + "Euryarchaeota", + "Methanomicrobia", + "MCJ7741397.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(41, 169, 130)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.20906346177500182 + ], + "y": [ + -0.025200443522557514 + ], + "z": [ + -0.07118891493707327 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanomassiliicoccales archaeon", + "Candidatus Thermoplasmatota", + "Methanomassiliicoccales", + "MCU0861666.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(33, 148, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.18433089106034548 + ], + "y": [ + -0.2399849776627994 + ], + "z": [ + 0.130546076463459 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "MCJ7464787.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.19415909085899535 + ], + "y": [ + -0.2100110467980553 + ], + "z": [ + 0.11452384117689518 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halocalculus aciditolerans", + "Euryarchaeota", + "Halobacteria", + "WP_188976441.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(58, 82, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.0017822279646746955 + ], + "y": [ + 0.14158020244484235 + ], + "z": [ + 0.01261380003653953 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanocalculus sp. MSAO_Arc2", + "Euryarchaeota", + "Methanomicrobia", + "RQD81054.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(39, 167, 131)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1984431718856601 + ], + "y": [ + -0.02761559319374038 + ], + "z": [ + -0.11303025353427078 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "UCE91495.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.17192874184039386 + ], + "y": [ + -0.20491456396549587 + ], + "z": [ + 0.13597932167168977 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Methanomicrobiales archaeon HGW-Methanomicrobiales-4", + "Euryarchaeota", + "Methanomicrobia", + "PKL59643.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(37, 165, 133)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.2280750539172968 + ], + "y": [ + -0.02196920837921728 + ], + "z": [ + -0.10200912923937079 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanospirillaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MBN1167899.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(83, 195, 104)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.2323378863947649 + ], + "y": [ + -0.0513216311625746 + ], + "z": [ + -0.10166511459522713 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Actinobacteria bacterium QS_8_72_14", + "Actinomycetota", + null, + "PSO49145.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(57, 85, 139)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.02509638879773659 + ], + "y": [ + 0.13082453833313357 + ], + "z": [ + 0.017548453959443343 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobrevibacter oralis", + "Euryarchaeota", + "Methanobacteria", + "WP_042693727.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(50, 180, 123)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.08949973924848917 + ], + "y": [ + 0.010542560318468461 + ], + "z": [ + -0.15730909395549592 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Acidiplasma", + "Candidatus Thermoplasmatota", + "Thermoplasmatales", + "WP_156150271.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(49, 103, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.22874281691166054 + ], + "y": [ + -0.19559242679618857 + ], + "z": [ + 0.06249821678967724 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosphaera", + "Euryarchaeota", + "Methanobacteria", + "WP_011407039.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(55, 90, 140)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.08442776192883028 + ], + "y": [ + 0.004023281036958951 + ], + "z": [ + -0.1682640481372782 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halobium salinum", + "Euryarchaeota", + "Halobacteria", + "WP_267619874.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(47, 108, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.04458268694011415 + ], + "y": [ + 0.11906386441107594 + ], + "z": [ + -0.00909411273605495 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanoculleus sp.", + "Euryarchaeota", + "Methanomicrobia", + "MBP7299847.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(148, 215, 64)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.19735764028550737 + ], + "y": [ + -0.05203755409517787 + ], + "z": [ + -0.07806082813864902 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halorubrum sp. JWXQ-INN 858", + "Euryarchaeota", + "Halobacteria", + "WP_159485710.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(228, 228, 39)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.021335957689039054 + ], + "y": [ + 0.13863288338577262 + ], + "z": [ + -0.011621157651127843 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanoregula sp.", + "Euryarchaeota", + "Methanomicrobia", + "MCK9631260.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(41, 169, 130)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.215584005407427 + ], + "y": [ + -0.043584336914292185 + ], + "z": [ + -0.1036394422916107 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosphaerula palustris", + "Euryarchaeota", + "Methanomicrobia", + "WP_012618370.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(36, 139, 140)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.18969605376749507 + ], + "y": [ + -0.012751609283787303 + ], + "z": [ + -0.07439043138296278 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Verstraetearchaeota archaeon", + "Candidatus Verstraetearchaeota", + null, + "MCD6409343.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(49, 179, 124)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.2590497322624897 + ], + "y": [ + 0.10513342899698173 + ], + "z": [ + -0.008508098522573585 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natrinema altunense", + "Euryarchaeota", + "Halobacteria", + "WP_007108352.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(98, 201, 95)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.010836514945927758 + ], + "y": [ + 0.12447956339824298 + ], + "z": [ + -0.00674727974853593 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanoregulaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MCJ7794343.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(36, 136, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.20784251879205412 + ], + "y": [ + -0.02730052981915896 + ], + "z": [ + -0.08358644525051447 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Natrinema thermotolerans DSM 11552", + "Euryarchaeota", + "Halobacteria", + "ELZ15084.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(191, 223, 42)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.002920750611726575 + ], + "y": [ + 0.14912882287287846 + ], + "z": [ + -0.0019218342136527874 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Salinarchaeum sp. IM2453", + "Euryarchaeota", + "Halobacteria", + "WP_221170772.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(47, 109, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.02698829389519927 + ], + "y": [ + 0.15537788974457864 + ], + "z": [ + 0.00031098363248356013 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "MCK4366801.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.20389579055048654 + ], + "y": [ + -0.21148691458240304 + ], + "z": [ + 0.10677375345657494 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Hyperthermus butylicus", + "Thermoproteota", + "Desulfurococcales", + "WP_011821276.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(93, 199, 98)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.24492937817577937 + ], + "y": [ + 0.14978247534747707 + ], + "z": [ + 0.009626303114696292 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanospirillum lacunae", + "Euryarchaeota", + "Methanomicrobia", + "WP_109967398.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(32, 154, 138)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.23144605817351457 + ], + "y": [ + -0.029552861593877613 + ], + "z": [ + -0.10133854086294557 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Desulfurococcales archaeon", + "Thermoproteota", + "Desulfurococcales", + "NAZ14258.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(52, 97, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.2524281497908487 + ], + "y": [ + 0.11302835796617833 + ], + "z": [ + 0.015901355997173818 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Desulfurococcaceae archaeon", + "Thermoproteota", + "Desulfurococcales", + "MCC6041979.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(69, 50, 125)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.21855588509398766 + ], + "y": [ + 0.11840600715310148 + ], + "z": [ + 0.022778791098299108 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobrevibacter olleyae", + "Euryarchaeota", + "Methanobacteria", + "WP_067148153.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(103, 203, 92)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.08315634283130924 + ], + "y": [ + 0.020658539438183778 + ], + "z": [ + -0.15385014969077287 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halobaculum halophilum", + "Euryarchaeota", + "Halobacteria", + "WP_179168523.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(34, 161, 135)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.03131214559557772 + ], + "y": [ + 0.13557026316820478 + ], + "z": [ + 0.010209724095000344 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natrinema salaciae", + "Euryarchaeota", + "Halobacteria", + "WP_090615699.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(51, 181, 122)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.0020871805264206004 + ], + "y": [ + 0.13649791129981356 + ], + "z": [ + 0.017237409460087012 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "MCK5292032.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.21029204495363646 + ], + "y": [ + -0.22471295236874342 + ], + "z": [ + 0.11029570238940942 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Methanosuratincola sp.", + "Candidatus Verstraetearchaeota", + "Candidatus Methanomethylicales", + "MCQ8891888.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(47, 110, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.2796506682851862 + ], + "y": [ + 0.11359583915430978 + ], + "z": [ + -0.002205251451799101 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halorubrum sp. LN27", + "Euryarchaeota", + "Halobacteria", + "WP_200531784.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 17, 98)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.008192382002917477 + ], + "y": [ + 0.14194234001626435 + ], + "z": [ + -0.0013133438150029946 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthase", + "ANME-1 cluster archaeon GoMg2", + "Euryarchaeota", + "Methanomicrobia", + "NQE45598.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(64, 66, 133)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthase", + "type": "scatter3d", + "x": [ + -0.27506119513589866 + ], + "y": [ + -0.12752629740045432 + ], + "z": [ + 0.08767981498177181 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halobacterium jilantaiense", + "Euryarchaeota", + "Halobacteria", + "WP_089667219.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(214, 226, 40)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.011148782237263585 + ], + "y": [ + 0.1295199688767365 + ], + "z": [ + 0.027529431158220187 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Candidatus Altiarchaeales archaeon IMC4", + "Candidatus Altarchaeota", + null, + "ODS42513.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(41, 124, 142)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.05751504491160505 + ], + "y": [ + -0.08208157580635494 + ], + "z": [ + 0.19113432605160366 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanofollis ethanolicus", + "Euryarchaeota", + "Methanomicrobia", + "WP_067051365.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(40, 125, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1786920395930022 + ], + "y": [ + -0.03188944815172614 + ], + "z": [ + -0.07357608571357259 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "TMA01594.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.19829917266602254 + ], + "y": [ + -0.22156704864230176 + ], + "z": [ + 0.0931384133798453 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halodesulfurarchaeum formicicum", + "Euryarchaeota", + "Halobacteria", + "WP_071932752.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(185, 222, 43)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.03511085616204511 + ], + "y": [ + 0.1269179082198851 + ], + "z": [ + 0.006486421223250759 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Salinirubrum litoreum", + "Euryarchaeota", + "Halobacteria", + "WP_227227828.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(71, 44, 122)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.00158950047681884 + ], + "y": [ + 0.1402221439805097 + ], + "z": [ + 0.004981604669013064 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobrevibacter wolinii", + "Euryarchaeota", + "Methanobacteria", + "WP_042707184.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(42, 121, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.0883786705322645 + ], + "y": [ + -0.007518387328183022 + ], + "z": [ + -0.15200665083120282 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "unclassified Halorubrum", + "Euryarchaeota", + "Halobacteria", + "WP_121564496.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(61, 75, 137)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.004917103940044601 + ], + "y": [ + 0.14754571247924197 + ], + "z": [ + 0.016910412456192136 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Ignicoccus pacificus DSM 13166", + "Thermoproteota", + "Desulfurococcales", + "UXD21236.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(32, 152, 138)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.26389230831551336 + ], + "y": [ + 0.13734193775081374 + ], + "z": [ + 0.04211739061124446 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Ferroplasma", + "Candidatus Thermoplasmatota", + "Thermoplasmatales", + "WP_019841393.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(58, 185, 118)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.23266889410904595 + ], + "y": [ + -0.21692713642193306 + ], + "z": [ + 0.06762645642285159 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halostella salina", + "Euryarchaeota", + "Halobacteria", + "WP_121821496.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(193, 223, 42)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.01688232665410156 + ], + "y": [ + 0.1249996185811868 + ], + "z": [ + -0.013252839825855563 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Pyrodictium delaneyi", + "Thermoproteota", + "Desulfurococcales", + "ALL00670.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(54, 91, 140)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.21039124634029727 + ], + "y": [ + 0.10771507113984585 + ], + "z": [ + 0.009109128376514121 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "TLZ91571.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.20111202091460995 + ], + "y": [ + -0.2194663456788976 + ], + "z": [ + 0.10329280890536963 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Nanohaloarchaeota archaeon QJJ-7", + "Candidatus Nanohaloarchaeota", + null, + "MCJ7479214.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(46, 175, 126)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.8354967420677185 + ], + "y": [ + -0.23233585922736574 + ], + "z": [ + -0.610105712206613 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MCL4340689.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.2415134738964735 + ], + "y": [ + -0.21515539847996437 + ], + "z": [ + 0.05860370509594605 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halobaculum roseum", + "Euryarchaeota", + "Halobacteria", + "WP_222922726.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 38, 118)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.04089267317606598 + ], + "y": [ + 0.12232980668802072 + ], + "z": [ + 0.01397206308997429 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobrevibacter curvatus", + "Euryarchaeota", + "Methanobacteria", + "WP_067091875.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(108, 205, 89)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.0875419797512272 + ], + "y": [ + -0.001856846364493402 + ], + "z": [ + -0.16136945132143007 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natronorubrum bangense", + "Euryarchaeota", + "Halobacteria", + "WP_006065566.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(125, 209, 78)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.025449767527523284 + ], + "y": [ + 0.1310905162388022 + ], + "z": [ + -0.004732643498580205 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MBK5191098.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 21, 103)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.24287436245254204 + ], + "y": [ + -0.10281284041853817 + ], + "z": [ + 0.03726184166139288 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Ignisphaera sp.", + "Thermoproteota", + "Desulfurococcales", + "MCC6045576.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(55, 89, 140)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.2661502213123969 + ], + "y": [ + 0.12811908620610749 + ], + "z": [ + 0.022011128087407586 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natrinema gelatinilyticum", + "Euryarchaeota", + "Halobacteria", + "WP_254529741.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(234, 229, 39)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.006476939032700374 + ], + "y": [ + 0.13104992572181345 + ], + "z": [ + 0.015149441240389968 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Bathyarchaeota archaeon", + "Candidatus Bathyarchaeota", + null, + "MBS7643067.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(55, 184, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.26222564142876986 + ], + "y": [ + 0.14429763562581538 + ], + "z": [ + -0.0130034227600226 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Theionarchaea archaeon", + "Euryarchaeota", + null, + "MBU7017391.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(37, 165, 132)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.8404903523840673 + ], + "y": [ + 0.44997456733673574 + ], + "z": [ + -0.13600728655825642 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MCL4308458.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.1494616429850754 + ], + "y": [ + -0.14772033142681604 + ], + "z": [ + 0.11970038663666181 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanoculleus sp.", + "Euryarchaeota", + "Methanomicrobia", + "MBP7144579.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(148, 215, 64)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.2199469874045306 + ], + "y": [ + -0.024102640105134472 + ], + "z": [ + -0.09665980056938421 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Halobacteriales archaeon SW_8_68_21", + "Euryarchaeota", + "Halobacteria", + "PSQ57047.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(71, 29, 110)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.02595353271862438 + ], + "y": [ + 0.1419099760097893 + ], + "z": [ + -0.008331800789335249 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoproteota archaeon", + "Thermoproteota", + null, + "NPA04564.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(179, 221, 45)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.2151488334960307 + ], + "y": [ + 0.11731195568501332 + ], + "z": [ + 0.00666833870584466 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanocorpusculum sp. MG", + "Euryarchaeota", + "Methanomicrobia", + "WP_268925586.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(45, 174, 127)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.2064894803269648 + ], + "y": [ + -0.036159214270721565 + ], + "z": [ + -0.11341622528106822 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halostella litorea", + "Euryarchaeota", + "Halobacteria", + "WP_135822644.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(38, 166, 132)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.03109006926706555 + ], + "y": [ + 0.13341459176918186 + ], + "z": [ + 0.023260092820008033 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Thermoplasmata archaeon HGW-Thermoplasmata-2", + "Candidatus Thermoplasmatota", + null, + "PKK81476.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(44, 173, 127)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.8795465188598599 + ], + "y": [ + 0.9238025782779682 + ], + "z": [ + -0.07535948122689631 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natronorubrum sediminis", + "Euryarchaeota", + "Halobacteria", + "WP_090503710.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(50, 101, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.010665251161221611 + ], + "y": [ + 0.14667240262212436 + ], + "z": [ + 0.004171025195262097 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanoregulaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "NTU99704.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(36, 136, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.18156424310278593 + ], + "y": [ + -0.029120067640530354 + ], + "z": [ + -0.08086607236793819 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Haloterrigena sp. H1", + "Euryarchaeota", + "Halobacteria", + "WP_138779374.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(160, 217, 56)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.030376830398643362 + ], + "y": [ + 0.13499668893005948 + ], + "z": [ + -0.016858796459060747 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanomicrobia archaeon", + "Euryarchaeota", + "Methanomicrobia", + "HDN68217.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(44, 116, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.2863697627124746 + ], + "y": [ + -0.11185652207102174 + ], + "z": [ + 0.0794725617591561 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natronococcus sp. CG52", + "Euryarchaeota", + "Halobacteria", + "WP_252489995.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(36, 138, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.03968246107713969 + ], + "y": [ + 0.12596750843644117 + ], + "z": [ + -0.014015519565156781 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natrinema amylolyticum", + "Euryarchaeota", + "Halobacteria", + "WP_226481852.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 25, 106)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.02293235497743287 + ], + "y": [ + 0.14870073220770827 + ], + "z": [ + -0.004092793572785439 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobacterium sp.", + "Euryarchaeota", + "Methanobacteria", + "HHT18794.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(44, 115, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.09747526427077302 + ], + "y": [ + 0.016510291708940805 + ], + "z": [ + -0.1380603277617469 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Bathyarchaeota archaeon", + "Candidatus Bathyarchaeota", + null, + "MCK5403199.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(55, 184, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.3295818869717208 + ], + "y": [ + 0.19312286285449395 + ], + "z": [ + -0.05688325777018101 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanomassiliicoccales archaeon", + "Candidatus Thermoplasmatota", + "Methanomassiliicoccales", + "MBC7107492.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(33, 148, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.20882042368206385 + ], + "y": [ + -0.22864225105722283 + ], + "z": [ + 0.13098871055878997 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobrevibacter ruminantium", + "Euryarchaeota", + "Methanobacteria", + "WP_012954933.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(34, 144, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.06656301171987734 + ], + "y": [ + -0.00878008380349537 + ], + "z": [ + -0.13399792795818533 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanomassiliicoccales archaeon", + "Candidatus Thermoplasmatota", + "Methanomassiliicoccales", + "MCG7840871.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(33, 148, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.19955615508898453 + ], + "y": [ + -0.2702544657763882 + ], + "z": [ + 0.13168337982668657 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halobaculum sp. CBA1158", + "Euryarchaeota", + "Halobacteria", + "WP_234297091.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(57, 84, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.009941732100075864 + ], + "y": [ + 0.11795811161818667 + ], + "z": [ + 0.008237943621135288 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halobaculum salinum", + "Euryarchaeota", + "Halobacteria", + "WP_179268991.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(51, 100, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.015181188989301203 + ], + "y": [ + 0.14817773574256124 + ], + "z": [ + 0.023982886428069197 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Thermogymnomonas acidicola", + "Candidatus Thermoplasmatota", + "Thermoplasmatales", + "GGM66958.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(170, 220, 50)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.2093000742800714 + ], + "y": [ + -0.1994160606193212 + ], + "z": [ + 0.07312136530714594 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Haladaptatus pallidirubidus", + "Euryarchaeota", + "Halobacteria", + "WP_227776945.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(99, 202, 94)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.043133337545818315 + ], + "y": [ + 0.10756729379250873 + ], + "z": [ + -0.004541205644506598 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "archaeon", + null, + null, + "MCQ2976762.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(34, 147, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.07634672920652916 + ], + "y": [ + -0.011651468343820633 + ], + "z": [ + -0.13558456842992989 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natronorubrum thiooxidans", + "Euryarchaeota", + "Halobacteria", + "WP_076608624.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(46, 175, 126)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.008721838616144036 + ], + "y": [ + 0.13561238680082324 + ], + "z": [ + 0.024785723540626213 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halobacterium litoreum", + "Euryarchaeota", + "Halobacteria", + "WP_232572234.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(40, 126, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.007522374027153546 + ], + "y": [ + 0.13714484838427177 + ], + "z": [ + 0.02355434044758499 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanofollis liminatans", + "Euryarchaeota", + "Methanomicrobia", + "WP_004038703.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(54, 93, 140)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.19011193566605877 + ], + "y": [ + -0.01524068131252966 + ], + "z": [ + -0.08454738589269788 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "candidate division MSBL1 archaeon SCGC-AAA259E19", + "Euryarchaeota", + null, + "KXA95705.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(203, 225, 41)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.2527399999462861 + ], + "y": [ + 0.2666482752686523 + ], + "z": [ + 0.49454203283883424 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanoculleus taiwanensis", + "Euryarchaeota", + "Methanomicrobia", + "WP_128693716.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(33, 150, 138)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.20875411424283474 + ], + "y": [ + -0.039867662421471314 + ], + "z": [ + -0.08207407539373947 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "unclassified Methanocalculus", + "Euryarchaeota", + "Methanomicrobia", + "WP_253460769.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(42, 119, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1996848881628408 + ], + "y": [ + -0.014980795930751906 + ], + "z": [ + -0.10515360726640922 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halovivax gelatinilyticus", + "Euryarchaeota", + "Halobacteria", + "WP_254862883.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(132, 211, 74)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.00423655530356418 + ], + "y": [ + 0.15266076651784743 + ], + "z": [ + 0.005153213291293703 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Haloterrigena alkaliphila", + "Euryarchaeota", + "Halobacteria", + "WP_207288301.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(138, 212, 70)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.0022785617921897254 + ], + "y": [ + 0.1348567231118803 + ], + "z": [ + 0.009800145087666755 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natrinema sp. SYSU A 869", + "Euryarchaeota", + "Halobacteria", + "WP_222919302.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(140, 213, 69)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.00952329387735438 + ], + "y": [ + 0.12429763185232484 + ], + "z": [ + -0.010064906435748047 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MCL5783052.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.2478646772128745 + ], + "y": [ + -0.206319541034505 + ], + "z": [ + 0.06741118974934109 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natronorubrum texcoconense", + "Euryarchaeota", + "Halobacteria", + "WP_090306871.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(67, 56, 128)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.013225491450482896 + ], + "y": [ + 0.12076368235041952 + ], + "z": [ + 0.008439902584578983 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanophagales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MCK4475473.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(63, 70, 135)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.22222588885319575 + ], + "y": [ + -0.10166874324526044 + ], + "z": [ + 0.06858416961538932 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halorubrum sodomense", + "Euryarchaeota", + "Halobacteria", + "WP_092922917.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(40, 168, 131)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.036955927341223785 + ], + "y": [ + 0.12575030081826316 + ], + "z": [ + -0.007449651493581068 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Altiarchaeota archaeon", + "Candidatus Altarchaeota", + null, + "MBU4201840.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(80, 194, 106)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.08684873753905041 + ], + "y": [ + -0.06398223460358134 + ], + "z": [ + 0.23851138014043397 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobrevibacter", + "Euryarchaeota", + "Methanobacteria", + "WP_004032572.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(48, 105, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.06736343693664831 + ], + "y": [ + -0.006390182651174576 + ], + "z": [ + -0.1440849403226333 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halorubrum aethiopicum", + "Euryarchaeota", + "Halobacteria", + "WP_066415702.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(51, 99, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.010868232776175702 + ], + "y": [ + 0.14822403228579023 + ], + "z": [ + -0.00975633967308866 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanoregulaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "NTW92131.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(36, 136, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.19447167243119215 + ], + "y": [ + -0.028013211665926963 + ], + "z": [ + -0.06889291267558442 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Methanophagales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "RCV65299.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(63, 70, 135)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.21265423392533045 + ], + "y": [ + -0.06625988648036359 + ], + "z": [ + 0.029530136374160056 + ] + }, + { + "customdata": [ + [ + "hypothetical protein", + "Thermoplasmatales archaeon E-plasma", + "Candidatus Thermoplasmatota", + "Thermoplasmatales", + "EQB66510.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(71, 34, 114)", + "size": 7 + }, + "mode": "markers", + "text": "hypothetical protein", + "type": "scatter3d", + "x": [ + 0.2404055237692557 + ], + "y": [ + -0.19987417828162463 + ], + "z": [ + 0.0484520083683924 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoproteales archaeon", + "Thermoproteota", + "Thermoproteales", + "MCD6562447.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(60, 78, 138)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.311806725993685 + ], + "y": [ + 0.19820194918361164 + ], + "z": [ + -0.00017965555269211232 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthase", + "Methanomassiliicoccales archaeon PtaB.Bin134", + "Candidatus Thermoplasmatota", + "Methanomassiliicoccales", + "OPX62442.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(48, 177, 125)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthase", + "type": "scatter3d", + "x": [ + 0.19319411984940854 + ], + "y": [ + -0.2601557190865877 + ], + "z": [ + 0.14539179041938982 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoprotei archaeon", + "Thermoproteota", + null, + "RLF06785.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(183, 222, 43)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.26364601616351696 + ], + "y": [ + 0.12564103334895216 + ], + "z": [ + -0.00029621067098682604 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "candidate division MSBL1 archaeon SCGC-AAA261D19", + "Euryarchaeota", + null, + "KXB02156.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(62, 72, 136)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.22809726588321114 + ], + "y": [ + 0.21710808915820884 + ], + "z": [ + 0.45517685241097045 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halorubrum sp. BV1", + "Euryarchaeota", + "Halobacteria", + "WP_049982863.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(146, 214, 65)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.02198074956359971 + ], + "y": [ + 0.11377962118869349 + ], + "z": [ + -0.004508705365583252 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Hyperthermus sp.", + "Thermoproteota", + "Desulfurococcales", + "RUM46922.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(35, 140, 140)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.24551842840937457 + ], + "y": [ + 0.11922613107917529 + ], + "z": [ + 0.021020405734407475 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Altiarchaeales archaeon", + "Candidatus Altarchaeota", + null, + "MBD3262709.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(195, 224, 42)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.10722228132782374 + ], + "y": [ + -0.07136980773372971 + ], + "z": [ + 0.2758519659400672 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Vulcanisaeta sp. SCGC AB-777_J10", + "Thermoproteota", + "Thermoproteales", + "PVU71895.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(53, 183, 121)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.24108502502916188 + ], + "y": [ + 0.14397572358340355 + ], + "z": [ + 0.01430923810823657 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Bathyarchaeota archaeon", + "Candidatus Bathyarchaeota", + null, + "RLI05182.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(55, 184, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.2810241886318335 + ], + "y": [ + 0.15898962897551963 + ], + "z": [ + -0.0179091711541553 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanocorpusculum sp.", + "Euryarchaeota", + "Methanomicrobia", + "MCK9313491.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(36, 164, 133)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.21121721129990018 + ], + "y": [ + -0.024903647098589984 + ], + "z": [ + -0.11190143871834157 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanoculleus", + "Euryarchaeota", + "Methanomicrobia", + "WP_066955078.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(38, 129, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.19933086811770545 + ], + "y": [ + -0.03947614051460931 + ], + "z": [ + -0.10287964286092799 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halobacterium", + "Euryarchaeota", + "Halobacteria", + "WP_010902940.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(216, 226, 40)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.024785334811464808 + ], + "y": [ + 0.1505756297446573 + ], + "z": [ + 0.020659165036436552 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MCL4451275.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.2553390539728161 + ], + "y": [ + -0.19173921194273313 + ], + "z": [ + 0.04889201900617062 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halorubrum sp. CBA1125", + "Euryarchaeota", + "Halobacteria", + "WP_156588411.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(62, 187, 116)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.021471694186241792 + ], + "y": [ + 0.11558699248732365 + ], + "z": [ + -0.013110620577937474 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halorubrum alkaliphilum", + "Euryarchaeota", + "Halobacteria", + "WP_209482594.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(32, 153, 138)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.022575736486019536 + ], + "y": [ + 0.11010317340123665 + ], + "z": [ + 0.0025149095415081626 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halopenitus persicus", + "Euryarchaeota", + "Halobacteria", + "WP_021073705.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(212, 226, 40)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.0023566464068876334 + ], + "y": [ + 0.1298729745584225 + ], + "z": [ + 0.0019052078198111284 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "candidate division MSBL1 archaeon SCGC-AAA259A05", + "Euryarchaeota", + null, + "KXA90742.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(57, 86, 139)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.28015729342277385 + ], + "y": [ + 0.3020531522983963 + ], + "z": [ + 0.5519371660181488 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MCL6003386.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.23312447648239867 + ], + "y": [ + -0.21627015029971608 + ], + "z": [ + 0.04497509215680752 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanomicrobiaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MBN1431402.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(52, 182, 122)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.20098535326452174 + ], + "y": [ + -0.027375474087732873 + ], + "z": [ + -0.09767671403629512 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Vulcanisaeta sp. JCM 14467", + "Thermoproteota", + "Thermoproteales", + "WP_054849467.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(31, 158, 137)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.24007601049971558 + ], + "y": [ + 0.1424003214446442 + ], + "z": [ + 0.005590189916030738 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Euryarchaeota archaeon RBG_16_62_10", + "Euryarchaeota", + null, + "OGS42269.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(43, 117, 142)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.18759346136280008 + ], + "y": [ + -0.23536536674527728 + ], + "z": [ + 0.1402880468545622 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Candidatus Terraquivivens tikiterensis", + "Nitrososphaerota", + "Candidatus Terraquivivens", + "PUA32000.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(197, 224, 42)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.32724431488178496 + ], + "y": [ + 0.24846170006292032 + ], + "z": [ + 0.0226103152335068 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanomassiliicoccales archaeon", + "Candidatus Thermoplasmatota", + "Methanomassiliicoccales", + "MBN1110266.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(33, 148, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.1965882734997979 + ], + "y": [ + -0.27850202367865434 + ], + "z": [ + 0.15402414826776312 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Methanomicrobiales archaeon HGW-Methanomicrobiales-1", + "Euryarchaeota", + "Methanomicrobia", + "PKL68256.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(59, 80, 138)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.1982743153701908 + ], + "y": [ + -0.01957787976886865 + ], + "z": [ + -0.08362219882671493 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Vulcanisaeta sp.", + "Thermoproteota", + "Thermoproteales", + "MCG2863631.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(69, 49, 125)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.24068523947082546 + ], + "y": [ + 0.14237723652596113 + ], + "z": [ + -0.009562763631460436 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Verstraetearchaeota archaeon", + "Candidatus Verstraetearchaeota", + null, + "RLE49468.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(49, 179, 124)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.24457186151840685 + ], + "y": [ + 0.13133670255587257 + ], + "z": [ + -0.01590979135721608 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natronococcus pandeyae", + "Euryarchaeota", + "Halobacteria", + "WP_148860060.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(45, 113, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.029938932967846915 + ], + "y": [ + 0.1128135905882924 + ], + "z": [ + -0.0037686656787571772 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoprotei archaeon", + "Thermoproteota", + null, + "RLF12032.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(183, 222, 43)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.33082241924534284 + ], + "y": [ + 0.19234679479327335 + ], + "z": [ + 0.0025797170379804417 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natronocalculus amylovorans", + "Euryarchaeota", + "Halobacteria", + "WP_174653571.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(111, 206, 87)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.036493640219321555 + ], + "y": [ + 0.14804212060498192 + ], + "z": [ + -0.0008744524388105921 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Haloglomus salinum", + "Euryarchaeota", + "Halobacteria", + "WP_254831124.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(34, 146, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.030081263627016866 + ], + "y": [ + 0.1549391041502578 + ], + "z": [ + 0.011575937411518885 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MCL5804246.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.25955141907326695 + ], + "y": [ + -0.18790291331197626 + ], + "z": [ + 0.0618793081715557 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanophagales archaeon ANME-1-THS", + "Euryarchaeota", + "Methanomicrobia", + "RZN38061.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(69, 14, 96)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.2790491540059707 + ], + "y": [ + -0.1126509148863387 + ], + "z": [ + 0.0914230945650647 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "MCL2460374.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.23166887131176214 + ], + "y": [ + -0.04180139447764477 + ], + "z": [ + -0.08713874860771266 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Vulcanisaeta souniana", + "Thermoproteota", + "Thermoproteales", + "WP_188602731.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(96, 200, 96)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.24114614536233883 + ], + "y": [ + 0.13785024282891178 + ], + "z": [ + 0.010275809138646968 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Sulfolobales archaeon HS-7", + "Thermoproteota", + "Sulfolobales", + "BCU68573.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(67, 55, 128)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.23747709593925317 + ], + "y": [ + 0.13281896109465288 + ], + "z": [ + 0.03504359852438719 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanomassiliicoccales archaeon", + "Candidatus Thermoplasmatota", + "Methanomassiliicoccales", + "TET91527.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(33, 148, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.20724236609512603 + ], + "y": [ + -0.21045026050588767 + ], + "z": [ + 0.09897658705733509 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Desulfurococcales archaeon", + "Thermoproteota", + "Desulfurococcales", + "MCE4612379.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(52, 97, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.2615094373054151 + ], + "y": [ + 0.14346604050266842 + ], + "z": [ + 0.02082913978980306 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Vulcanisaeta distributa", + "Thermoproteota", + "Thermoproteales", + "WP_054841976.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(134, 211, 73)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.25683161632973117 + ], + "y": [ + 0.13426146455874327 + ], + "z": [ + 0.008385510763646844 + ] + }, + { + "customdata": [ + [ + "Methionine adenosyltransferase", + "Methanoculleus marisnigri", + "Euryarchaeota", + "Methanomicrobia", + "KUK61883.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(66, 59, 130)", + "size": 7 + }, + "mode": "markers", + "text": "Methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.20099152747059593 + ], + "y": [ + -0.05095694637061202 + ], + "z": [ + -0.10177575897551469 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Halobacteriales archaeon QS_3_64_16", + "Euryarchaeota", + "Halobacteria", + "PSP72731.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 22, 104)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.013846346089186367 + ], + "y": [ + 0.1523178627564625 + ], + "z": [ + 0.016274528393487673 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halorubrum vacuolatum", + "Euryarchaeota", + "Halobacteria", + "WP_089384817.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(39, 128, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.026955137588239815 + ], + "y": [ + 0.11339199904347713 + ], + "z": [ + 0.015922485558131513 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanolinea sp.", + "Euryarchaeota", + "Methanomicrobia", + "HII75663.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(48, 107, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.17936430356221894 + ], + "y": [ + -0.018612810182866753 + ], + "z": [ + -0.06663600166605288 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "UCD92258.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.21077686914282975 + ], + "y": [ + -0.21410149177609444 + ], + "z": [ + 0.12491811965675109 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natronobeatus ordinarius", + "Euryarchaeota", + "Halobacteria", + "WP_255194224.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(41, 170, 130)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.047539979589132315 + ], + "y": [ + 0.11672554319201688 + ], + "z": [ + 0.006684380924040092 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natronococcus amylolyticus", + "Euryarchaeota", + "Halobacteria", + "WP_005555509.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(44, 116, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.0221948388024104 + ], + "y": [ + 0.1323391475778323 + ], + "z": [ + -0.009944165058204606 + ] + }, + { + "customdata": [ + [ + "archaeal S-adenosylmethionine synthetase", + "halophilic archaeon J07HX5", + "Euryarchaeota", + "Halobacteria", + "ERG88479.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(172, 220, 48)", + "size": 7 + }, + "mode": "markers", + "text": "archaeal S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.0006660802050822259 + ], + "y": [ + 0.14865499347304778 + ], + "z": [ + 0.01052353272792443 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanobrevibacter sp.", + "Euryarchaeota", + "Methanobacteria", + "MCF0226734.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(35, 142, 140)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.06939774138206524 + ], + "y": [ + 0.01669805634842956 + ], + "z": [ + -0.14816570565004086 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanomicrobiales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "NMC89124.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(58, 83, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.20106776220398567 + ], + "y": [ + -0.054157230281760255 + ], + "z": [ + -0.08997349725398182 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halopiger goleimassiliensis", + "Euryarchaeota", + "Halobacteria", + "WP_049928531.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(46, 110, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.016130110913211825 + ], + "y": [ + 0.13096867760161046 + ], + "z": [ + -0.018125779332681058 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natrononativus amylolyticus", + "Euryarchaeota", + "Halobacteria", + "WP_255167024.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(60, 79, 138)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.0022170771107512576 + ], + "y": [ + 0.131170015233419 + ], + "z": [ + 0.005009566635108049 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halopelagius inordinatus", + "Euryarchaeota", + "Halobacteria", + "WP_092893338.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(64, 67, 134)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.04795601685594687 + ], + "y": [ + 0.11036412300076522 + ], + "z": [ + -0.0020000547616237027 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natronoarchaeum rubrum", + "Euryarchaeota", + "Halobacteria", + "WP_256392138.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(60, 77, 138)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.030940971610893764 + ], + "y": [ + 0.11296924483450725 + ], + "z": [ + 0.008297744036620975 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halomarina rubra", + "Euryarchaeota", + "Halobacteria", + "WP_250875294.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(81, 194, 105)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.04187942647447064 + ], + "y": [ + 0.12265279877391165 + ], + "z": [ + 0.002171612146383973 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanoregulaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "RPI39353.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(36, 136, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.2077776195099853 + ], + "y": [ + -0.05578354671180043 + ], + "z": [ + -0.09648376075666949 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Pyrodictium occultum", + "Thermoproteota", + "Desulfurococcales", + "WP_058370489.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(32, 160, 136)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.22387730828962962 + ], + "y": [ + 0.11326633556740157 + ], + "z": [ + 0.019050339548874338 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MBS3782639.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.222732215454674 + ], + "y": [ + -0.23072656727618934 + ], + "z": [ + 0.1382408654198321 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Verstraetearchaeota archaeon", + "Candidatus Verstraetearchaeota", + null, + "NHW44568.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(49, 179, 124)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.42834882177713723 + ], + "y": [ + 0.2543724776887983 + ], + "z": [ + 0.007975996506161896 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Thermoplasmatales archaeon ex4484_30", + "Candidatus Thermoplasmatota", + "Thermoplasmatales", + "OYT60719.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(220, 227, 40)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.29563786017361715 + ], + "y": [ + -0.3283790371944876 + ], + "z": [ + 0.24513708796251107 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Salinadaptatus halalkaliphilus", + "Euryarchaeota", + "Halobacteria", + "WP_141464562.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(249, 230, 37)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.005211299154455561 + ], + "y": [ + 0.13706408166449155 + ], + "z": [ + -0.009811114867519587 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halolamina salifodinae", + "Euryarchaeota", + "Halobacteria", + "WP_209490980.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(71, 43, 122)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.032460147525716035 + ], + "y": [ + 0.14803340563554662 + ], + "z": [ + -0.0008625486716904369 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "HID73726.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.23077294214220972 + ], + "y": [ + -0.28440966665496376 + ], + "z": [ + 0.11096429369427224 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Halobacteriales archaeon SW_6_65_15", + "Euryarchaeota", + "Halobacteria", + "PSQ49033.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(236, 229, 38)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.034934247386590074 + ], + "y": [ + 0.113419241601778 + ], + "z": [ + -0.01222066469781257 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Bathyarchaeota archaeon", + "Candidatus Bathyarchaeota", + null, + "MCJ7609030.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(55, 184, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.4124345684970245 + ], + "y": [ + -0.7874742367233859 + ], + "z": [ + -0.8902188644525144 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Candidatus Altiarchaeales archaeon WOR_SM1_79", + "Candidatus Altarchaeota", + null, + "ODS37233.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(53, 94, 140)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.049775320547777877 + ], + "y": [ + -0.07474977640055631 + ], + "z": [ + 0.21547665709222102 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Bathyarchaeota archaeon", + "Candidatus Bathyarchaeota", + null, + "MCK4243364.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(55, 184, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.32306262978665345 + ], + "y": [ + 0.1547691456629923 + ], + "z": [ + -0.0737427926780059 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanomicrobiales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "NLA30213.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(58, 83, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.21742973017498787 + ], + "y": [ + -0.04862078370224918 + ], + "z": [ + -0.09596896861271657 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Euryarchaeota archaeon RBG_13_57_23", + "Euryarchaeota", + null, + "OGS43622.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(34, 148, 139)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.16760334124749243 + ], + "y": [ + -0.20090046088971775 + ], + "z": [ + 0.10783094382308064 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halobaculum rubrum", + "Euryarchaeota", + "Halobacteria", + "WP_222914261.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 47, 124)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.01792331357883712 + ], + "y": [ + 0.14122696485090833 + ], + "z": [ + -0.017460809022098626 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Bathyarchaeota archaeon", + "Candidatus Bathyarchaeota", + null, + "UCH01986.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(55, 184, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.30802606698031354 + ], + "y": [ + 0.19778908155381536 + ], + "z": [ + -0.053681498464740234 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanophagales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MBE0517364.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(63, 70, 135)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.2049231101470829 + ], + "y": [ + -0.07323061023271853 + ], + "z": [ + 0.03716441991705909 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natronomonas marina", + "Euryarchaeota", + "Halobacteria", + "WP_254841269.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(52, 97, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.0036201228901662093 + ], + "y": [ + 0.1469862696965148 + ], + "z": [ + -0.009802396275584496 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "MBM4237193.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.19336432605076165 + ], + "y": [ + -0.23606177325494052 + ], + "z": [ + 0.12628677961535928 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halosolutus amylolyticus", + "Euryarchaeota", + "Halobacteria", + "WP_250142161.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(106, 204, 90)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.027590738286474358 + ], + "y": [ + 0.13243506387013326 + ], + "z": [ + 0.02650745400768922 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halogranum gelatinilyticum", + "Euryarchaeota", + "Halobacteria", + "WP_089698184.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(88, 197, 101)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.01939233426087702 + ], + "y": [ + 0.15533398819439387 + ], + "z": [ + 0.007966354980102463 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "MCE5296380.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.2066504956574826 + ], + "y": [ + -0.24582515491949808 + ], + "z": [ + 0.1264407559386889 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halapricum desulfuricans", + "Euryarchaeota", + "Halobacteria", + "WP_229110273.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(210, 226, 41)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.03418985748130383 + ], + "y": [ + 0.13699307951988277 + ], + "z": [ + -0.006674025299040467 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosphaera sp. Vir-13MRS", + "Euryarchaeota", + "Methanobacteria", + "WP_274870358.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 41, 121)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.07631711870190798 + ], + "y": [ + -0.0011682815883943534 + ], + "z": [ + -0.16135285182309628 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halostella pelagica", + "Euryarchaeota", + "Halobacteria", + "WP_135534433.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(48, 177, 125)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.030683985996229245 + ], + "y": [ + 0.1251237614902678 + ], + "z": [ + -0.01902825159975578 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Altiarchaeota archaeon", + "Candidatus Altarchaeota", + null, + "MBN2518333.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(80, 194, 106)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.8128475356863178 + ], + "y": [ + 0.4695984617702563 + ], + "z": [ + 0.8362077023569224 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "MBM4240268.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.11356522621220301 + ], + "y": [ + 0.0028100615712115568 + ], + "z": [ + -0.1323689928707888 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natronosalvus amylolyticus", + "Euryarchaeota", + "Halobacteria", + "WP_254809959.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(39, 128, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.0380750441941392 + ], + "y": [ + 0.1133797451146904 + ], + "z": [ + 0.005571837854429271 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Desulfurococcaceae archaeon", + "Thermoproteota", + "Desulfurococcales", + "MCC6022082.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(69, 50, 125)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.22953833262401804 + ], + "y": [ + 0.10945269094588773 + ], + "z": [ + 0.009499220493039771 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanoculleus horonobensis", + "Euryarchaeota", + "Methanomicrobia", + "WP_067075402.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 39, 119)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.22612383580280218 + ], + "y": [ + -0.04021697754627432 + ], + "z": [ + -0.09076542037598563 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halogeometricum pallidum", + "Euryarchaeota", + "Halobacteria", + "WP_008383527.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(241, 229, 38)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.011372426184766828 + ], + "y": [ + 0.15307798099362313 + ], + "z": [ + -0.0013433591489672224 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoplasmata archaeon", + "Candidatus Thermoplasmatota", + null, + "HIH01356.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(176, 221, 46)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.20609604583786859 + ], + "y": [ + -0.23663445902931035 + ], + "z": [ + 0.142067299373228 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "candidate division MSBL1 archaeon SCGC-AAA259J03", + "Euryarchaeota", + null, + "KXA98460.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(73, 191, 109)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + 0.31201788077651876 + ], + "y": [ + 0.33102750320824537 + ], + "z": [ + 0.5791711663874501 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanomicrobiaceae archaeon", + "Euryarchaeota", + "Methanomicrobia", + "MCC7566529.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(52, 182, 122)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.19678577088406451 + ], + "y": [ + -0.0448296414623408 + ], + "z": [ + -0.07095414300343318 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natronobiforma cellulositropha", + "Euryarchaeota", + "Halobacteria", + "WP_263020555.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(154, 216, 60)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.037193849388562246 + ], + "y": [ + 0.13726424413238983 + ], + "z": [ + 0.015455508860767976 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermosphaera sp.", + "Thermoproteota", + "Desulfurococcales", + "MCC6054709.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(222, 227, 40)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.2050964269245425 + ], + "y": [ + 0.10013884191429695 + ], + "z": [ + 0.009836252978547334 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanofollis sp. W23", + "Euryarchaeota", + "Methanomicrobia", + "WP_209628966.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(69, 51, 125)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1965339399696559 + ], + "y": [ + -0.03290184433292095 + ], + "z": [ + -0.06369669058784387 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Haladaptatus salinisoli", + "Euryarchaeota", + "Halobacteria", + "WP_227354255.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(58, 81, 138)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.04802285842832433 + ], + "y": [ + 0.12365852898430832 + ], + "z": [ + 0.00848943137713002 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoprotei archaeon", + "Thermoproteota", + null, + "RLG86825.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(183, 222, 43)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.25490647979098263 + ], + "y": [ + 0.12746312902850804 + ], + "z": [ + 0.002250961065709231 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Desulfurococcaceae archaeon", + "Thermoproteota", + "Desulfurococcales", + "PWV37647.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(69, 50, 125)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.22812517987034497 + ], + "y": [ + 0.1460115681286942 + ], + "z": [ + 0.013267020551854481 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Salinilacihabitans rarus", + "Euryarchaeota", + "Halobacteria", + "WP_254768129.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(43, 172, 128)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.000565747779672603 + ], + "y": [ + 0.13910412755816623 + ], + "z": [ + -0.004821599059519937 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halohasta litchfieldiae", + "Euryarchaeota", + "Halobacteria", + "WP_089670865.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(49, 104, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.03452960571301807 + ], + "y": [ + 0.1431426844338317 + ], + "z": [ + 0.011473610276587288 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Nanohaloarchaeota archaeon QJJ-5", + "Candidatus Nanohaloarchaeota", + null, + "MCJ7428959.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(35, 143, 140)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.8585169810732752 + ], + "y": [ + -0.2586737101856149 + ], + "z": [ + -0.5963398335589324 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natribaculum luteum", + "Euryarchaeota", + "Halobacteria", + "WP_246968680.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(144, 214, 67)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.04190379516872054 + ], + "y": [ + 0.13121602947670002 + ], + "z": [ + 0.0003873855573717473 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosarcinales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "RLG37179.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(70, 21, 103)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.2887985734609542 + ], + "y": [ + -0.1262065567184775 + ], + "z": [ + 0.08188492193816922 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanosphaera cuniculi", + "Euryarchaeota", + "Methanobacteria", + "WP_095607844.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(35, 163, 134)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.07456470281088737 + ], + "y": [ + 0.0031703047570862983 + ], + "z": [ + -0.158874913632797 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halegenticoccus soli", + "Euryarchaeota", + "Halobacteria", + "WP_101297280.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(48, 107, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.011644923308157848 + ], + "y": [ + 0.11870722025145078 + ], + "z": [ + 0.02014292574441181 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "unclassified Methanocalculus", + "Euryarchaeota", + "Methanomicrobia", + "WP_253458115.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(42, 119, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.21175431531178912 + ], + "y": [ + -0.01794025021647753 + ], + "z": [ + -0.0974757371949339 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Euryarchaeota archaeon", + "Euryarchaeota", + null, + "UCE80363.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(115, 207, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.19310353804445213 + ], + "y": [ + -0.22297105615190077 + ], + "z": [ + 0.13941655222181432 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Thermoprotei archaeon", + "Thermoproteota", + null, + "MCD6114320.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(183, 222, 43)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.24619445849396915 + ], + "y": [ + 0.12748405958118256 + ], + "z": [ + 0.012885437314622267 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natronobacterium texcoconense", + "Euryarchaeota", + "Halobacteria", + "WP_090386117.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(52, 96, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.034798307708589375 + ], + "y": [ + 0.13785304173593058 + ], + "z": [ + 0.00022348330842303176 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Halobacteriales archaeon QS_8_69_26", + "Euryarchaeota", + "Halobacteria", + "PSQ15689.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(104, 204, 91)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.03752711220679854 + ], + "y": [ + 0.1142740081757647 + ], + "z": [ + 0.01565167083784945 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natrarchaeobius chitinivorans", + "Euryarchaeota", + "Halobacteria", + "WP_124197364.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(63, 69, 135)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.03123006234004002 + ], + "y": [ + 0.1292141492620188 + ], + "z": [ + -0.016869428556231993 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Haloprofundus halophilus", + "Euryarchaeota", + "Halobacteria", + "WP_117591019.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(48, 106, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.03591367611208579 + ], + "y": [ + 0.10902120875968137 + ], + "z": [ + -0.00402772070247011 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Theionarchaea archaeon", + "Euryarchaeota", + null, + "MBU7025755.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(37, 165, 132)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.8089501131655384 + ], + "y": [ + 0.4442553501965237 + ], + "z": [ + -0.14907612637604095 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halogranum rubrum", + "Euryarchaeota", + "Halobacteria", + "WP_089871735.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(76, 192, 107)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.010562872403394484 + ], + "y": [ + 0.14316616931015308 + ], + "z": [ + 0.015412377694884344 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natronococcus jeotgali", + "Euryarchaeota", + "Halobacteria", + "WP_008425871.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(71, 26, 107)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.017788625748620297 + ], + "y": [ + 0.13942854457113849 + ], + "z": [ + 0.019360542453714623 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Thermoplasmatota archaeon", + "Candidatus Thermoplasmatota", + null, + "MCL5666017.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(72, 40, 120)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.26541163179454674 + ], + "y": [ + -0.2037424810361282 + ], + "z": [ + 0.062132556951226194 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Candidatus Micrarchaeota archaeon", + "Candidatus Micrarchaeota", + null, + "MBI5159355.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(41, 123, 142)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.8124600829018415 + ], + "y": [ + -0.7230339476950353 + ], + "z": [ + 0.8023177843540765 + ] + }, + { + "customdata": [ + [ + "S-adenosylmethionine synthetase", + "Halobacteriales archaeon QS_4_62_28", + "Euryarchaeota", + "Halobacteria", + "PSP93059.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(42, 171, 129)", + "size": 7 + }, + "mode": "markers", + "text": "S-adenosylmethionine synthetase", + "type": "scatter3d", + "x": [ + -0.005413606596445798 + ], + "y": [ + 0.14349888560275992 + ], + "z": [ + 0.023984979528447303 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halorussus vallis", + "Euryarchaeota", + "Halobacteria", + "WP_253516867.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(90, 198, 100)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.01919106540005617 + ], + "y": [ + 0.12017847424192976 + ], + "z": [ + 0.024604961307963143 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halorubrum sp. 48-1-W", + "Euryarchaeota", + "Halobacteria", + "WP_112079538.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(245, 230, 38)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.02092300705155082 + ], + "y": [ + 0.14949497515096472 + ], + "z": [ + 0.0023212230792628787 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Theionarchaea archaeon", + "Euryarchaeota", + null, + "MBU7031515.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(37, 165, 132)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + 0.816749206361719 + ], + "y": [ + 0.4705776489265028 + ], + "z": [ + -0.1291596429815075 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natrialba asiatica", + "Euryarchaeota", + "Halobacteria", + "WP_006109281.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(51, 98, 141)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.025066997213201617 + ], + "y": [ + 0.1482422443944375 + ], + "z": [ + 0.011697557838537848 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanomicrobiales archaeon", + "Euryarchaeota", + "Methanomicrobia", + "NLA39026.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(58, 83, 139)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.21512893650831605 + ], + "y": [ + -0.05049832840306235 + ], + "z": [ + -0.08662173103105054 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "unclassified Halorhabdus", + "Euryarchaeota", + "Halobacteria", + "WP_154552100.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(34, 162, 135)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.04850751144401809 + ], + "y": [ + 0.11884495317326671 + ], + "z": [ + -0.0033186831292885883 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Halobellus", + "Euryarchaeota", + "Halobacteria", + "WP_256287971.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(65, 64, 132)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.02559067067204765 + ], + "y": [ + 0.12049405482667874 + ], + "z": [ + 0.01737979538696331 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Methanofollis fontis", + "Euryarchaeota", + "Methanomicrobia", + "WP_130646405.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(66, 61, 131)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.1847988247565108 + ], + "y": [ + -0.04050167083908747 + ], + "z": [ + -0.06924110230629237 + ] + }, + { + "customdata": [ + [ + "methionine adenosyltransferase", + "Natrarchaeobius halalkaliphilus", + "Euryarchaeota", + "Halobacteria", + "WP_124177345.1" + ] + ], + "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + "marker": { + "color": "rgb(68, 2, 85)", + "size": 7 + }, + "mode": "markers", + "text": "methionine adenosyltransferase", + "type": "scatter3d", + "x": [ + -0.030158796521055915 + ], + "y": [ + 0.1389772978797611 + ], + "z": [ + 0.012477334393911991 + ] + } + ], + "layout": { + "hovermode": "closest", + "margin": { + "b": 0, + "l": 0, + "r": 0, + "t": 0 + }, + "plot_bgcolor": "white", + "scene": { + "xaxis": { + "visible": false + }, + "yaxis": { + "visible": false + }, + "zaxis": { + "visible": false + } + }, + "showlegend": false, + "template": { + "data": { + "bar": [ + { + "error_x": { + "color": "#2a3f5f" + }, + "error_y": { + "color": "#2a3f5f" + }, + "marker": { + "line": { + "color": "#E5ECF6", + "width": 0.5 + }, + "pattern": { + "fillmode": "overlay", + "size": 10, + "solidity": 0.2 + } + }, + "type": "bar" + } + ], + "barpolar": [ + { + "marker": { + "line": { + "color": "#E5ECF6", + "width": 0.5 + }, + "pattern": { + "fillmode": "overlay", + "size": 10, + "solidity": 0.2 + } + }, + "type": "barpolar" + } + ], + "carpet": [ + { + "aaxis": { + "endlinecolor": "#2a3f5f", + "gridcolor": "white", + "linecolor": "white", + "minorgridcolor": "white", + "startlinecolor": "#2a3f5f" + }, + "baxis": { + "endlinecolor": "#2a3f5f", + "gridcolor": "white", + "linecolor": "white", + "minorgridcolor": "white", + "startlinecolor": "#2a3f5f" + }, + "type": "carpet" + } + ], + "choropleth": [ + { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + }, + "type": "choropleth" + } + ], + "contour": [ + { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + }, + "colorscale": [ + [ + 0, + "#0d0887" + ], + [ + 0.1111111111111111, + "#46039f" + ], + [ + 0.2222222222222222, + "#7201a8" + ], + [ + 0.3333333333333333, + "#9c179e" + ], + [ + 0.4444444444444444, + "#bd3786" + ], + [ + 0.5555555555555556, + "#d8576b" + ], + [ + 0.6666666666666666, + "#ed7953" + ], + [ + 0.7777777777777778, + "#fb9f3a" + ], + [ + 0.8888888888888888, + "#fdca26" + ], + [ + 1, + "#f0f921" + ] + ], + "type": "contour" + } + ], + "contourcarpet": [ + { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + }, + "type": "contourcarpet" + } + ], + "heatmap": [ + { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + }, + "colorscale": [ + [ + 0, + "#0d0887" + ], + [ + 0.1111111111111111, + "#46039f" + ], + [ + 0.2222222222222222, + "#7201a8" + ], + [ + 0.3333333333333333, + "#9c179e" + ], + [ + 0.4444444444444444, + "#bd3786" + ], + [ + 0.5555555555555556, + "#d8576b" + ], + [ + 0.6666666666666666, + "#ed7953" + ], + [ + 0.7777777777777778, + "#fb9f3a" + ], + [ + 0.8888888888888888, + "#fdca26" + ], + [ + 1, + "#f0f921" + ] + ], + "type": "heatmap" + } + ], + "heatmapgl": [ + { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + }, + "colorscale": [ + [ + 0, + "#0d0887" + ], + [ + 0.1111111111111111, + "#46039f" + ], + [ + 0.2222222222222222, + "#7201a8" + ], + [ + 0.3333333333333333, + "#9c179e" + ], + [ + 0.4444444444444444, + "#bd3786" + ], + [ + 0.5555555555555556, + "#d8576b" + ], + [ + 0.6666666666666666, + "#ed7953" + ], + [ + 0.7777777777777778, + "#fb9f3a" + ], + [ + 0.8888888888888888, + "#fdca26" + ], + [ + 1, + "#f0f921" + ] + ], + "type": "heatmapgl" + } + ], + "histogram": [ + { + "marker": { + "pattern": { + "fillmode": "overlay", + "size": 10, + "solidity": 0.2 + } + }, + "type": "histogram" + } + ], + "histogram2d": [ + { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + }, + "colorscale": [ + [ + 0, + "#0d0887" + ], + [ + 0.1111111111111111, + "#46039f" + ], + [ + 0.2222222222222222, + "#7201a8" + ], + [ + 0.3333333333333333, + "#9c179e" + ], + [ + 0.4444444444444444, + "#bd3786" + ], + [ + 0.5555555555555556, + "#d8576b" + ], + [ + 0.6666666666666666, + "#ed7953" + ], + [ + 0.7777777777777778, + "#fb9f3a" + ], + [ + 0.8888888888888888, + "#fdca26" + ], + [ + 1, + "#f0f921" + ] + ], + "type": "histogram2d" + } + ], + "histogram2dcontour": [ + { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + }, + "colorscale": [ + [ + 0, + "#0d0887" + ], + [ + 0.1111111111111111, + "#46039f" + ], + [ + 0.2222222222222222, + "#7201a8" + ], + [ + 0.3333333333333333, + "#9c179e" + ], + [ + 0.4444444444444444, + "#bd3786" + ], + [ + 0.5555555555555556, + "#d8576b" + ], + [ + 0.6666666666666666, + "#ed7953" + ], + [ + 0.7777777777777778, + "#fb9f3a" + ], + [ + 0.8888888888888888, + "#fdca26" + ], + [ + 1, + "#f0f921" + ] + ], + "type": "histogram2dcontour" + } + ], + "mesh3d": [ + { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + }, + "type": "mesh3d" + } + ], + "parcoords": [ + { + "line": { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + } + }, + "type": "parcoords" + } + ], + "pie": [ + { + "automargin": true, + "type": "pie" + } + ], + "scatter": [ + { + "fillpattern": { + "fillmode": "overlay", + "size": 10, + "solidity": 0.2 + }, + "type": "scatter" + } + ], + "scatter3d": [ + { + "line": { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + } + }, + "marker": { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + } + }, + "type": "scatter3d" + } + ], + "scattercarpet": [ + { + "marker": { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + } + }, + "type": "scattercarpet" + } + ], + "scattergeo": [ + { + "marker": { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + } + }, + "type": "scattergeo" + } + ], + "scattergl": [ + { + "marker": { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + } + }, + "type": "scattergl" + } + ], + "scattermapbox": [ + { + "marker": { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + } + }, + "type": "scattermapbox" + } + ], + "scatterpolar": [ + { + "marker": { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + } + }, + "type": "scatterpolar" + } + ], + "scatterpolargl": [ + { + "marker": { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + } + }, + "type": "scatterpolargl" + } + ], + "scatterternary": [ + { + "marker": { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + } + }, + "type": "scatterternary" + } + ], + "surface": [ + { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + }, + "colorscale": [ + [ + 0, + "#0d0887" + ], + [ + 0.1111111111111111, + "#46039f" + ], + [ + 0.2222222222222222, + "#7201a8" + ], + [ + 0.3333333333333333, + "#9c179e" + ], + [ + 0.4444444444444444, + "#bd3786" + ], + [ + 0.5555555555555556, + "#d8576b" + ], + [ + 0.6666666666666666, + "#ed7953" + ], + [ + 0.7777777777777778, + "#fb9f3a" + ], + [ + 0.8888888888888888, + "#fdca26" + ], + [ + 1, + "#f0f921" + ] + ], + "type": "surface" + } + ], + "table": [ + { + "cells": { + "fill": { + "color": "#EBF0F8" + }, + "line": { + "color": "white" + } + }, + "header": { + "fill": { + "color": "#C8D4E3" + }, + "line": { + "color": "white" + } + }, + "type": "table" + } + ] + }, + "layout": { + "annotationdefaults": { + "arrowcolor": "#2a3f5f", + "arrowhead": 0, + "arrowwidth": 1 + }, + "autotypenumbers": "strict", + "coloraxis": { + "colorbar": { + "outlinewidth": 0, + "ticks": "" + } + }, + "colorscale": { + "diverging": [ + [ + 0, + "#8e0152" + ], + [ + 0.1, + "#c51b7d" + ], + [ + 0.2, + "#de77ae" + ], + [ + 0.3, + "#f1b6da" + ], + [ + 0.4, + "#fde0ef" + ], + [ + 0.5, + "#f7f7f7" + ], + [ + 0.6, + "#e6f5d0" + ], + [ + 0.7, + "#b8e186" + ], + [ + 0.8, + "#7fbc41" + ], + [ + 0.9, + "#4d9221" + ], + [ + 1, + "#276419" + ] + ], + "sequential": [ + [ + 0, + "#0d0887" + ], + [ + 0.1111111111111111, + "#46039f" + ], + [ + 0.2222222222222222, + "#7201a8" + ], + [ + 0.3333333333333333, + "#9c179e" + ], + [ + 0.4444444444444444, + "#bd3786" + ], + [ + 0.5555555555555556, + "#d8576b" + ], + [ + 0.6666666666666666, + "#ed7953" + ], + [ + 0.7777777777777778, + "#fb9f3a" + ], + [ + 0.8888888888888888, + "#fdca26" + ], + [ + 1, + "#f0f921" + ] + ], + "sequentialminus": [ + [ + 0, + "#0d0887" + ], + [ + 0.1111111111111111, + "#46039f" + ], + [ + 0.2222222222222222, + "#7201a8" + ], + [ + 0.3333333333333333, + "#9c179e" + ], + [ + 0.4444444444444444, + "#bd3786" + ], + [ + 0.5555555555555556, + "#d8576b" + ], + [ + 0.6666666666666666, + "#ed7953" + ], + [ + 0.7777777777777778, + "#fb9f3a" + ], + [ + 0.8888888888888888, + "#fdca26" + ], + [ + 1, + "#f0f921" + ] + ] + }, + "colorway": [ + "#636efa", + "#EF553B", + "#00cc96", + "#ab63fa", + "#FFA15A", + "#19d3f3", + "#FF6692", + "#B6E880", + "#FF97FF", + "#FECB52" + ], + "font": { + "color": "#2a3f5f" + }, + "geo": { + "bgcolor": "white", + "lakecolor": "white", + "landcolor": "#E5ECF6", + "showlakes": true, + "showland": true, + "subunitcolor": "white" + }, + "hoverlabel": { + "align": "left" + }, + "hovermode": "closest", + "mapbox": { + "style": "light" + }, + "paper_bgcolor": "white", + "plot_bgcolor": "#E5ECF6", + "polar": { + "angularaxis": { + "gridcolor": "white", + "linecolor": "white", + "ticks": "" + }, + "bgcolor": "#E5ECF6", + "radialaxis": { + "gridcolor": "white", + "linecolor": "white", + "ticks": "" + } + }, + "scene": { + "xaxis": { + "backgroundcolor": "#E5ECF6", + "gridcolor": "white", + "gridwidth": 2, + "linecolor": "white", + "showbackground": true, + "ticks": "", + "zerolinecolor": "white" + }, + "yaxis": { + "backgroundcolor": "#E5ECF6", + "gridcolor": "white", + "gridwidth": 2, + "linecolor": "white", + "showbackground": true, + "ticks": "", + "zerolinecolor": "white" + }, + "zaxis": { + "backgroundcolor": "#E5ECF6", + "gridcolor": "white", + "gridwidth": 2, + "linecolor": "white", + "showbackground": true, + "ticks": "", + "zerolinecolor": "white" + } + }, + "shapedefaults": { + "line": { + "color": "#2a3f5f" + } + }, + "ternary": { + "aaxis": { + "gridcolor": "white", + "linecolor": "white", + "ticks": "" + }, + "baxis": { + "gridcolor": "white", + "linecolor": "white", + "ticks": "" + }, + "bgcolor": "#E5ECF6", + "caxis": { + "gridcolor": "white", + "linecolor": "white", + "ticks": "" + } + }, + "title": { + "x": 0.05 + }, + "xaxis": { + "automargin": true, + "gridcolor": "white", + "linecolor": "white", + "ticks": "", + "title": { + "standoff": 15 + }, + "zerolinecolor": "white", + "zerolinewidth": 2 + }, + "yaxis": { + "automargin": true, + "gridcolor": "white", + "linecolor": "white", + "ticks": "", + "title": { + "standoff": 15 + }, + "zerolinecolor": "white", + "zerolinewidth": 2 + } + } + }, + "xaxis": { + "visible": false + }, + "yaxis": { + "visible": false + } + } + } + }, + "metadata": {}, + "output_type": "display_data" + } + ], + "source": [ + "n = SequenceNetwork(\n", + " sequences=blast_results,\n", + " pairwise_alignments=multi_parwise_alignments,\n", + " threshold=0.65,\n", + " weight=\"identity\",\n", + " dimensions=3,\n", + " color=\"taxonomy_id\",\n", + ")\n", + "n.visualize()" + ] + } + ], + "metadata": { + "kernelspec": { + "display_name": "pye", + "language": "python", + "name": "python3" + }, + "language_info": { + "codemirror_mode": { + "name": "ipython", + "version": 3 + }, + "file_extension": ".py", + "mimetype": "text/x-python", + "name": "python", + "nbconvert_exporter": "python", + "pygments_lexer": "ipython3", + "version": "3.10.13" + } + }, + "nbformat": 4, + "nbformat_minor": 2 +} diff --git a/examples/test.ipynb b/examples/test.ipynb deleted file mode 100644 index fddfea96..00000000 --- a/examples/test.ipynb +++ /dev/null @@ -1,259 +0,0 @@ -{ - "cells": [ - { - "cell_type": "markdown", - "metadata": {}, - "source": [ - "# Test Docker-integrated Aligners" - ] - }, - { - "cell_type": "code", - "execution_count": 1, - "metadata": {}, - "outputs": [], - "source": [ - "%reload_ext autoreload\n", - "%autoreload 2\n", - "from pyeed.core import ProteinInfo\n", - "from pyeed.core import Alignment\n", - "from pyeed.aligners import ClustalOmega\n" - ] - }, - { - "cell_type": "code", - "execution_count": 2, - "metadata": {}, - "outputs": [], - "source": [ - "# Get a query sequence from NCBI\n", - "ald1 = ProteinInfo.from_ncbi(\"UCS38941.1\")" - ] - }, - { - "cell_type": "code", - "execution_count": 3, - "metadata": {}, - "outputs": [ - { - "ename": "KeyboardInterrupt", - "evalue": "", - "output_type": "error", - "traceback": [ - "\u001b[0;31m---------------------------------------------------------------------------\u001b[0m", - "\u001b[0;31mKeyboardInterrupt\u001b[0m Traceback (most recent call last)", - "Cell \u001b[0;32mIn[3], line 2\u001b[0m\n\u001b[1;32m 1\u001b[0m \u001b[38;5;66;03m# Run local blastp search\u001b[39;00m\n\u001b[0;32m----> 2\u001b[0m blast_results \u001b[38;5;241m=\u001b[39m \u001b[43mald1\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mblastp\u001b[49m\u001b[43m(\u001b[49m\n\u001b[1;32m 3\u001b[0m \u001b[43m \u001b[49m\u001b[43mdb_path\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[38;5;124;43m\"\u001b[39;49m\u001b[38;5;124;43m/Users/max/Documents/GitHub/blast-db/data/source\u001b[39;49m\u001b[38;5;124;43m\"\u001b[39;49m\u001b[43m,\u001b[49m\n\u001b[1;32m 4\u001b[0m \u001b[43m \u001b[49m\u001b[43mn_hits\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[38;5;241;43m100\u001b[39;49m\u001b[43m,\u001b[49m\n\u001b[1;32m 5\u001b[0m \u001b[43m)\u001b[49m\n", - "File \u001b[0;32m~/Documents/GitHub/pyeed/pyeed/core/proteininfo.py:261\u001b[0m, in \u001b[0;36mProteinInfo.blastp\u001b[0;34m(self, db_path, identity, evalue, n_hits, subst_matrix, word_size, gapopen, gapextend, threshold, n_cores, ncbi_key)\u001b[0m\n\u001b[1;32m 247\u001b[0m \u001b[38;5;28;01mdef\u001b[39;00m \u001b[38;5;21mblastp\u001b[39m(\n\u001b[1;32m 248\u001b[0m \u001b[38;5;28mself\u001b[39m,\n\u001b[1;32m 249\u001b[0m db_path: \u001b[38;5;28mstr\u001b[39m,\n\u001b[0;32m (...)\u001b[0m\n\u001b[1;32m 259\u001b[0m ncbi_key: \u001b[38;5;28mstr\u001b[39m \u001b[38;5;241m=\u001b[39m \u001b[38;5;28;01mNone\u001b[39;00m,\n\u001b[1;32m 260\u001b[0m ):\n\u001b[0;32m--> 261\u001b[0m blaster \u001b[38;5;241m=\u001b[39m \u001b[43mBlastp\u001b[49m\u001b[43m(\u001b[49m\n\u001b[1;32m 262\u001b[0m \u001b[43m \u001b[49m\u001b[43m_db_path\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mdb_path\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 263\u001b[0m \u001b[43m \u001b[49m\u001b[43midentity\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43midentity\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 264\u001b[0m \u001b[43m \u001b[49m\u001b[43mevalue\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mevalue\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 265\u001b[0m \u001b[43m \u001b[49m\u001b[43mn_hits\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mn_hits\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 266\u001b[0m \u001b[43m \u001b[49m\u001b[43msubst_matrix\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43msubst_matrix\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 267\u001b[0m \u001b[43m \u001b[49m\u001b[43mword_size\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mword_size\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 268\u001b[0m \u001b[43m \u001b[49m\u001b[43mgapopen\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mgapopen\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 269\u001b[0m \u001b[43m \u001b[49m\u001b[43mgapextend\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mgapextend\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 270\u001b[0m \u001b[43m \u001b[49m\u001b[43mthreshold\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mthreshold\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 271\u001b[0m \u001b[43m \u001b[49m\u001b[43mn_cores\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mn_cores\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 272\u001b[0m \u001b[43m \u001b[49m\u001b[43mncbi_key\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mncbi_key\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 273\u001b[0m \u001b[43m \u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 275\u001b[0m command \u001b[38;5;241m=\u001b[39m blaster\u001b[38;5;241m.\u001b[39msetup_command()\n\u001b[1;32m 276\u001b[0m accession_ids \u001b[38;5;241m=\u001b[39m blaster\u001b[38;5;241m.\u001b[39mrun_container(command\u001b[38;5;241m=\u001b[39mcommand, data\u001b[38;5;241m=\u001b[39m\u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39mto_fasta())\n", - "File \u001b[0;32m~/Documents/GitHub/pyeed/pyeed/containers/abstract_container.py:152\u001b[0m, in \u001b[0;36mBlastp.__init__\u001b[0;34m(self, _db_path, ncbi_key, **kwargs)\u001b[0m\n\u001b[1;32m 151\u001b[0m \u001b[38;5;28;01mdef\u001b[39;00m \u001b[38;5;21m__init__\u001b[39m(\u001b[38;5;28mself\u001b[39m, _db_path: \u001b[38;5;28mstr\u001b[39m, ncbi_key: \u001b[38;5;28mstr\u001b[39m \u001b[38;5;241m=\u001b[39m \u001b[38;5;28;01mNone\u001b[39;00m, \u001b[38;5;241m*\u001b[39m\u001b[38;5;241m*\u001b[39mkwargs):\n\u001b[0;32m--> 152\u001b[0m \u001b[38;5;28;43msuper\u001b[39;49m\u001b[43m(\u001b[49m\u001b[43m)\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[38;5;21;43m__init__\u001b[39;49m\u001b[43m(\u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43mkwargs\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 153\u001b[0m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_db_path \u001b[38;5;241m=\u001b[39m _db_path\n\u001b[1;32m 154\u001b[0m \u001b[38;5;28;01mif\u001b[39;00m \u001b[38;5;129;01mnot\u001b[39;00m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_ncbi_key:\n", - "File \u001b[0;32m~/Documents/GitHub/pyeed/pyeed/containers/abstract_container.py:65\u001b[0m, in \u001b[0;36mAbstractContainer.__init__\u001b[0;34m(self, **kwargs)\u001b[0m\n\u001b[1;32m 63\u001b[0m \u001b[38;5;28msuper\u001b[39m()\u001b[38;5;241m.\u001b[39m\u001b[38;5;21m__init__\u001b[39m(\u001b[38;5;241m*\u001b[39m\u001b[38;5;241m*\u001b[39mkwargs)\n\u001b[1;32m 64\u001b[0m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_tempdir_path \u001b[38;5;241m=\u001b[39m tempfile\u001b[38;5;241m.\u001b[39mmkdtemp()\n\u001b[0;32m---> 65\u001b[0m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_client \u001b[38;5;241m=\u001b[39m \u001b[43mdocker\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mfrom_env\u001b[49m\u001b[43m(\u001b[49m\u001b[43m)\u001b[49m\n", - "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/docker/client.py:94\u001b[0m, in \u001b[0;36mDockerClient.from_env\u001b[0;34m(cls, **kwargs)\u001b[0m\n\u001b[1;32m 92\u001b[0m version \u001b[38;5;241m=\u001b[39m kwargs\u001b[38;5;241m.\u001b[39mpop(\u001b[38;5;124m'\u001b[39m\u001b[38;5;124mversion\u001b[39m\u001b[38;5;124m'\u001b[39m, \u001b[38;5;28;01mNone\u001b[39;00m)\n\u001b[1;32m 93\u001b[0m use_ssh_client \u001b[38;5;241m=\u001b[39m kwargs\u001b[38;5;241m.\u001b[39mpop(\u001b[38;5;124m'\u001b[39m\u001b[38;5;124muse_ssh_client\u001b[39m\u001b[38;5;124m'\u001b[39m, \u001b[38;5;28;01mFalse\u001b[39;00m)\n\u001b[0;32m---> 94\u001b[0m \u001b[38;5;28;01mreturn\u001b[39;00m \u001b[38;5;28;43mcls\u001b[39;49m\u001b[43m(\u001b[49m\n\u001b[1;32m 95\u001b[0m \u001b[43m \u001b[49m\u001b[43mtimeout\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mtimeout\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 96\u001b[0m \u001b[43m \u001b[49m\u001b[43mmax_pool_size\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mmax_pool_size\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 97\u001b[0m \u001b[43m \u001b[49m\u001b[43mversion\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mversion\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 98\u001b[0m \u001b[43m \u001b[49m\u001b[43muse_ssh_client\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43muse_ssh_client\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 99\u001b[0m \u001b[43m \u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43mkwargs_from_env\u001b[49m\u001b[43m(\u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43mkwargs\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 100\u001b[0m \u001b[43m\u001b[49m\u001b[43m)\u001b[49m\n", - "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/docker/client.py:45\u001b[0m, in \u001b[0;36mDockerClient.__init__\u001b[0;34m(self, *args, **kwargs)\u001b[0m\n\u001b[1;32m 44\u001b[0m \u001b[38;5;28;01mdef\u001b[39;00m \u001b[38;5;21m__init__\u001b[39m(\u001b[38;5;28mself\u001b[39m, \u001b[38;5;241m*\u001b[39margs, \u001b[38;5;241m*\u001b[39m\u001b[38;5;241m*\u001b[39mkwargs):\n\u001b[0;32m---> 45\u001b[0m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39mapi \u001b[38;5;241m=\u001b[39m \u001b[43mAPIClient\u001b[49m\u001b[43m(\u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43margs\u001b[49m\u001b[43m,\u001b[49m\u001b[43m \u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43mkwargs\u001b[49m\u001b[43m)\u001b[49m\n", - "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/docker/api/client.py:197\u001b[0m, in \u001b[0;36mAPIClient.__init__\u001b[0;34m(self, base_url, version, timeout, tls, user_agent, num_pools, credstore_env, use_ssh_client, max_pool_size)\u001b[0m\n\u001b[1;32m 192\u001b[0m \u001b[38;5;66;03m# version detection needs to be after unix adapter mounting\u001b[39;00m\n\u001b[1;32m 193\u001b[0m \u001b[38;5;28;01mif\u001b[39;00m version \u001b[38;5;129;01mis\u001b[39;00m \u001b[38;5;28;01mNone\u001b[39;00m \u001b[38;5;129;01mor\u001b[39;00m (\u001b[38;5;28misinstance\u001b[39m(\n\u001b[1;32m 194\u001b[0m version,\n\u001b[1;32m 195\u001b[0m \u001b[38;5;28mstr\u001b[39m\n\u001b[1;32m 196\u001b[0m ) \u001b[38;5;129;01mand\u001b[39;00m version\u001b[38;5;241m.\u001b[39mlower() \u001b[38;5;241m==\u001b[39m \u001b[38;5;124m'\u001b[39m\u001b[38;5;124mauto\u001b[39m\u001b[38;5;124m'\u001b[39m):\n\u001b[0;32m--> 197\u001b[0m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_version \u001b[38;5;241m=\u001b[39m \u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43m_retrieve_server_version\u001b[49m\u001b[43m(\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 198\u001b[0m \u001b[38;5;28;01melse\u001b[39;00m:\n\u001b[1;32m 199\u001b[0m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_version \u001b[38;5;241m=\u001b[39m version\n", - "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/docker/api/client.py:213\u001b[0m, in \u001b[0;36mAPIClient._retrieve_server_version\u001b[0;34m(self)\u001b[0m\n\u001b[1;32m 211\u001b[0m \u001b[38;5;28;01mdef\u001b[39;00m \u001b[38;5;21m_retrieve_server_version\u001b[39m(\u001b[38;5;28mself\u001b[39m):\n\u001b[1;32m 212\u001b[0m \u001b[38;5;28;01mtry\u001b[39;00m:\n\u001b[0;32m--> 213\u001b[0m \u001b[38;5;28;01mreturn\u001b[39;00m \u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mversion\u001b[49m\u001b[43m(\u001b[49m\u001b[43mapi_version\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[38;5;28;43;01mFalse\u001b[39;49;00m\u001b[43m)\u001b[49m[\u001b[38;5;124m\"\u001b[39m\u001b[38;5;124mApiVersion\u001b[39m\u001b[38;5;124m\"\u001b[39m]\n\u001b[1;32m 214\u001b[0m \u001b[38;5;28;01mexcept\u001b[39;00m \u001b[38;5;167;01mKeyError\u001b[39;00m \u001b[38;5;28;01mas\u001b[39;00m ke:\n\u001b[1;32m 215\u001b[0m \u001b[38;5;28;01mraise\u001b[39;00m DockerException(\n\u001b[1;32m 216\u001b[0m \u001b[38;5;124m'\u001b[39m\u001b[38;5;124mInvalid response from docker daemon: key \u001b[39m\u001b[38;5;124m\"\u001b[39m\u001b[38;5;124mApiVersion\u001b[39m\u001b[38;5;124m\"\u001b[39m\u001b[38;5;124m'\u001b[39m\n\u001b[1;32m 217\u001b[0m \u001b[38;5;124m'\u001b[39m\u001b[38;5;124m is missing.\u001b[39m\u001b[38;5;124m'\u001b[39m\n\u001b[1;32m 218\u001b[0m ) \u001b[38;5;28;01mfrom\u001b[39;00m \u001b[38;5;21;01mke\u001b[39;00m\n", - "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/docker/api/daemon.py:181\u001b[0m, in \u001b[0;36mDaemonApiMixin.version\u001b[0;34m(self, api_version)\u001b[0m\n\u001b[1;32m 169\u001b[0m \u001b[38;5;250m\u001b[39m\u001b[38;5;124;03m\"\"\"\u001b[39;00m\n\u001b[1;32m 170\u001b[0m \u001b[38;5;124;03mReturns version information from the server. Similar to the ``docker\u001b[39;00m\n\u001b[1;32m 171\u001b[0m \u001b[38;5;124;03mversion`` command.\u001b[39;00m\n\u001b[0;32m (...)\u001b[0m\n\u001b[1;32m 178\u001b[0m \u001b[38;5;124;03m If the server returns an error.\u001b[39;00m\n\u001b[1;32m 179\u001b[0m \u001b[38;5;124;03m\"\"\"\u001b[39;00m\n\u001b[1;32m 180\u001b[0m url \u001b[38;5;241m=\u001b[39m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_url(\u001b[38;5;124m\"\u001b[39m\u001b[38;5;124m/version\u001b[39m\u001b[38;5;124m\"\u001b[39m, versioned_api\u001b[38;5;241m=\u001b[39mapi_version)\n\u001b[0;32m--> 181\u001b[0m \u001b[38;5;28;01mreturn\u001b[39;00m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_result(\u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43m_get\u001b[49m\u001b[43m(\u001b[49m\u001b[43murl\u001b[49m\u001b[43m)\u001b[49m, json\u001b[38;5;241m=\u001b[39m\u001b[38;5;28;01mTrue\u001b[39;00m)\n", - "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/docker/utils/decorators.py:44\u001b[0m, in \u001b[0;36mupdate_headers..inner\u001b[0;34m(self, *args, **kwargs)\u001b[0m\n\u001b[1;32m 42\u001b[0m \u001b[38;5;28;01melse\u001b[39;00m:\n\u001b[1;32m 43\u001b[0m kwargs[\u001b[38;5;124m'\u001b[39m\u001b[38;5;124mheaders\u001b[39m\u001b[38;5;124m'\u001b[39m]\u001b[38;5;241m.\u001b[39mupdate(\u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_general_configs[\u001b[38;5;124m'\u001b[39m\u001b[38;5;124mHttpHeaders\u001b[39m\u001b[38;5;124m'\u001b[39m])\n\u001b[0;32m---> 44\u001b[0m \u001b[38;5;28;01mreturn\u001b[39;00m \u001b[43mf\u001b[49m\u001b[43m(\u001b[49m\u001b[38;5;28;43mself\u001b[39;49m\u001b[43m,\u001b[49m\u001b[43m \u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43margs\u001b[49m\u001b[43m,\u001b[49m\u001b[43m \u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43mkwargs\u001b[49m\u001b[43m)\u001b[49m\n", - "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/docker/api/client.py:236\u001b[0m, in \u001b[0;36mAPIClient._get\u001b[0;34m(self, url, **kwargs)\u001b[0m\n\u001b[1;32m 234\u001b[0m \u001b[38;5;129m@update_headers\u001b[39m\n\u001b[1;32m 235\u001b[0m \u001b[38;5;28;01mdef\u001b[39;00m \u001b[38;5;21m_get\u001b[39m(\u001b[38;5;28mself\u001b[39m, url, \u001b[38;5;241m*\u001b[39m\u001b[38;5;241m*\u001b[39mkwargs):\n\u001b[0;32m--> 236\u001b[0m \u001b[38;5;28;01mreturn\u001b[39;00m \u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mget\u001b[49m\u001b[43m(\u001b[49m\u001b[43murl\u001b[49m\u001b[43m,\u001b[49m\u001b[43m \u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43m_set_request_timeout\u001b[49m\u001b[43m(\u001b[49m\u001b[43mkwargs\u001b[49m\u001b[43m)\u001b[49m\u001b[43m)\u001b[49m\n", - "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/requests/sessions.py:602\u001b[0m, in \u001b[0;36mSession.get\u001b[0;34m(self, url, **kwargs)\u001b[0m\n\u001b[1;32m 594\u001b[0m \u001b[38;5;250m\u001b[39m\u001b[38;5;124mr\u001b[39m\u001b[38;5;124;03m\"\"\"Sends a GET request. Returns :class:`Response` object.\u001b[39;00m\n\u001b[1;32m 595\u001b[0m \n\u001b[1;32m 596\u001b[0m \u001b[38;5;124;03m:param url: URL for the new :class:`Request` object.\u001b[39;00m\n\u001b[1;32m 597\u001b[0m \u001b[38;5;124;03m:param \\*\\*kwargs: Optional arguments that ``request`` takes.\u001b[39;00m\n\u001b[1;32m 598\u001b[0m \u001b[38;5;124;03m:rtype: requests.Response\u001b[39;00m\n\u001b[1;32m 599\u001b[0m \u001b[38;5;124;03m\"\"\"\u001b[39;00m\n\u001b[1;32m 601\u001b[0m kwargs\u001b[38;5;241m.\u001b[39msetdefault(\u001b[38;5;124m\"\u001b[39m\u001b[38;5;124mallow_redirects\u001b[39m\u001b[38;5;124m\"\u001b[39m, \u001b[38;5;28;01mTrue\u001b[39;00m)\n\u001b[0;32m--> 602\u001b[0m \u001b[38;5;28;01mreturn\u001b[39;00m \u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mrequest\u001b[49m\u001b[43m(\u001b[49m\u001b[38;5;124;43m\"\u001b[39;49m\u001b[38;5;124;43mGET\u001b[39;49m\u001b[38;5;124;43m\"\u001b[39;49m\u001b[43m,\u001b[49m\u001b[43m \u001b[49m\u001b[43murl\u001b[49m\u001b[43m,\u001b[49m\u001b[43m \u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43mkwargs\u001b[49m\u001b[43m)\u001b[49m\n", - "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/requests/sessions.py:589\u001b[0m, in \u001b[0;36mSession.request\u001b[0;34m(self, method, url, params, data, headers, cookies, files, auth, timeout, allow_redirects, proxies, hooks, stream, verify, cert, json)\u001b[0m\n\u001b[1;32m 584\u001b[0m send_kwargs \u001b[38;5;241m=\u001b[39m {\n\u001b[1;32m 585\u001b[0m \u001b[38;5;124m\"\u001b[39m\u001b[38;5;124mtimeout\u001b[39m\u001b[38;5;124m\"\u001b[39m: timeout,\n\u001b[1;32m 586\u001b[0m \u001b[38;5;124m\"\u001b[39m\u001b[38;5;124mallow_redirects\u001b[39m\u001b[38;5;124m\"\u001b[39m: allow_redirects,\n\u001b[1;32m 587\u001b[0m }\n\u001b[1;32m 588\u001b[0m send_kwargs\u001b[38;5;241m.\u001b[39mupdate(settings)\n\u001b[0;32m--> 589\u001b[0m resp \u001b[38;5;241m=\u001b[39m \u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43msend\u001b[49m\u001b[43m(\u001b[49m\u001b[43mprep\u001b[49m\u001b[43m,\u001b[49m\u001b[43m \u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43msend_kwargs\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 591\u001b[0m \u001b[38;5;28;01mreturn\u001b[39;00m resp\n", - "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/requests/sessions.py:703\u001b[0m, in \u001b[0;36mSession.send\u001b[0;34m(self, request, **kwargs)\u001b[0m\n\u001b[1;32m 700\u001b[0m start \u001b[38;5;241m=\u001b[39m preferred_clock()\n\u001b[1;32m 702\u001b[0m \u001b[38;5;66;03m# Send the request\u001b[39;00m\n\u001b[0;32m--> 703\u001b[0m r \u001b[38;5;241m=\u001b[39m \u001b[43madapter\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43msend\u001b[49m\u001b[43m(\u001b[49m\u001b[43mrequest\u001b[49m\u001b[43m,\u001b[49m\u001b[43m \u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43mkwargs\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 705\u001b[0m \u001b[38;5;66;03m# Total elapsed time of the request (approximately)\u001b[39;00m\n\u001b[1;32m 706\u001b[0m elapsed \u001b[38;5;241m=\u001b[39m preferred_clock() \u001b[38;5;241m-\u001b[39m start\n", - "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/requests/adapters.py:486\u001b[0m, in \u001b[0;36mHTTPAdapter.send\u001b[0;34m(self, request, stream, timeout, verify, cert, proxies)\u001b[0m\n\u001b[1;32m 483\u001b[0m timeout \u001b[38;5;241m=\u001b[39m TimeoutSauce(connect\u001b[38;5;241m=\u001b[39mtimeout, read\u001b[38;5;241m=\u001b[39mtimeout)\n\u001b[1;32m 485\u001b[0m \u001b[38;5;28;01mtry\u001b[39;00m:\n\u001b[0;32m--> 486\u001b[0m resp \u001b[38;5;241m=\u001b[39m \u001b[43mconn\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43murlopen\u001b[49m\u001b[43m(\u001b[49m\n\u001b[1;32m 487\u001b[0m \u001b[43m \u001b[49m\u001b[43mmethod\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mrequest\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mmethod\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 488\u001b[0m \u001b[43m \u001b[49m\u001b[43murl\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43murl\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 489\u001b[0m \u001b[43m \u001b[49m\u001b[43mbody\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mrequest\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mbody\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 490\u001b[0m \u001b[43m \u001b[49m\u001b[43mheaders\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mrequest\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mheaders\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 491\u001b[0m \u001b[43m \u001b[49m\u001b[43mredirect\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[38;5;28;43;01mFalse\u001b[39;49;00m\u001b[43m,\u001b[49m\n\u001b[1;32m 492\u001b[0m \u001b[43m \u001b[49m\u001b[43massert_same_host\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[38;5;28;43;01mFalse\u001b[39;49;00m\u001b[43m,\u001b[49m\n\u001b[1;32m 493\u001b[0m \u001b[43m \u001b[49m\u001b[43mpreload_content\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[38;5;28;43;01mFalse\u001b[39;49;00m\u001b[43m,\u001b[49m\n\u001b[1;32m 494\u001b[0m \u001b[43m \u001b[49m\u001b[43mdecode_content\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[38;5;28;43;01mFalse\u001b[39;49;00m\u001b[43m,\u001b[49m\n\u001b[1;32m 495\u001b[0m \u001b[43m \u001b[49m\u001b[43mretries\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mmax_retries\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 496\u001b[0m \u001b[43m \u001b[49m\u001b[43mtimeout\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mtimeout\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 497\u001b[0m \u001b[43m \u001b[49m\u001b[43mchunked\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mchunked\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 498\u001b[0m \u001b[43m \u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 500\u001b[0m \u001b[38;5;28;01mexcept\u001b[39;00m (ProtocolError, \u001b[38;5;167;01mOSError\u001b[39;00m) \u001b[38;5;28;01mas\u001b[39;00m err:\n\u001b[1;32m 501\u001b[0m \u001b[38;5;28;01mraise\u001b[39;00m \u001b[38;5;167;01mConnectionError\u001b[39;00m(err, request\u001b[38;5;241m=\u001b[39mrequest)\n", - "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/urllib3/connectionpool.py:793\u001b[0m, in \u001b[0;36mHTTPConnectionPool.urlopen\u001b[0;34m(self, method, url, body, headers, retries, redirect, assert_same_host, timeout, pool_timeout, release_conn, chunked, body_pos, preload_content, decode_content, **response_kw)\u001b[0m\n\u001b[1;32m 790\u001b[0m response_conn \u001b[38;5;241m=\u001b[39m conn \u001b[38;5;28;01mif\u001b[39;00m \u001b[38;5;129;01mnot\u001b[39;00m release_conn \u001b[38;5;28;01melse\u001b[39;00m \u001b[38;5;28;01mNone\u001b[39;00m\n\u001b[1;32m 792\u001b[0m \u001b[38;5;66;03m# Make the request on the HTTPConnection object\u001b[39;00m\n\u001b[0;32m--> 793\u001b[0m response \u001b[38;5;241m=\u001b[39m \u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43m_make_request\u001b[49m\u001b[43m(\u001b[49m\n\u001b[1;32m 794\u001b[0m \u001b[43m \u001b[49m\u001b[43mconn\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 795\u001b[0m \u001b[43m \u001b[49m\u001b[43mmethod\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 796\u001b[0m \u001b[43m \u001b[49m\u001b[43murl\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 797\u001b[0m \u001b[43m \u001b[49m\u001b[43mtimeout\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mtimeout_obj\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 798\u001b[0m \u001b[43m \u001b[49m\u001b[43mbody\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mbody\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 799\u001b[0m \u001b[43m \u001b[49m\u001b[43mheaders\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mheaders\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 800\u001b[0m \u001b[43m \u001b[49m\u001b[43mchunked\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mchunked\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 801\u001b[0m \u001b[43m \u001b[49m\u001b[43mretries\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mretries\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 802\u001b[0m \u001b[43m \u001b[49m\u001b[43mresponse_conn\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mresponse_conn\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 803\u001b[0m \u001b[43m \u001b[49m\u001b[43mpreload_content\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mpreload_content\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 804\u001b[0m \u001b[43m \u001b[49m\u001b[43mdecode_content\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mdecode_content\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 805\u001b[0m \u001b[43m \u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43mresponse_kw\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 806\u001b[0m \u001b[43m\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 808\u001b[0m \u001b[38;5;66;03m# Everything went great!\u001b[39;00m\n\u001b[1;32m 809\u001b[0m clean_exit \u001b[38;5;241m=\u001b[39m \u001b[38;5;28;01mTrue\u001b[39;00m\n", - "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/urllib3/connectionpool.py:537\u001b[0m, in \u001b[0;36mHTTPConnectionPool._make_request\u001b[0;34m(self, conn, method, url, body, headers, retries, timeout, chunked, response_conn, preload_content, decode_content, enforce_content_length)\u001b[0m\n\u001b[1;32m 535\u001b[0m \u001b[38;5;66;03m# Receive the response from the server\u001b[39;00m\n\u001b[1;32m 536\u001b[0m \u001b[38;5;28;01mtry\u001b[39;00m:\n\u001b[0;32m--> 537\u001b[0m response \u001b[38;5;241m=\u001b[39m \u001b[43mconn\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mgetresponse\u001b[49m\u001b[43m(\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 538\u001b[0m \u001b[38;5;28;01mexcept\u001b[39;00m (BaseSSLError, \u001b[38;5;167;01mOSError\u001b[39;00m) \u001b[38;5;28;01mas\u001b[39;00m e:\n\u001b[1;32m 539\u001b[0m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_raise_timeout(err\u001b[38;5;241m=\u001b[39me, url\u001b[38;5;241m=\u001b[39murl, timeout_value\u001b[38;5;241m=\u001b[39mread_timeout)\n", - "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/urllib3/connection.py:466\u001b[0m, in \u001b[0;36mHTTPConnection.getresponse\u001b[0;34m(self)\u001b[0m\n\u001b[1;32m 463\u001b[0m \u001b[38;5;28;01mfrom\u001b[39;00m \u001b[38;5;21;01m.\u001b[39;00m\u001b[38;5;21;01mresponse\u001b[39;00m \u001b[38;5;28;01mimport\u001b[39;00m HTTPResponse\n\u001b[1;32m 465\u001b[0m \u001b[38;5;66;03m# Get the response from http.client.HTTPConnection\u001b[39;00m\n\u001b[0;32m--> 466\u001b[0m httplib_response \u001b[38;5;241m=\u001b[39m \u001b[38;5;28;43msuper\u001b[39;49m\u001b[43m(\u001b[49m\u001b[43m)\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mgetresponse\u001b[49m\u001b[43m(\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 468\u001b[0m \u001b[38;5;28;01mtry\u001b[39;00m:\n\u001b[1;32m 469\u001b[0m assert_header_parsing(httplib_response\u001b[38;5;241m.\u001b[39mmsg)\n", - "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/http/client.py:1375\u001b[0m, in \u001b[0;36mHTTPConnection.getresponse\u001b[0;34m(self)\u001b[0m\n\u001b[1;32m 1373\u001b[0m \u001b[38;5;28;01mtry\u001b[39;00m:\n\u001b[1;32m 1374\u001b[0m \u001b[38;5;28;01mtry\u001b[39;00m:\n\u001b[0;32m-> 1375\u001b[0m \u001b[43mresponse\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mbegin\u001b[49m\u001b[43m(\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 1376\u001b[0m \u001b[38;5;28;01mexcept\u001b[39;00m \u001b[38;5;167;01mConnectionError\u001b[39;00m:\n\u001b[1;32m 1377\u001b[0m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39mclose()\n", - "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/http/client.py:318\u001b[0m, in \u001b[0;36mHTTPResponse.begin\u001b[0;34m(self)\u001b[0m\n\u001b[1;32m 316\u001b[0m \u001b[38;5;66;03m# read until we get a non-100 response\u001b[39;00m\n\u001b[1;32m 317\u001b[0m \u001b[38;5;28;01mwhile\u001b[39;00m \u001b[38;5;28;01mTrue\u001b[39;00m:\n\u001b[0;32m--> 318\u001b[0m version, status, reason \u001b[38;5;241m=\u001b[39m \u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43m_read_status\u001b[49m\u001b[43m(\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 319\u001b[0m \u001b[38;5;28;01mif\u001b[39;00m status \u001b[38;5;241m!=\u001b[39m CONTINUE:\n\u001b[1;32m 320\u001b[0m \u001b[38;5;28;01mbreak\u001b[39;00m\n", - "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/http/client.py:279\u001b[0m, in \u001b[0;36mHTTPResponse._read_status\u001b[0;34m(self)\u001b[0m\n\u001b[1;32m 278\u001b[0m \u001b[38;5;28;01mdef\u001b[39;00m \u001b[38;5;21m_read_status\u001b[39m(\u001b[38;5;28mself\u001b[39m):\n\u001b[0;32m--> 279\u001b[0m line \u001b[38;5;241m=\u001b[39m \u001b[38;5;28mstr\u001b[39m(\u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mfp\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mreadline\u001b[49m\u001b[43m(\u001b[49m\u001b[43m_MAXLINE\u001b[49m\u001b[43m \u001b[49m\u001b[38;5;241;43m+\u001b[39;49m\u001b[43m \u001b[49m\u001b[38;5;241;43m1\u001b[39;49m\u001b[43m)\u001b[49m, \u001b[38;5;124m\"\u001b[39m\u001b[38;5;124miso-8859-1\u001b[39m\u001b[38;5;124m\"\u001b[39m)\n\u001b[1;32m 280\u001b[0m \u001b[38;5;28;01mif\u001b[39;00m \u001b[38;5;28mlen\u001b[39m(line) \u001b[38;5;241m>\u001b[39m _MAXLINE:\n\u001b[1;32m 281\u001b[0m \u001b[38;5;28;01mraise\u001b[39;00m LineTooLong(\u001b[38;5;124m\"\u001b[39m\u001b[38;5;124mstatus line\u001b[39m\u001b[38;5;124m\"\u001b[39m)\n", - "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/socket.py:705\u001b[0m, in \u001b[0;36mSocketIO.readinto\u001b[0;34m(self, b)\u001b[0m\n\u001b[1;32m 703\u001b[0m \u001b[38;5;28;01mwhile\u001b[39;00m \u001b[38;5;28;01mTrue\u001b[39;00m:\n\u001b[1;32m 704\u001b[0m \u001b[38;5;28;01mtry\u001b[39;00m:\n\u001b[0;32m--> 705\u001b[0m \u001b[38;5;28;01mreturn\u001b[39;00m \u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43m_sock\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mrecv_into\u001b[49m\u001b[43m(\u001b[49m\u001b[43mb\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 706\u001b[0m \u001b[38;5;28;01mexcept\u001b[39;00m timeout:\n\u001b[1;32m 707\u001b[0m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_timeout_occurred \u001b[38;5;241m=\u001b[39m \u001b[38;5;28;01mTrue\u001b[39;00m\n", - "\u001b[0;31mKeyboardInterrupt\u001b[0m: " - ] - } - ], - "source": [ - "# Run local blastp search\n", - "blast_results = ald1.blastp(\n", - " db_path=\"/Users/max/Documents/GitHub/blast-db/data/source\",\n", - " n_hits=100,\n", - ")" - ] - }, - { - "cell_type": "code", - "execution_count": null, - "metadata": {}, - "outputs": [ - { - "ename": "NameError", - "evalue": "name 'blast_results' is not defined", - "output_type": "error", - "traceback": [ - "\u001b[0;31m---------------------------------------------------------------------------\u001b[0m", - "\u001b[0;31mNameError\u001b[0m Traceback (most recent call last)", - "Cell \u001b[0;32mIn[1], line 1\u001b[0m\n\u001b[0;32m----> 1\u001b[0m \u001b[43mblast_results\u001b[49m[\u001b[38;5;241m0\u001b[39m]\u001b[38;5;241m.\u001b[39msource_id\n", - "\u001b[0;31mNameError\u001b[0m: name 'blast_results' is not defined" - ] - } - ], - "source": [ - "blast_results[0].source_id" - ] - }, - { - "cell_type": "markdown", - "metadata": {}, - "source": [ - "## MSA with Clustal Omega" - ] - }, - { - "cell_type": "markdown", - "metadata": {}, - "source": [] - }, - { - "cell_type": "code", - "execution_count": null, - "metadata": {}, - "outputs": [ - { - "name": "stdout", - "output_type": "stream", - "text": [ - "πŸƒ Running CLUSTALO\n" - ] - } - ], - "source": [ - "alignment = Alignment.from_sequences(blast_results)\n", - "alignment.align(ClustalOmega)" - ] - }, - { - "cell_type": "code", - "execution_count": null, - "metadata": {}, - "outputs": [], - "source": [ - "alignment.apply_standard_numbering()" - ] - }, - { - "cell_type": "code", - "execution_count": null, - "metadata": {}, - "outputs": [ - { - "data": { - "text/plain": [ - "Alignment(id='alignment0', method='CLUSTALO', consensus='MEQXQQAXXXXXXXXPXXXXAXXXXXXXPQPXSAPQMXXMXXXXXXXXXXXXXMXHSARPPXRXXXXXXXXXXXXXXXXXAPXLPPPXXXXXXXXXXXXXXPXXXXXEXXXXXXXXHXHXXXXXXXXXXXRXXXXXXXXXXXXXDXXPXSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXSXXXNXXXSXXPQXXXXXXXXXXXXXXXXXXXXXXNXVXIKVGXVGDAQXGKTSLMVKYVEXXXDEXYXQTLGVNFXEKXISIRXTXITFSIXDLGGQREFXNMLPLVXXDAVAIXFMFDLTRXXTLNSIKEWYRQXRGFNXTAIPXLVGTKYDXFXXXXXEXQEEISXQAXXXAXAMXAXLIFXSTXXSINVQKIFKIVLXKXFDLXXTIPEIXXXGXPLLXYXXXGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYXXXXXSXXPXPXXXXXXXXIKNLHXCLRHXQLRCLRVV', input_sequences=[Sequence(id='sequence0', source_id='BAH60832.1', sequence='MSASEMRAASERVGEERNSLPSVRNQVDIQVGLIGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVSIRSTDIVFSLMDLGGQREFINMLPIATLGSSVIILLFDLTRPETLNSIKEWYRQALGLNDSAIPILVGTKYNLFIDLEEEYQEKVSKTSMKYAQVMDAPLIFCSTAKSINIQKIFKVALAKIFDLTLTIPEINEIGDPLLIYKELGSKKNKSKNSSKPRRRSPVDNENKELVSQPHNYGHTSE'), Sequence(id='sequence1', source_id='CAI4663910.1', sequence='MATPSTGANNSIPAVRNQVEVQVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQADGLNDSAIPILVGTKYDLLIDLDPEYQEQISRTSMKYAQVMNAPLIFCSTAKSINIQKIFKIALAKIFNLTLTIPEINEIGDPLLIYKHLGGQQHRHHNKSQDRKSHNIRKPSSSPSSKAPSPGVNT'), Sequence(id='sequence2', source_id='EJT44931.1', sequence='MTTPITGGSTSIPAVRNQVEVQVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQAYGLNDSAIPILVGTKYDLLIDLDPEYQEQISGTSMKYAQVMNAPLIFCSTAKSINIQKIFKIALAKIFNLTLTIPEINEIGDPLLIYKHLGSQQRRRQSKSQDRKNHTVKKPSSSPSSKPPSPGVNI'), Sequence(id='sequence3', source_id='XP_037139093.1', sequence='MSSGGTDVQAQQELPKVKSRVDVQVGLVGDAQVGKTSLIVKYVQNVFDEEYTQTLGVNFLKRKVSIRSTDIVFSIMDLGGQREFINMLPIASLGSSAIVFLFDLTRPETLSSIKEWYRQAHGLNETAVPLLVGTKYDLFVDLDPEYQEQLSRTSMEYAQVMDAPLVFCSTAKSVNVQKIFKIALAKIFNLTLTIPEINEIGDPLLIYKSLGNHRARGEEISRRPSPSARTSFS'), Sequence(id='sequence4', source_id='XP_003680887.1', sequence='MSEAQEQQELPKAKNRVDVQVGLVGDAQVGKTSLMVKYVQNVFDEEYTQTLGVNFLKRKVSIRSTDIVFSLMDLGGQREFINMLPIASLGSSAIVFLFDLTRPETLSSIKEWYRQAHGLNETAVPLLVGTKYDLFVDLDPEYQEQLSRTSMEYAQVMDAPLIFCSTAKSINVQKIFKIALAKIFKLTLTVQEINDVGDPLLIYRHLGNQRHDSDEVSRRSSPSTRSSTS'), Sequence(id='sequence5', source_id='XP_037144827.1', sequence='MSQEYRTRSRSRSFSDQAATQEEERPFVNLNMNVNMRPKNQVEVQIGLVGDAQVGKTSLMVKYVQNVFDEEYTQTLGVNFLKRKVSVRSTDIVFSLMDLGGQREFINMLPIASLGSSAIIFLFDLTRAETLSSIKEWFRQAHGLNDTAIPILVGTKYDLFVDLDPDYQEQMSRTSMEYAQVMDAPLIFCSTAKSINVQKIFKVALAKIFSLTLTIQEINEVGDPLLIYKTLGTAKRDQDKTDNIKNSNTNVTTESRRKSPTYTQ'), Sequence(id='sequence6', source_id='AQZ18344.1', sequence='MEGSQETQGQQTMNVKVKNQVEVQIGLVGDAQVGKTSLMVKYVQNVFDEEYTQTLGVNFLKRKVSIRSTDIVFSIMDLGGQREFINMLPIASLGSSAMVFLFDLTRPDTLTSVKEWYRQAHGLNETAVPLLVGTKYDLFVDLDPAYQEQLSRTSMEYAQVMDAPLVFCSTAKSINVQKIFKIALAKIFHLTLTLPEINEIGDPLLIYSTLGNKRSRRAARG'), Sequence(id='sequence7', source_id='XP_002495560.1', sequence='MDNSDQEVQGHQHQQQQQPTNVKVKNQVEVQIGLVGDAQVGKTSLMVKYVQNVFDEEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINMLPIASLGSSALVFLFDLTRPETLTSIKEWYRQAHGLNEGAIPVLVGTKYDLFVDLDPVYQEQLSRASMEYAQVMDAPLIFCSTAKSINVQKIFKVALAKIFSLTLTVPEINEIGDPLLIYSAFGNKRSRGAAR'), Sequence(id='sequence8', source_id='XP_003673548.1', sequence='MPNSSPADHEPIPDVRNQVDLQIGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVKLHSTDIVFSLMDLGGQKEFINMLPIAAVGSSVIVFLFDLTRPETLNSIKDWYRQVKGLNDIAIPILVGTKYDLLINLSAEYQEQISTAAIDYANVMDAPLIFCSTAESINVQKIFKIALAKIFNLTLVVPEIRDIGDPLLLYKELGNNIQKVKQSKSPQRLS'), Sequence(id='sequence9', source_id='XP_003958955.1', sequence='MVASEEHEKHQQIPFVRNQVDIQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVNLRSTDIVFSLMDLGGQREFINMLPLAAVGSAAIIFLFDLTRPETLESVKEWYRQAYGLNNQAIPILVGTKYDLFIDLDEEYQRQVSKTALDYSEVMDAPLVFCSTAKSINIQKIFKIALAKIFSLTLTISEIKDTGDPILLYKRFGSKLSKNKSSPSSSTKLKTPRA'), Sequence(id='sequence10', source_id='XP_001644471.1', sequence='MQSSSIPKTRNQIEVQIGLVGDAQVGKTSLMVKYVQNIFNDEYTQTLGVNFLKRKVSVRSTDIVFSILDLGGQKEFINMLPIASIGSSAIIFLFDLTRPETLNSIKEWYRQANGLNDQAIPILVGTKYDLFIDLDQSTQEKISRIAMQYAQVMNAPLIFTSTAKSINVQKIFKIALSKIFNLTLTISEINEIGDPLLIYKTLGNRSTPIANASASSSASSPSAST'), Sequence(id='sequence11', source_id='XP_003684279.1', sequence='MPYRENRNASSAGGMMRSVPKSRNQVEIQVGLIGDAQVGKTSLMVKYVQNIFNEEYTQTLGVNFLKRTVSVRSTDIVFSLLDLGGQKEFINMLPIATVGSAAIVFLFDLTRPETLNSIKNWYRQANGLNEMAIPILVGTKYDLFINLDKEHQDSISRLSMEIAQVMDSPLVFCSTSKSINVQKIFKIALSKIFNLTLTIPEINEIGDPLLIYKTLGNNFNNNRSHNSSPIRTNNNNNSNNDTNSNNDGNSNTVNNNNYSALDNSNYPNPTASEHLNRIKNLHQCLRHAQLRCLRVV'), Sequence(id='sequence12', source_id='SMN18735.1', sequence='MPGSEPKRNLVPDVKNQVEIQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKINLRSTDIVFSLMDLGGQREFINMLPLASVGSSAIIFLFDLTRPETLDSVKEWYRQVYGLNNLAIPILVGTKYDLFIDMDKEYQKQISHTVLEYAQVMNAPIVFSSTAKSINIQKIFKIALSKIFNLTLTIPEITRTGDPLLIYRKFGNQNRNPTNVSASPVFSSQSSSISPPKSKGTTAS'), Sequence(id='sequence13', source_id='CAD1779387.1', sequence='MPGSESKRNIVPDVKNQVEIQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKINLRSTDIVFSLMDLGGQREFINMLPLASVGSSAIIFLFDLTRPETLDSVKEWYRQVYGLNNLAIPILVGTKYDLFIDMDKEYQKQISNTVLEYAQVMNAPIVFSSTAKSINIQKIFKIALSKIFNLTLTIPEITRTGDPLLIYRKFGNQNCKPTKVMTSPAFSSQTSSTSTSQVKAKETTAT'), Sequence(id='sequence14', source_id='KAG0666170.1', sequence='MPHSSSRRHQVPDVKNQVEIQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKINLRSTDIVFSLMDLGGQREFINMLPLASVGSSAIIFLFDLTRPETLDSVKEWYRQVYGLNNLAIPILVGTKYDLFIDMDKEYQKQISNTVLEYANVMNAPIIFSSTAKSINIQKIFKVALSKIFNLTLTIPEITRTGDPLLIYKKFGNQDRKSSKITTSSSQSSSSPASVSVSPRKSKSTITSS'), Sequence(id='sequence15', source_id='XP_022464898.1', sequence='MANVRSRHSSIPGIKNQIDVQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVNLRSTDIIFSIMDLGGQKEFINMLPLAAVGSSVIIFMFDLTRPKTLQSIKDWFRQAHGLNDSAVPILVGTKYDLSIETDERVPGNISCTAMRYAQVMNAPIVFCSTAKSIHIQKIFKIALAKIFNLTLTVPEIESIGDPLLIYRDFGNNVKRQSKSSPKRTGSMERTPVSSQQ'), Sequence(id='sequence16', source_id='XP_003669861.1', sequence='MSNSSSPEHEPIPAVRNQVDLQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNYLKRKVRLHSTDIIYSLMDLGGQREFINMLPIAAVGSSAIIFLFDLTRPETLNSIKDWYRQVNGLNDVAIPILVGTKYDLFIGLDSNYQNHISNSAIEYSKIMNSPLVFCSTAEGINIQKIFKIALAKIFNLTLVIPEITTVGDPLLIYKNLGNATNK'), Sequence(id='sequence17', source_id='XP_003678517.1', sequence='MASEHRARTSKDSEANLAQPEEIQIQVGLVGDAQVGKTSLMVKYAQNGFDEEYTQTLGVNLLKRKVRIKSSNIVFSLMDLGGQKEFINMLPIASVNSSVIIFLFDLTRPESLESIKNWYMQAHGLNHDAVCILVGTKYDLFIDLPTEYQEQISRTSMKYAQAMDSPLIFSSSIASINIQKIFKIALAKVFDLTLIIPEITQIGDPLLIYKHLGSFAGRKRNNK'), Sequence(id='sequence18', source_id='KAG0659075.1', sequence='MQQNTPTSINRHDPIPGVKNQIDIQIGLVGDAQVGKTSLMVKYVQNIFDNEYTQTLGVNFLKRKVKLRQTEIIFSLMDLGGQSEFINMLPLAAVGSSVIIFLFDLTRPVTLKSIKGWFRQAKGLNDLAIPILVGTKFDLFYTMDSQYQNEISKVAMEYSQVMDAPLIFCSTAKSIHIQKIFKIALAKLFNLTLTINEINLPGDPLLIYKDKGNNCINQSTNNNNNNTNLRRKSSHGHTSNNNNNNNTPIQASPIAVRSSYNHRHH'), Sequence(id='sequence19', source_id='XP_451758.1', sequence='MSLDKDRVPSLRHQVKVKVGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKVVLGSTDVIFSIMDLGGQREFINMLPLVSEGAVAIVFLFDLTRPETLNSIKEWYRQARGFNDTAISILVGTKYDLFVDMDPEYQENVSRTAMKYAQVMKSPLIFCSTQSSINVQKIFKVVIAKAFNLTLKVPEYKQIGEPLLIYKSFGPSRPSSPKRQVHTPPPSS'), Sequence(id='sequence20', source_id='NP_984991.1', sequence='MASENTIPQLKNEVKIKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKINLGSTDVIFSIMDLGGQREFINMLPLVSNRAVAIIFLFDLTRPETLTSIREWYRQARGFNETAIPLLVGTKYDLFVNLDVAYQEELSKTSMRYAQVMGAPLVFCSTASSINVQKIFKVIIAKAFNLTLRIPEIKDMGDPLLIYKSLGNAPQRVPSEYTHHGRYRQPEHIRNMAEQ'), Sequence(id='sequence21', source_id='XP_017989070.1', sequence='MVGESGIPQPKNEVKIKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKINLGSTDVIFSIMDLGGQREFINMLPLVSNRAVAIIFLFDLTRPETLTSIREWFRQARGFNDTAIPLLVGTKYDLFINLDASYQEEISKTSMRYAQAMGAPLVFCSTASSINVQKIFKVIIAKAFRLTLRIPEIRDIGDPLLIYKSLGNSVPKRDAAGTVMAASSGYSPTSATVEQGQYRQSERAQHTASEQ'), Sequence(id='sequence22', source_id='KAG0673910.1', sequence='MSTDKVPSLRHQVRVKVGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKVVLGSTDVIFSIMDLGGQREFINMLPLVSEGAVAIVFLFDLTRPETLNSIKEWYRQARGFNETAISILVGTKYDLFVEMDSKYQEEVSRTAMKYAQVMKSPLIFSSTQSSINVQKIFKVVIAKAFNITLKVPEYKQIGEPLLIYKSLGPTRPPSPNKRQVHTPPPSS'), Sequence(id='sequence23', source_id='SMN21971.1', sequence='MNSEKNKVSPREEIQLQIGIIGDAQVGKTSLMVKYVQDIYNKEYTQTLGVNFLKKRIRLRSTDITLSLMDLGGQREFINMLPLAAMDSYCIILLFDLTRPETLKSVKEWYRQAFGLNKNAIPILVGTKYDLFIEMDQDYQEEISRTCLKYAQIMDSPVIFSSSAYSINIQKLFKIIISKIFNLTLTLAEISDIGDPLLIYKEFGNTHLNGL'), Sequence(id='sequence24', source_id='KAG0661436.1', sequence='MNSTKLKSSKRPAKREEIQLQIGIIGDAQVGKTSLMVKYVQDIYNKEYTQTLGVNFLKKTIRLRSTDIVLSLMDLGGQKEFINMLPLAAMDSYCIILLFDLTRPETLKSVKEWYRQAFGLNKNAISVLVGTKYDIFIDMDEDYQEEISRTCIKYAQIMDSPVIFSSSAYSINIQKLFKIIVSKIFNLKLTIPEIRDIGDPLLIYEEFGNGHLNN'), Sequence(id='sequence25', source_id='SCV02624.1', sequence='MSTNEANVPTLPQPKNTFTIKVGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLDKKIKLGSADIVFYIMDLGGQREFINMLPLASEGARAIIFLFDLTRPETLKSIKEWHRQATGFNEMAVPLLVGTKYDLFVNFDPEYQVQVSKQSMRYAQAMDAPLIFCSTSHSINIQKIFKVIIAKLYNLTMRASEIKQIGDPLLIYKHLGSKRRFSENPSSRNSSSRTPSPHRSP'), Sequence(id='sequence26', source_id='SCV99388.1', sequence='MSLATSDTPVLPHPTNTFTIKVGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLDKKIRLGSADILFYIMDLGGQREFINMLPLASEGAKAIIFLFDLTRPETLKSIKEWHRQATGFNENAVPLLVGTKYDLFVNMDPEYQVQVSKQSMRYAQVMDAPLIFCSTSHSINVQRIFKIIIAKIYNLTMRASEIKQIGDPLLIYKYLGNSRRRSPSS'), Sequence(id='sequence27', source_id='CUS20182.1', sequence='MSMVSGGDTPLLPHPKNTFTLKIGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLSKKITLGSADILFYIMDLGGQREFINMLPLASEGAKAIIFLFDLTRPETLKSIKEWHRQATGFNEQAVPLLVGTKYDLFVNLDPDYQAQISKQSMRYAQAMDAPLIFCSTSHSINVQKIFKIVIAKLYNLTMRASEIKQIGDPLLIYKYLGSSRRPASGSSTSSGTS'), Sequence(id='sequence28', source_id='XP_045933944.1', sequence='MHFQQQQQQHYHTPLRHGSDPAQHITNNSEEHINNYGNNTVDTPQQLRHTSAMTVINSSQAATNNNYSDNNNNTSPVRGTTSTAETIPDELIPRTTFRLKVGLIGDAQVGKTSLMVKYVQSVFDEEYIQTLGVHHLEKRESLKYADILFVINDLGGQREFINMLPIVSEDAVAIVYLFDLTRPETLTSIKEWYRQAKGLNSKAIPLLIGTKYDLFIDMDPSYQEKMSRIGMLYAEAMNAPLIFSSTAESINVKIIFKIVVAKAFNLKLTVPEIKDLGDPILIYKNLGEKKKKN'), Sequence(id='sequence29', source_id='KAA8901327.1', sequence='MSTPSSPSGGGSKATAAEAARNSVSLKVGMIGDAQIGKTSLMVKYVEGTFDEDYIQTLGVNFMEKVVSIRNTDITFSIWDLGGQREFVNMLPLVSNDAVAILFMFDLTRKSTLNSVKEWYRQARGFNKTAIPFLVGTKFDMFVNLAEEDQEEITKQAKRFAKAMKASLIFCSTSHSINVQKIFKIVLSKAFDLKLTLPEITMTGEPLLIYQQW'), Sequence(id='sequence30', source_id='KAF8417303.1', sequence='MSDSSTIASGSGAGGSYHHQQASTSSAGSALQETPGRRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSVKEWYRQARGFNKTAIPFLVGTKFDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINIQKIFKIVLSKSFDLKCTIPEIEQVGEPLLLYQEV'), Sequence(id='sequence31', source_id='KAF3929277.1', sequence='MTTTPPTKRETSPVSPLRASFANLNTEDHSQATAAIRAQAGHTRHESLEKYTRRDSTASENRNEEGYRERGSISSQSGAAGAKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGLNKTAIPFLIGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGDPLLIYQDVELGNR'), Sequence(id='sequence32', source_id='OEJ86227.1', sequence='MTEYENGQQQQRERIRGQERESYDEQERESYDEQERERIREQERRINNEQQRRVNNEQQRRXNNQQRSTTNDNVSSNKNTHKDLDLQDNLIPRTTFKLKVGLVGDAQVGKTSLMVKYVQSVFDDEYIQTLGVHHLEKTEFLKYADILFVINDLGGQREFINMLPIVSEDAVAIVYMFDLTRPETLTSIKEWYRQAKGLNNKAISLLVGTKYDLFIEMDSEYQEKISKIATLYSZAMNAPLIFSSTSESINVKVIFKIIVAKSFNLKLTIKEIXEIGDPLLLYKNLGNKHRISH'), Sequence(id='sequence33', source_id='XP_046060918.1', sequence='MDKNTVTLKVGLVGDAQVGKTSLMVKYVENCFDEVYTQTLGVNYMERSINIKSTEITFSIWDLGGEAEFTNMLPLVASDAVAVLFMFDLSRKSTLSSIKDWYRQTRGFNRTAIPFLVGTKYDLFVDLSDAEQEEITRHAQKFARAMNAPLIFCSTSASINIQKIFKIVISKAFDLRLRIPEIENVGEPILIYHEHDRERERTSRRPTASHS'), Sequence(id='sequence34', source_id='EPS36031.1', sequence='MTTTPPTKRDASPVSPLRASFANLNTDDHTSATAAIRAAAGHTRHESLEKYTRRDSTASENRPEEGYRERGSISSQGGSAGAKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGLNKTAIPFLIGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGDPLLIYQDVELGNR'), Sequence(id='sequence35', source_id='KAI5807151.1', sequence='MHELPLAPSLPPPQSPPTPDRYSQGAARHYHSNSAASAPAMIGDAAGAYYRGSPPPPMPQQPYVPRDRSSESYHNGSSAQQQQQQYAMEQKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFTREEQEEVSKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQDV'), Sequence(id='sequence36', source_id='XP_011117899.1', sequence='MTTTPPTKRESSPVSPLRASFANLNADDHSSATAAIRAAAGHTRHESLEKYTRRDSTASENRNDESYRDRSSVSSQGGSGAKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGLNKTAIPFLIGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGDPLLIYQDVEAGNR'), Sequence(id='sequence37', source_id='KAI1438264.1', sequence='MEQDLHTTPGADLEPHGLPDDGSISSIEDTPEAASSLNGHETYHQHPQSLDYVVSSSQNTDETDPNAQYETVPATSQAQSISRPPSGLSGAGGDRQAAHSDRGSNGADHPSARNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSRDEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC'), Sequence(id='sequence38', source_id='XP_022456167.1', sequence='MSSQNSVSLKVGLVGDAQIGKTSLMVKYVEGCFNEDYTQTLGVNFMERSILIKNTQITFSIWDLGGEREFLNMLPLVSSDAVAILFMFDLTRKSTLNSIKEWYRQTRGFNKTAIPFLVGTKYDLFIDMPMEDQEEVTTQARKFAKAMNASLIFCSTSASINIQKIFKIVISKAFDLRLTIPEVTHIGEPILLYQGV'), Sequence(id='sequence39', source_id='KAF3908940.1', sequence='MTTTPPTKRDVSPVSPLRASFANLNTTDDGQSATAAIRASAGHTRHESLEKYTRRDSTASESRNEDGYRERSSISSQGGSGGNKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLVGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENTGDPLLIYQDVELGNR'), Sequence(id='sequence40', source_id='XP_006693239.1', sequence='MERDQLAAPAPSESAASDYRDHSLADAEVAPSSDCENNGFHDHHYSQSQHYDQDDAAESEPTARYNTPSGSGQQISRPPSGLSGERGAGYATDQGSRAGSNSASQEQQQQQSQQPPARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNLSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEITNVGEPLLIYKDV'), Sequence(id='sequence41', source_id='EWC45326.1', sequence='MATTPPTKRDTSPVSPLRASFANLNTTDDGQQSAAAAIRAAAGHTRHESLEKYTRRDSTASESRNDDGYRERSSISSQGGGAGGNKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLVGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGDPLLIYQDVETGNR'), Sequence(id='sequence42', source_id='KAF3930522.1', sequence='MTTTPPTKQGSRNVSPVSPLRASFANLNTTDENHSSATAAIRAAAGHTRHESLEKYTRRDSNASESKNEDGYRERSSVSSQGGSSQKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLIGTKYDHFVNLSKEDQEEISRQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENIGDPLLIYQDVESGNR'), Sequence(id='sequence43', source_id='KAF8249497.1', sequence='MQQHDDDALPQPQTTELPLAPSLPPPVALAHSPPTPRRRNSSPTRHYHSSSNASGAPPYIGSPGSVESAQYYNSQGSPPTPAAPHQQQQFATSRADGGYHNGGGYAQQQLEAKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQDV'), Sequence(id='sequence44', source_id='XP_002174495.1', sequence='MAEQTKNSVTIKLGMVGDSSIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAVPILIGTKYDYFVGLSREDQEEITKQARRYAKVMKASLVFCSTSHSINVQKIFKIVLAKVFDLKCTIPEITAVGEPILEYQSV'), Sequence(id='sequence45', source_id='PRP83484.1', sequence='MGDQNDTEARIGHSRLPFFIMSGDGEYTGSGKAGEGKKNSVVVKVGMVGDSQIGKTSLMVKYVEGTFDEDYIQTLGVNFMEKTISIKGTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLIGTKYDFFANLPAEEQEEITKQARKFAKAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLSCTIPEIIKVGEPILEYQNLS'), Sequence(id='sequence46', source_id='GAA97202.1', sequence='MASSTSTGAGSSSSRQRQESYRSSHSQQSSSQHAPAPAPQDDDRNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKSISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFSTLAESEQEDVTRQAKRFAKAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTLPEITETGEPLLLYQDI'), Sequence(id='sequence47', source_id='OBA26219.1', sequence='MESMLQSHNRRRHTNSMSISGSSNNNVHSELRQNNNNRISSMPSSQPASNSNNKPVDNIKLTEKDMNKYIDKDLVPKTTFKLKVGIIGDAQVGKTTLMCKYVNSAFDDEYIQTLGIHHLQKKETLKYSNILFTINDLGGQREFINMLPIVSEGAVAIIYLFDLTQPESLNSIKEWYRQAKGLNEKAISILVGTKYDLFLDLDPEYQTNISQIATLYSEAMNAPLIFASTAASINVKIIFKVIVAKAFGLDLAVPEITQIGDPLLIYKKLGNVIKQIKR'), Sequence(id='sequence48', source_id='KAI1823332.1', sequence='MEQDFHAVPAPDSEPHDHPDDGLGGLEESPDIAPGSNGHELYHQHPQSLDYVISNNQNIDDVDPNAPYEAVATTSQPQSISRPPSGLSGAGGDRQTAHSDRGSNGAEHPSARNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC'), Sequence(id='sequence49', source_id='CDO57487.1', sequence='MSIPSIYPNHKPTGMYTGQFISTLHPCANYPFFSRVSLKVGMIGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKAISIRNTEITFSIWDLGGQREFVNMLPLVSNDAVAILFMFDLTRKSTLNSVKEWYRQARGFNKTAIPFLVGTKFDLFANLPEEDQEEISTQSKRFAKAMKASLIFCSTSHSINVQKIFKIVLSKAFDLRLTLPEITNTGEPLMIYQQW'), Sequence(id='sequence50', source_id='KAI2629167.1', sequence='MDQDPMATPIPHDVHDDTLGGIEGSMHLPNEPHNHETHHRQSQSLDQGLANNAHPDEVDPNAQYEAHQYDQPSQSVPRPASSMSSTGGERQYSDQAARESNGADRNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence51', source_id='KAI5811198.1', sequence='MSNDPLPTIPSATSSTVDLSNGNDGSAQNENEPPHRSQHHTGMTSIHLNDPTSQSNAAASYSQTHSGATMLSSGSGATGSFQQAGGPSSGGPAGAQTQGQQALGGDYSRRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPKEDQEEISKQARKFARAMKASLIFSSTSHSINIQKIFKIVLSKSFDLKCTIPEIEQVGEPLLLYQDV'), Sequence(id='sequence52', source_id='KAG9017701.1', sequence='MSTAASGSGAPPATPLSAASADLGGDERNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISVRRTTITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSVKEWYRQARGFNKTAIPFLIGTKYDTFATFSRDEQEEITKQAKRFAKAMHAPLIFCSTSSSINVQKIFKIVLAKAFDLKCVIPEVHNVGEPLLIYMDQ'), Sequence(id='sequence53', source_id='OTA67948.1', sequence='MHFPGHLPDEPSSSSHEPHHRQSQSLDQGLANSAHPHPHPDDIDPNAQYEAQQYDPPQQSTQRPPSSMSSTGERQYTEQASRESNGADRNARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence54', source_id='KAH6626466.1', sequence='MEQEQQAMAPPLPITPTTGIASDAPLVPAAAAAQVPLPHSLSPPLQIDPHDDTLSSAGTVSHQALPDHNNFHEHNGYHDQPQHPIQFQPLDHSVNNSPRSYYPADQTDSEPTARYATPPVAAPAISRPSSGLSGQGAGYGADHVSRAGSNGAAAESSQAPGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNLSREEQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEITNVGEPLLIYQSC'), Sequence(id='sequence55', source_id='ORX96310.1', sequence='MEAEAQKKNSVVVKVGLVGDAQIGKTSLMVKYVEGAFDEDYIQTLGVNFMEKTIHIRNTEITFSLWDLGGQREFINMLPLVCNDAVAILFLFDLSRKSTLNSIKEWYRQARGFNKTAIPILVGTKYDQFAECPPEEQEEVTRQARKFSKAMRAPLIFCSTSHSINVQKIFKIVLSKAFDLRCTIPEISDVGAPILEYHID'), Sequence(id='sequence56', source_id='XP_028477951.1', sequence='MTDPGYASSGSGSGRVSGGEGGDRNAIVLKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKAITIRNTEITFSIWDLGGQREFVSMLPLVSNDAVAILFMFDLTRKATLNSVKEWYRQARGFNKTAIPVLIGTKYDKFAALSREEQEEITKQAKRFSKAMHAPLIFCSTSHSINVQKIFKIVLAKAFDLKCVIPEIDQVGEPILLYNDL'), Sequence(id='sequence57', source_id='XP_024666830.1', sequence='MSRDRVPVDLNDQQQQVTVKVGLIGDAQIGKTSLMVKYVNNTFDDDYIQTLGVNFLEKSVNIRNTQITFSIWDLGGQREFINMLPLVCNDAAALVFMFDLTRKSTLNSVRNWYRQARGFNRTAVPLLVGTKFDMFYEMSDQEQLEITEQAKKYAQAMKAPLVFCSTAMGINVQKLFKIVLAKTFDLKLTIPELAATGEPILIYQQW'), Sequence(id='sequence58', source_id='KAI0099584.1', sequence='MHIPGHLPGESSSSHEPHHRQSQSLDQGLANSAPPLPDDIDPNAQYEAHQYDPPQQPVQRPASSMSSTGERQYNEQASRESNGADRNARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence59', source_id='KAI1801530.1', sequence='MHIAGEPGVHEPHHRQSRSLDQGLANSAHADDIDTHAVDPHAIDPIAVDHNAQYEAHSYEPPAQSMSRPASSSGTGERHLNGEASREGNGADRNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence60', source_id='KAF9351078.1', sequence='MSDTPESTKKGSGNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKTTLNSIKEWYRQARGFNKTAIPFLVGTKYDYFAMFSKEEQEEVTKQARKFARAMKAPLIFCSTAQSINVQKIFKIVLSKAFDLKCTIPEISESGAPILEYQSY'), Sequence(id='sequence61', source_id='KAF9160900.1', sequence='MAATSESAKKSSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDYFSTFSKEEQEEVTKQARKFARAMKAPLIFCSTAHSINVQKIFKIVLSKAFDLKCTIPEISESGAPILEYATYCDRDRKKLTI'), Sequence(id='sequence62', source_id='KAG0263740.1', sequence='MAAAGDSGKKSSSPNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDYFSTFSKEEQEEVTKQARKFARAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTIPEISEAGAPILEYTDK'), Sequence(id='sequence63', source_id='KAI1135662.1', sequence='MEQDPVAAPVPHDIHEDTIGGIEGSMHIPAEPSTSHEPHRHRQSQSLDRGLASSKHPEDIDPNAQYDTPQYDPPQQSMPRPASSSSAGERHYAEQASRESNGADRNARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence64', source_id='XP_045969802.1', sequence='MTTTPPPLENNGSLPSHIDIDVAATPRQEHYTSSSDPSLAFSPQDSNSPSRANIGDDQRHSGTPPLSQSQLYGNGGGMNSFTSAAGAAAGGGQGAEAKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIEHVGEPLLLYQDVM'), Sequence(id='sequence65', source_id='KAI1414505.1', sequence='MHFSGEPSSSHEPLHRQSQSLDQGLANSAHPHPDDIDPNAQYEAHQYDPPQQSMQRPTSSMSSGGERHYTEQAPRESNGTDRNARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence66', source_id='KAG0239750.1', sequence='MATLGDSGKKSSNSSHNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKATLNSIKEWYRQARGFNKTAIPFLVGTKYDYFTMFSKEEQEEVTKQARKFARAMKAPLIFCSTAQSINVQKIFKIVLSKAFDLKCTIPEINEAGAPILEYQSY'), Sequence(id='sequence67', source_id='XP_044688071.1', sequence='MTTTPPPPENNGSLPSHIDVDVAATPRQEHYTSSDPSLTFSPQDSNSPSRAIGDERNSGTPPLSQSQLYGNGGGMNNFTSAAAAAGGQGAEAKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIEHVGEPLLLYQDVM'), Sequence(id='sequence68', source_id='RPB01516.1', sequence='MTTTPPLLFSPSPPPPLPDSLYPDEPEEVTTPTATLPPPPPSPPPRQPSPARHQHSGSAPATVGNFGSPPPNPPPPPQSLAYQQNGAGTTPTQAHYGGGGAVDMGKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIEHVGEPLLLYQDV'), Sequence(id='sequence69', source_id='KAG0236582.1', sequence='MAASADSARRSSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDFFSTFSKEEQEEITKQARKFARAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTIPEISEPGAPILEYTS'), Sequence(id='sequence70', source_id='KAH6640987.1', sequence='MEQDQAISPAYAVAPDSALAPARIPSPAGFPTDPHDDTLSGVESVTHQAVPDHHIHEHNGFHEQQHISQLQPLDHNVTNSPRSPYPTDTTDSEPTARYATPPIQAPTISRPPSGLSGQGAAYGADQVSRAGSNGAQAESSQSPGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNLSREEQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEITNVGEPLLIYQSC'), Sequence(id='sequence71', source_id='XP_002493958.1', sequence='MPDSPRRNQHRRSHSEQQNVPHSQRETNSVAVKIGLIGDAQIGKTSLMVKYVEGCYDENYTQTLGANFMERIINIRNTQITLSIWDLGGEKEFINMLPLVTTDAVVIIFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDLFIDLPDEDQIEITNQAKKYARAMSASLIFSSTSHSINIQKLFKVILSKVFDIKATIPEIVNTGEPLLLYQSI'), Sequence(id='sequence72', source_id='KAA8914877.1', sequence='MTTTPPPSRTSTSDMDHSARTPSSSSSSIPEEYIHTELRLAPSLSSLQSPPTPDRGSPSRYHHSHSNSATSAPSDGASYYGGSPPAMRDRDREGYYGNGAGAAGGSGGGAGSSAYNMAEQQRTKQNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQEV'), Sequence(id='sequence73', source_id='XP_018701974.1', sequence='METDDVPAATLHDNLDDTLGGLDGSPQVPSSSHYSNHHHDHQYQNPHHSNNDTHEHEPQSPGGGPSHHQQQHHDEDPPCTRYTPPAPGSSAPASAAPGSRAGSEMSNPSSSQQQHQAYGEYASSRQGSGEPAAPNGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPIQDQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence74', source_id='KAI2643608.1', sequence='MEHDLHGAPVSGLEPHAHHDDDSLNDADEHSDIASSLNGHESYHQPSQSLDYVLSHGQDTDEADPNSQYETQPTTSQPQSISRPPSGLSGAGGDRQTAHSDRGSNGADQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC'), Sequence(id='sequence75', source_id='KAG0125076.1', sequence='MTTTPPPLFSPSPPPPLPDSLCPDDPEEVTTPTSNLPPPPLPSPPPRQPSPVRHHHSGPAPAAVGNFGSPPPNPPPPPQSLAYQQNGAGTTPTQAHYGSGGAVDLGKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIEHVGEPLLLYQDV'), Sequence(id='sequence76', source_id='KAH9904989.1', sequence='MEQDPVAAAVPQDGYDDTLGGIEGSPHVGPTQINREKRHQQSQSLDNGLPNNGHADEIDPNARYDTPPNPLQPHSISRPPSGLSGAGDRHNAYSDHASRGSNGAEQNNGRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQARRFAKAMRAPLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC'), Sequence(id='sequence77', source_id='VEU24358.1', sequence='MDNRSVSTRIPRSHSTSEALSEEPARSVSSTVDGYDNYYGHQHHHAHRHRYGEEERQSAEKNTVTIKVGLIGDAQVGKTSLMVKYVENCFDEIYTQTLGVNFMERTIRIKNTEITFSIWDLGGEAEFTNMLPLVASDAVAVLFMFDLSRKSTLNSVKDWYRQARGFNRTAIPFLVGTKYDLFVDLPDEEQEEITRQARKYAKAMNAPLIFSSTCASINIQKIFKIVISKTFDLRLKIPEIVNTGEPILLYQNV'), Sequence(id='sequence78', source_id='KAI1283572.1', sequence='MDTMEQDFHAAPIPGPHEHLDEPLPDTFADVEGGPHVSPSQNGHEVYHHHHQQSQSLDHGLASSQNHDEADLNGRYETPPSTAHPQSISRPPSGLSGGDRQTAYSDRGSNGADQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC'), Sequence(id='sequence79', source_id='KAI1500557.1', sequence='MMEHDPAFATAPGPHNGIDDMLGGIEGSPTLASGQNGHETYHHHHSQSFDQEIPLNENPDDMDTTAQYDTPPVTAQPQSISRPPSALDGAAGERHASNGDRGSNGADYNNTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENIGEPLLLYQSC'), Sequence(id='sequence80', source_id='KAI2623093.1', sequence='MDQDPITTPVQAPAQDPTPHELHEDTFGGIEGSMHLSGEPGTPEAHHRQSQSLDQGLANSVHPDEVDPNTQYEAHQYDAPPQSMPRPASSMSGAGERQYPEHASRESNGADRNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence81', source_id='NP_593285.1', sequence='MADARKNNVTIKVGMIGDSSIGKTSLMVTYVQGSFDEESTQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPMVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAVPILIGTKYDHFMTFPREDQEEITKQARRYAKAMKASLVFCSTSHSINVQKIFKIVLAKVFDLKCTIPEIKNVGDPILEYIDR'), Sequence(id='sequence82', source_id='KAI0431960.1', sequence='MDTMEQDFHAAPIPGPHEHLDETLPDTLADVEGAPHVSPSQNGHEVYHHHQQSHSLDQGLANSQTSDEPDLNGRYETPPSTGHAQSISRPPSGLSGGDRQTAYSDRGSNGADQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC'), Sequence(id='sequence83', source_id='KAH8926511.1', sequence='MSDSAGPLALEKGGAEAGEKNSVVLKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLIGTKYDHFSNFSRDEQEEITRQSRRFARAMKAPLIFCSTSHSINVQKIFKIVLSKSFDLKCTIPEITDVGEPMLIYIDV'), Sequence(id='sequence84', source_id='RMJ24013.1', sequence='MNPSYHNGYSSDSHAQYSTGPAGFNPPVHDSTSQDAEQTRLTFSPSITQQPQPPSLSRPSSAFSSGPERHGASQQHHETSQRAQPAKNSVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLIGTKYDHFVNFPREDQEEISVQAKRFAKAMKASLIFSSTSHSINVQKIFKIVLAKAFDLKCTIPEIENVGEPLLLYKSV'), Sequence(id='sequence85', source_id='KAF8931046.1', sequence='MAATGESAKKSSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDYFSTFSKEEQEEVTKQARKFARAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTIPEISEAGAPILEYASN'), Sequence(id='sequence86', source_id='ODQ76250.1', sequence='MSSAAPNGSDGSVARKNAVVIKVGMIGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRDTEITFSIWDLGGQREFVNMLPLVSNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDTFAQFPREDQEEITKQARRFAKVMKASLIFCSTSHSINIQKIFKIVLSKAFELKCVIPEIATIGDPILLYHDV'), Sequence(id='sequence87', source_id='KXJ93426.1', sequence='MDQEPAALPPTRNPLDVAPDDTLGGIESSPRVYSDPESTIRTHHHSQSLDQGLASSAHYQHNSEDMDHQTRQDTPPIPQQPQSISRPPSGLSGAGDRQPAQYSDHASRSSGGQPEPQNGRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFPREDQEEISNQARRFAKAMRAPLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC'), Sequence(id='sequence88', source_id='XP_051368163.1', sequence='MDQDLLGTPTAPHDTLDDALAGVEGPLHLASESGNLEPHHRQSQSLDRGLANNAQVDDFDTAVPFDSPQYDTPPPAMQRPASSDSAAGEKQLAEHASREANGADRNNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence89', source_id='GES63634.1', sequence='METIHNLNTGVSEPVEQQPQESAFEASPVSHPAGSTDEPTSASVYHRSGYNSDSHAQYSSLATHQPQPPTSSRPSSGLSGPERYGPSQEVTQKQPSQPPSSQTKNSVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLVGTKYDHFVNFPREDQEEISIQAKRFAKAMKASLIFSSTSHSINVQKIFKIVLAKAFDLKCTIPEIENIGEPLLLYKNV'), Sequence(id='sequence90', source_id='RPA74746.1', sequence='MADHHEGSSHSYDRTSHSSRPATAEKQPAPKEETKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLIGTKYDHYVNFPIEDQEEISKQAKRFAKAMKASLIFSSTSHSINIQKIFKIVLSKAFDLKCTIPEITEIGEPLLLYQDV'), Sequence(id='sequence91', source_id='XP_024675402.1', sequence='MDTPQPSDPLAGVAPERHEQHPQPQSAPQQSQYPVNPAGPYPSHVESVPPEVIPSASTYHAGYSSDSHANYSSNAVDFNSGSEYPPQPRAELPRAQEAVPSMMHPPAAPSSSRPSSGLSSGPDRLGSVQSGQELPQKQPIPSNKNSVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLVGTKYDHFVNFPREDQEEISIQAKRFAKAMKASLIFSSTSHSINVQKIFKIVLAKAFDLKCTIPEIENIGEPLLLYKNL'), Sequence(id='sequence92', source_id='KAH6850716.1', sequence='MEQEQAFNPAYTMAPDPALAPAPIPAPISSPVGLPTDPHDDTLSGVESVTHQALPDHNIHDHNGFHEQQHLVQLQPLDHSVNNSPRSPYPTDTTDSEPTARYATPPIPAPTISRPPSGLSGQGAAYGADQVSRAGSNGAQAESSQSPGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNLSREEQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEITNVGEPLLIYQSC'), Sequence(id='sequence93', source_id='PHH71636.1', sequence='MEHQQPELDQQPPPLHAAHDSLDDTLGGIEGSPHVAAANNGFHQQSQSLDSAVPNSPRYDDDAANRHTPPVSSAPSLSRPGSQMSNPSSSNPPQQMHGNDHRQGSNEPPNGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPPQDQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQNV'), Sequence(id='sequence94', source_id='KAJ3562589.1', sequence='MDTMEQDLHTTPIPGVHEHHHLDDALPDPHADVDARPHSAPGQNGHEVYHQQSHSLDQGIAHGQHPDEADLNGRYDTPPSATHPQSISRPPSGLSGAGGDRQTTYSDRGSNGTDQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQQTV'), Sequence(id='sequence95', source_id='RDA84390.1', sequence='MDHQPAADQEQPQELPRPASHDGLDDTLGGIEGSPHPVASSNGFHAHQEAPGSPRYDDDNAARQTPPVSAPLSRPGSQMSNPPQHASGSDYRQGSNEPPNGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPPQDQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQNV'), Sequence(id='sequence96', source_id='XP_007413704.1', sequence='MSNMTSSTGPAGSSGSTSNSSLQQNDDKNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLIGTKYDHFAAFSKDEQEEITRQSRRFAKAMRAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTIPEINGSGEPLLIYLDV'), Sequence(id='sequence97', source_id='KAI0376630.1', sequence='MHLPNEPHNHETHHRQSQSLDQGLANNVHPDDVDPNAQYEAHQYDQPSQSVPRPASSMSSTGGERQYSDQAARESNGAADRNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence98', source_id='XP_047831721.1', sequence='MEQDFHTAPIPGPREHLDALPDTHDTHADVVARPHTAPDQNGHEVYHQQSQSLDQGLSDSQHHDDADVAGRYETHPSTTHPQSISRPPSGLSGAGGDRQATYSDRGSNGTDQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISSQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC'), Sequence(id='sequence99', source_id='KAI9294962.1', sequence='MAEEGKNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQHEFVNMLPLVCNDAVAILFMFDLSRKATLNSIKEWYRQARGFNKTAMPFLVGTKYDHFASFNREEQEEITKQARKFAKAMRAPLIFCSTSHSINVQKVFKVVLSKAFDLKCTIPEISDIGAPILEYEVGSE')], aligned_sequences=[Sequence(id='sequence100', source_id='BAH60832.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSA------------SE-----MR-----A---------ASERVGEERNSLPSVRNQVDIQVGLIGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVSIRSTDIVFSLMDLGGQREFINMLPIATLGSSVIILLFDLTRPETLNSIKEWYRQALGLNDSAIPILVGTKYNLFIDLEEEYQEKVSKTSMKYAQVMDAPLIFCSTAKSINIQKIFKVALAKIFDLTLTIPEINEIGDPLLIYKELGSKKNKSKNSSKPRRRSPVDN-ENKELV---------SQPHNYGHTSE---------------------------------'), Sequence(id='sequence101', source_id='CAI4663910.1', sequence='-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M---------A-TPSTGANNSIPAVRNQVEVQVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQADGLNDSAIPILVGTKYDLLIDLDPEYQEQISRTSMKYAQVMNAPLIFCSTAKSINIQKIFKIALAKIFNLTLTIPEINEIGDPLLIYKHLGGQQHRHHNKSQD--RKSHNIRKPSS-------------------SPSSKAPSPGVNT-----------------------'), Sequence(id='sequence102', source_id='EJT44931.1', sequence='-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M---------T-TPITGGSTSIPAVRNQVEVQVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQAYGLNDSAIPILVGTKYDLLIDLDPEYQEQISGTSMKYAQVMNAPLIFCSTAKSINIQKIFKIALAKIFNLTLTIPEINEIGDPLLIYKHLGSQQRRRQSKSQD--RKNHTVKKPSS-------------------SPSSKPPSPGVNI-----------------------'), Sequence(id='sequence103', source_id='XP_037139093.1', sequence='-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSSGGTDVQAQQELPKVKSRVDVQVGLVGDAQVGKTSLIVKYVQNVFDEEYTQTLGVNFLKRKVSIRSTDIVFSIMDLGGQREFINMLPIASLGSSAIVFLFDLTRPETLSSIKEWYRQAHGLNETAVPLLVGTKYDLFVDLDPEYQEQLSRTSMEYAQVMDAPLVFCSTAKSVNVQKIFKIALAKIFNLTLTIPEINEIGDPLLIYKSLGNHRARGEEISRRP--SPSARTSFS--------------------------------------------------------'), Sequence(id='sequence104', source_id='XP_003680887.1', sequence='-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSEAQEQQELPKAKNRVDVQVGLVGDAQVGKTSLMVKYVQNVFDEEYTQTLGVNFLKRKVSIRSTDIVFSLMDLGGQREFINMLPIASLGSSAIVFLFDLTRPETLSSIKEWYRQAHGLNETAVPLLVGTKYDLFVDLDPEYQEQLSRTSMEYAQVMDAPLIFCSTAKSINVQKIFKIALAKIFKLTLTVQEINDVGDPLLIYRHLGNQRHDSDEVSRRS--SPSTRSSTS--------------------------------------------------------'), Sequence(id='sequence105', source_id='XP_037144827.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------MSQEYR----T---------RSRSRSF------------SD-----QA-----AT-----QEEERPFVNLNMNVNMRPKNQVEVQIGLVGDAQVGKTSLMVKYVQNVFDEEYTQTLGVNFLKRKVSVRSTDIVFSLMDLGGQREFINMLPIASLGSSAIIFLFDLTRAETLSSIKEWFRQAHGLNDTAIPILVGTKYDLFVDLDPDYQEQMSRTSMEYAQVMDAPLIFCSTAKSINVQKIFKVALAKIFSLTLTIQEINEVGDPLLIYKTLGTAKRDQDKTDNIK--NSNTNVTTES-----------------------RRKSPTYTQ-----------------------'), Sequence(id='sequence106', source_id='AQZ18344.1', sequence='-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MEGSQETQGQQTMNVKVKNQVEVQIGLVGDAQVGKTSLMVKYVQNVFDEEYTQTLGVNFLKRKVSIRSTDIVFSIMDLGGQREFINMLPIASLGSSAMVFLFDLTRPDTLTSVKEWYRQAHGLNETAVPLLVGTKYDLFVDLDPAYQEQLSRTSMEYAQVMDAPLVFCSTAKSINVQKIFKIALAKIFHLTLTLPEINEIGDPLLIYSTLGNKRSRRAARG----------------------------------------------------------------------'), Sequence(id='sequence107', source_id='XP_002495560.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MDN------------SD-----QE-------------VQGHQHQQQQQPTNVKVKNQVEVQIGLVGDAQVGKTSLMVKYVQNVFDEEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINMLPIASLGSSALVFLFDLTRPETLTSIKEWYRQAHGLNEGAIPVLVGTKYDLFVDLDPVYQEQLSRASMEYAQVMDAPLIFCSTAKSINVQKIFKVALAKIFSLTLTVPEINEIGDPLLIYSAFGNKRSRGAAR-----------------------------------------------------------------------'), Sequence(id='sequence108', source_id='XP_003673548.1', sequence='---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MPNSSPADHEPIPDVRNQVDLQIGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVKLHSTDIVFSLMDLGGQKEFINMLPIAAVGSSVIVFLFDLTRPETLNSIKDWYRQVKGLNDIAIPILVGTKYDLLINLSAEYQEQISTAAIDYANVMDAPLIFCSTAESINVQKIFKIALAKIFNLTLVVPEIRDIGDPLLLYKELGNNIQKVKQSKSPQRLS----------------------------------------------------------------'), Sequence(id='sequence109', source_id='XP_003958955.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MVASEEHEKHQQIPFVRNQVDIQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVNLRSTDIVFSLMDLGGQREFINMLPLAAVGSAAIIFLFDLTRPETLESVKEWYRQAYGLNNQAIPILVGTKYDLFIDLDEEYQRQVSKTALDYSEVMDAPLVFCSTAKSINIQKIFKIALAKIFSLTLTISEIKDTGDPILLYKRFGSKLSKNKSSPSSSTKLK-TP-------RA---------------------------------------------------'), Sequence(id='sequence110', source_id='XP_001644471.1', sequence='---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MQSSSIPKTRNQIEVQIGLVGDAQVGKTSLMVKYVQNIFNDEYTQTLGVNFLKRKVSVRSTDIVFSILDLGGQKEFINMLPIASIGSSAIIFLFDLTRPETLNSIKEWYRQANGLNDQAIPILVGTKYDLFIDLDQSTQEKISRIAMQYAQVMNAPLIFTSTAKSINVQKIFKIALSKIFNLTLTISEINEIGDPLLIYKTLGNRSTPIANASAS--SSA-------S-------------------SPS-------AST-----------------------'), Sequence(id='sequence111', source_id='XP_003684279.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MPY------------RE-----NR-----N---------A-SSAGGMMRSVPKSRNQVEIQVGLIGDAQVGKTSLMVKYVQNIFNEEYTQTLGVNFLKRTVSVRSTDIVFSLLDLGGQKEFINMLPIATVGSAAIVFLFDLTRPETLNSIKNWYRQANGLNEMAIPILVGTKYDLFINLDKEHQDSISRLSMEIAQVMDSPLVFCSTSKSINVQKIFKIALSKIFNLTLTIPEINEIGDPLLIYKTLGNNFNNNRSHNSSPIRTNNNNNSNNDTNSNNDGNSNTVNNNNYSALDNSNYPNPTASEHLNRIKNLHQCLRHAQLRCLRVV'), Sequence(id='sequence112', source_id='SMN18735.1', sequence='----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MPGSEPKRNLVPDVKNQVEIQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKINLRSTDIVFSLMDLGGQREFINMLPLASVGSSAIIFLFDLTRPETLDSVKEWYRQVYGLNNLAIPILVGTKYDLFIDMDKEYQKQISHTVLEYAQVMNAPIVFSSTAKSINIQKIFKIALSKIFNLTLTIPEITRTGDPLLIYRKFGNQNRNPTNVSASPVFSSQSS---SISPPKSKGTTAS--------------------------------------------'), Sequence(id='sequence113', source_id='CAD1779387.1', sequence='----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MPGSESKRNIVPDVKNQVEIQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKINLRSTDIVFSLMDLGGQREFINMLPLASVGSSAIIFLFDLTRPETLDSVKEWYRQVYGLNNLAIPILVGTKYDLFIDMDKEYQKQISNTVLEYAQVMNAPIVFSSTAKSINIQKIFKIALSKIFNLTLTIPEITRTGDPLLIYRKFGNQNCKPTKVMTSPAFSSQTS---STSTSQVKAKETTAT------------------------------------------'), Sequence(id='sequence114', source_id='KAG0666170.1', sequence='----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MPHSSSRRHQVPDVKNQVEIQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKINLRSTDIVFSLMDLGGQREFINMLPLASVGSSAIIFLFDLTRPETLDSVKEWYRQVYGLNNLAIPILVGTKYDLFIDMDKEYQKQISNTVLEYANVMNAPIIFSSTAKSINIQKIFKVALSKIFNLTLTIPEITRTGDPLLIYKKFGNQDRKSSKITTSSSQSSSSPASVSVSPRKSKSTITSS-------------------------------------------'), Sequence(id='sequence115', source_id='XP_022464898.1', sequence='----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MANVRSRHSSIPGIKNQIDVQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVNLRSTDIIFSIMDLGGQKEFINMLPLAAVGSSVIIFMFDLTRPKTLQSIKDWFRQAHGLNDSAVPILVGTKYDLSIETDERVPGNISCTAMRYAQVMNAPIVFCSTAKSIHIQKIFKIALAKIFNLTLTVPEIESIGDPLLIYRDFGNNVKRQSKSSPKRTGSMERT-PVSSQQ-----------------------------------------------------'), Sequence(id='sequence116', source_id='XP_003669861.1', sequence='---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSNSSSPEHEPIPAVRNQVDLQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNYLKRKVRLHSTDIIYSLMDLGGQREFINMLPIAAVGSSAIIFLFDLTRPETLNSIKDWYRQVNGLNDVAIPILVGTKYDLFIGLDSNYQNHISNSAIEYSKIMNSPLVFCSTAEGINIQKIFKIALAKIFNLTLVIPEITTVGDPLLIYKNLGNATNK---------------------------------------------------------------------------'), Sequence(id='sequence117', source_id='XP_003678517.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------MA-------------------------------------SE----------------------HRARTSKDSEANLAQPEEIQIQVGLVGDAQVGKTSLMVKYAQNGFDEEYTQTLGVNLLKRKVRIKSSNIVFSLMDLGGQKEFINMLPIASVNSSVIIFLFDLTRPESLESIKNWYMQAHGLNHDAVCILVGTKYDLFIDLPTEYQEQISRTSMKYAQAMDSPLIFSSSIASINIQKIFKIALAKVFDLTLIIPEITQIGDPLLIYKHLGSFAGRKRNNK----------------------------------------------------------------------'), Sequence(id='sequence118', source_id='KAG0659075.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MQQNTPTSINRHDPIPGVKNQIDIQIGLVGDAQVGKTSLMVKYVQNIFDNEYTQTLGVNFLKRKVKLRQTEIIFSLMDLGGQSEFINMLPLAAVGSSVIIFLFDLTRPVTLKSIKGWFRQAKGLNDLAIPILVGTKFDLFYTMDSQYQNEISKVAMEYSQVMDAPLIFCSTAKSIHIQKIFKIALAKLFNLTLTINEINLPGDPLLIYKDKGNNCINQSTNNNNNNTNLRRKSS--------HG--HTSNNNNNNNTPIQASPIAVRSSYNHR----HH-------------'), Sequence(id='sequence119', source_id='XP_451758.1', sequence='-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSLDKDRVPSLRHQVKVKVGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKVVLGSTDVIFSIMDLGGQREFINMLPLVSEGAVAIVFLFDLTRPETLNSIKEWYRQARGFNDTAISILVGTKYDLFVDMDPEYQENVSRTAMKYAQVMKSPLIFCSTQSSINVQKIFKVVIAKAFNLTLKVPEYKQIGEPLLIYKSFGPSRPSSP-KRQVH-----TPPPSS--------------------------------------------------------'), Sequence(id='sequence120', source_id='NP_984991.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MASENTIPQLKNEVKIKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKINLGSTDVIFSIMDLGGQREFINMLPLVSNRAVAIIFLFDLTRPETLTSIREWYRQARGFNETAIPLLVGTKYDLFVNLDVAYQEELSKTSMRYAQVMGAPLVFCSTASSINVQKIFKVIIAKAFNLTLRIPEIKDMGDPLLIYKSLGNAPQRVPS--------------------E------YTHHGRYRQ--------PEHIRNMAE----------Q--------'), Sequence(id='sequence121', source_id='XP_017989070.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MVGESGIPQPKNEVKIKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKINLGSTDVIFSIMDLGGQREFINMLPLVSNRAVAIIFLFDLTRPETLTSIREWFRQARGFNDTAIPLLVGTKYDLFINLDASYQEEISKTSMRYAQAMGAPLVFCSTASSINVQKIFKVIIAKAFRLTLRIPEIRDIGDPLLIYKSLGNSVPKRDAAGTVM-----AASSGYSPTSA------TVEQGQYRQ--------SERAQHTAS----------EQ-------'), Sequence(id='sequence122', source_id='KAG0673910.1', sequence='---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSTDKVPSLRHQVRVKVGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKVVLGSTDVIFSIMDLGGQREFINMLPLVSEGAVAIVFLFDLTRPETLNSIKEWYRQARGFNETAISILVGTKYDLFVEMDSKYQEEVSRTAMKYAQVMKSPLIFSSTQSSINVQKIFKVVIAKAFNITLKVPEYKQIGEPLLIYKSLGPTRPPSPNKRQVH-----TPPPSS--------------------------------------------------------'), Sequence(id='sequence123', source_id='SMN21971.1', sequence='----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MNSE----KNKVSPREEIQLQIGIIGDAQVGKTSLMVKYVQDIYNKEYTQTLGVNFLKKRIRLRSTDITLSLMDLGGQREFINMLPLAAMDSYCIILLFDLTRPETLKSVKEWYRQAFGLNKNAIPILVGTKYDLFIEMDQDYQEEISRTCLKYAQIMDSPVIFSSSAYSINIQKLFKIIISKIFNLTLTLAEISDIGDPLLIYKEFGNTHLNGL-------------------------------------------------------------------------'), Sequence(id='sequence124', source_id='KAG0661436.1', sequence='----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MNSTKLKSSKRPAKREEIQLQIGIIGDAQVGKTSLMVKYVQDIYNKEYTQTLGVNFLKKTIRLRSTDIVLSLMDLGGQKEFINMLPLAAMDSYCIILLFDLTRPETLKSVKEWYRQAFGLNKNAISVLVGTKYDIFIDMDEDYQEEISRTCIKYAQIMDSPVIFSSSAYSINIQKLFKIIVSKIFNLKLTIPEIRDIGDPLLIYEEFGNGHLNN--------------------------------------------------------------------------'), Sequence(id='sequence125', source_id='SCV02624.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MST----NEANVPTLPQPKNTFTIKVGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLDKKIKLGSADIVFYIMDLGGQREFINMLPLASEGARAIIFLFDLTRPETLKSIKEWHRQATGFNEMAVPLLVGTKYDLFVNFDPEYQVQVSKQSMRYAQAMDAPLIFCSTSHSINIQKIFKVIIAKLYNLTMRASEIKQIGDPLLIYKHLGSKRRFSENPSSRNSSSR-TPSPHRSP------------------------------------------------------'), Sequence(id='sequence126', source_id='SCV99388.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSL----ATSDTPVLPHPTNTFTIKVGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLDKKIRLGSADILFYIMDLGGQREFINMLPLASEGAKAIIFLFDLTRPETLKSIKEWHRQATGFNENAVPLLVGTKYDLFVNMDPEYQVQVSKQSMRYAQVMDAPLIFCSTSHSINVQRIFKIIIAKIYNLTMRASEIKQIGDPLLIYKYLGNSRRRSPSS-----------------------------------------------------------------------'), Sequence(id='sequence127', source_id='CUS20182.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M-----SMV----SGGDTPLLPHPKNTFTLKIGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLSKKITLGSADILFYIMDLGGQREFINMLPLASEGAKAIIFLFDLTRPETLKSIKEWHRQATGFNEQAVPLLVGTKYDLFVNLDPDYQAQISKQSMRYAQAMDAPLIFCSTSHSINVQKIFKIVIAKLYNLTMRASEIKQIGDPLLIYKYLGSSRRPASGSSTSSGTS----------------------------------------------------------------'), Sequence(id='sequence128', source_id='XP_045933944.1', sequence='-------------------------------------MHFQQ----------------------------------------------------------------------QQQQHYHTPLRHGSDPAQ-HITNNSEEHINN--------YGNNTVDTPQQLRHTS---------AMTVINS---SQAATNNNYSDN---NNNT-SPVRG-----TTS----TAETIPDELIPRTTFRLKVGLIGDAQVGKTSLMVKYVQSVFDEEYIQTLGVHHLEKRESLKYADILFVINDLGGQREFINMLPIVSEDAVAIVYLFDLTRPETLTSIKEWYRQAKGLNSKAIPLLIGTKYDLFIDMDPSYQEKMSRIGMLYAEAMNAPLIFSSTAESINVKIIFKIVVAKAFNLKLTVPEIKDLGDPILIYKNLGEKKKKN--------------------------------------------------------------------------'), Sequence(id='sequence129', source_id='KAA8901327.1', sequence='---------------------------------------------------------------------------------------------------------------------------------------------------------------------MSTPS-----S------PSG-----------GG---------------------------SKATAAEAARNSVSLKVGMIGDAQIGKTSLMVKYVEGTFDEDYIQTLGVNFMEKVVSIRNTDITFSIWDLGGQREFVNMLPLVSNDAVAILFMFDLTRKSTLNSVKEWYRQARGFNKTAIPFLVGTKFDMFVNLAEEDQEEITKQAKRFAKAMKASLIFCSTSHSINVQKIFKIVLSKAFDLKLTLPEITMTGEPLLIYQQW---------------------------------------------------------------------------------'), Sequence(id='sequence130', source_id='KAF8417303.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------------MSD-SSTIA-------------SGSGAGGSYHHQQA------STS-------------SAGSALQETPGRRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSVKEWYRQARGFNKTAIPFLVGTKFDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINIQKIFKIVLSKSFDLKCTIPEIEQVGEPLLLYQEV---------------------------------------------------------------------------------'), Sequence(id='sequence131', source_id='KAF3929277.1', sequence='---------------------------------------MTTTPP-------------------------------TK------------RETSP----VSPLRASF--ANLN--------TEDHS---------QATAAIR---AQ---------------AGHTR-HESL--EKYTRR-DSTASE-NRNEEGY----------------------RERGSISSQSGAAG-AKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGLNKTAIPFLIGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGDPLLIYQDVELGNR----------------------------------------------------------------------------'), Sequence(id='sequence132', source_id='OEJ86227.1', sequence='------------------------------------MTEYEN----------------------------------------------G----QQQQ---------RERIRGQERESYDEQERESYDEQERERIREQERRINN--------EQQRRVNNEQQ--------------------------RRXNNQQRST---TNDN-VSSNK-----NTH----KDLDLQDNLIPRTTFKLKVGLVGDAQVGKTSLMVKYVQSVFDDEYIQTLGVHHLEKTEFLKYADILFVINDLGGQREFINMLPIVSEDAVAIVYMFDLTRPETLTSIKEWYRQAKGLNNKAISLLVGTKYDLFIEMDSEYQEKISKIATLYSZAMNAPLIFSSTSESINVKVIFKIIVAKSFNLKLTIKEIXEIGDPLLLYKNLGNKHRISH-------------------------------------------------------------------------'), Sequence(id='sequence133', source_id='XP_046060918.1', sequence='----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MDKNTVTLKVGLVGDAQVGKTSLMVKYVENCFDEVYTQTLGVNYMERSINIKSTEITFSIWDLGGEAEFTNMLPLVASDAVAVLFMFDLSRKSTLSSIKDWYRQTRGFNRTAIPFLVGTKYDLFVDLSDAEQEEITRHAQKFARAMNAPLIFCSTSASINIQKIFKIVISKAFDLRLRIPEIENVGEPILIYHEHDRERERTSRRPTASHS-----------------------------------------------------------------'), Sequence(id='sequence134', source_id='EPS36031.1', sequence='---------------------------------------MTTTPP-------------------------------TK------------RDASP----VSPLRASF--ANLN--------TDDHT---------SATAAIR---AA---------------AGHTR-HESL--EKYTRR-DSTASE-NRPEEGY----------------------RERGSISSQGGSAG-AKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGLNKTAIPFLIGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGDPLLIYQDVELGNR----------------------------------------------------------------------------'), Sequence(id='sequence135', source_id='KAI5807151.1', sequence='--------------------------------------------------------------------------MHELPLAPSLPPPQ----SPPTPDR----------YSQGAARHY---HSNSAAS-A-----PAMIG-----------DA-------AGAYYRGSPPPPMPQQPYVP-R----D-RS-SESYHNGSS--------------------AQQ-QQQQYAMEQKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFTREEQEEVSKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQDV---------------------------------------------------------------------------------'), Sequence(id='sequence136', source_id='XP_011117899.1', sequence='---------------------------------------MTTTPP-------------------------------TK------------RESSP----VSPLRASF--ANLN--------ADDHS---------SATAAIR---AA---------------AGHTR-HESL--EKYTRR-DSTASE-NRNDESY----------------------RDRSSVSSQG-GSG-AKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGLNKTAIPFLIGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGDPLLIYQDVEAGNR----------------------------------------------------------------------------'), Sequence(id='sequence137', source_id='KAI1438264.1', sequence='---------------------------------------MEQDLHTTPGADLE----------P--HGLPDD---GSI---------SSIEDTPEA--------AS--SLNGHETYHQ---HPQSLDYVV-----SSS---------------QNTDETDPNAQYET-VPATSQAQSISR-PPSGLSGAGGDRQAA------------------------HSDRGSNGADHPSARNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSRDEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence138', source_id='XP_022456167.1', sequence='---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSSQNSVSLKVGLVGDAQIGKTSLMVKYVEGCFNEDYTQTLGVNFMERSILIKNTQITFSIWDLGGEREFLNMLPLVSSDAVAILFMFDLTRKSTLNSIKEWYRQTRGFNKTAIPFLVGTKYDLFIDMPMEDQEEVTTQARKFAKAMNASLIFCSTSASINIQKIFKIVISKAFDLRLTIPEVTHIGEPILLYQGV---------------------------------------------------------------------------------'), Sequence(id='sequence139', source_id='KAF3908940.1', sequence='---------------------------------------MTTTPP-------------------------------TK------------RDVSP----VSPLRASF--ANLN--------TTDDGQS--------ATAAIR---AS---------------AGHTR-HESL--EKYTRR-DSTASE-SRNEDGY----------------------RERSSISSQG-GSGGNKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLVGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENTGDPLLIYQDVELGNR----------------------------------------------------------------------------'), Sequence(id='sequence140', source_id='XP_006693239.1', sequence='---------------------------------------MERDQLAAPAPSE------------------S-----AA---------SDYRDHSLADAEVAPSSDCE--NNGFHDHHY--SQSQHYDQ-------DDAAESE---PT---------------ARYNT-PSGS--GQQISR-PPSGLS-GERGAGYATDQGSRAG------------SNSASQEQQQQQSQQPPARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNLSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEITNVGEPLLIYKDV---------------------------------------------------------------------------------'), Sequence(id='sequence141', source_id='EWC45326.1', sequence='---------------------------------------MATTPP-------------------------------TK------------RDTSP----VSPLRASF--ANLN--------TTDDGQQ-------SAAAAIR---AA---------------AGHTR-HESL--EKYTRR-DSTASE-SRNDDGY----------------------RERSSISSQGGGAGGNKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLVGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGDPLLIYQDVETGNR----------------------------------------------------------------------------'), Sequence(id='sequence142', source_id='KAF3930522.1', sequence='---------------------------------------MTTTPP-------------------------------TK---------QGSRNVSP----VSPLRASF--ANLN--------TTDENHS-------SATAAIR---AA---------------AGHTR-HESL--EKYTRR-DSNASE-SKNEDGY----------------------RERSSVSSQGGS--SQKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLIGTKYDHFVNLSKEDQEEISRQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENIGDPLLIYQDVESGNR----------------------------------------------------------------------------'), Sequence(id='sequence143', source_id='KAF8249497.1', sequence='-----------------------------------------------------MQ------Q-HDDDALPQP-QTTELPLAPSLPPPVALAHSPPTPRR----------RNSSPTRHY---HSSSNASGA-----PPYIG-----------SP---GSVESAQYYNSQGSPPTPAAPHQQ-QQFATS-RA-DGGYHNGGG-------------------------YAQQQLEAKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQDV---------------------------------------------------------------------------------'), Sequence(id='sequence144', source_id='XP_002174495.1', sequence='-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MAEQTKNSVTIKLGMVGDSSIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAVPILIGTKYDYFVGLSREDQEEITKQARRYAKVMKASLVFCSTSHSINVQKIFKIVLAKVFDLKCTIPEITAVGEPILEYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence145', source_id='PRP83484.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------MG-----------DQ---NDTE-------------ARIGHSR-LPFFIM-SG-DGEYTG-----------------------------SGKAGEGKKNSVVVKVGMVGDSQIGKTSLMVKYVEGTFDEDYIQTLGVNFMEKTISIKGTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLIGTKYDFFANLPAEEQEEITKQARKFAKAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLSCTIPEIIKVGEPILEYQNLS--------------------------------------------------------------------------------'), Sequence(id='sequence146', source_id='GAA97202.1', sequence='-------------------------------------------------------------------------------------------------------------------------MASSTSTG---------AG-----------SS---SSRQRQESYRSS--------------------------HSQQSS--------------------SQH-APAPAPQDDDRNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKSISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFSTLAESEQEDVTRQAKRFAKAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTLPEITETGEPLLLYQDI---------------------------------------------------------------------------------'), Sequence(id='sequence147', source_id='OBA26219.1', sequence='------------------------------------MESML-------------------------------------------------------------------------------------QSHNRRR-HTNSMSISG--------SSNNNVHSELRQNNNN---------RISSMPS---SQPASN----------SNN-KPVDN-----IKLTEKDMNKYIDKDLVPKTTFKLKVGIIGDAQVGKTTLMCKYVNSAFDDEYIQTLGIHHLQKKETLKYSNILFTINDLGGQREFINMLPIVSEGAVAIIYLFDLTQPESLNSIKEWYRQAKGLNEKAISILVGTKYDLFLDLDPEYQTNISQIATLYSEAMNAPLIFASTAASINVKIIFKVIVAKAFGLDLAVPEITQIGDPLLIYKKLGNVIKQIKR------------------------------------------------------------------------'), Sequence(id='sequence148', source_id='KAI1823332.1', sequence='---------------------------------------MEQDFHAVPAPDSE----------P--HDHPDD---G-L---------GGLEESPDI--------AP--GSNGHELYHQ---HPQSLDYVI-----SNN---------------QNIDDVDPNAPYEA-VATTSQPQSISR-PPSGLSGAGGDRQTA------------------------HSDRGSNGAEHPSARNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence149', source_id='CDO57487.1', sequence='---------------------------------------------------------------------------------------------------------------------------------------------------------------------MSIPS-----IYPNH-KPTGM--------YTGQ-----------------------FISTLHPCANYPFFSRVSLKVGMIGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKAISIRNTEITFSIWDLGGQREFVNMLPLVSNDAVAILFMFDLTRKSTLNSVKEWYRQARGFNKTAIPFLVGTKFDLFANLPEEDQEEISTQSKRFAKAMKASLIFCSTSHSINVQKIFKIVLSKAFDLRLTLPEITNTGEPLMIYQQW---------------------------------------------------------------------------------'), Sequence(id='sequence150', source_id='KAI2629167.1', sequence='---------------------------------------MDQD--------PM----------A--TPIPHDVHDDTL---------GGIEGSMHLP---------NEPHN--HETHH--RQSQSLDQGL-----ANNA---------------HPDEVDPNAQYEA-HQYDQPSQSVPR-PASSMSSTGGERQY---------------------SDQ--AARESNGA-DRNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence151', source_id='KAI5811198.1', sequence='---------------------------------------MSNDPL----PTIP----------SA-TSSTVD----LS---------NG--NDGSA---QNE---N---EPPHRSQHH--TGM------------TSIHL-----NDPTSQSNAA---ASYSQTHSG-ATMLS-------------SGSGATGSFQQAGG------PSSGGP-----AGAQTQGQQALGGDYSRRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPKEDQEEISKQARKFARAMKASLIFSSTSHSINIQKIFKIVLSKSFDLKCTIPEIEQVGEPLLLYQDV---------------------------------------------------------------------------------'), Sequence(id='sequence152', source_id='KAG9017701.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSTAASGSGAPPAT--------------------PLS-AASADLGGDERNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISVRRTTITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSVKEWYRQARGFNKTAIPFLIGTKYDTFATFSRDEQEEITKQAKRFAKAMHAPLIFCSTSSSINVQKIFKIVLAKAFDLKCVIPEVHNVGEPLLIYMDQ---------------------------------------------------------------------------------'), Sequence(id='sequence153', source_id='OTA67948.1', sequence='-----------------------------------------------------------------------------------------MHFPGHLP---------DEPSSSSHEPHH--RQSQSLDQGL-----ANSAHP-----------HPHPDDIDPNAQYEA-QQYDPPQQSTQR-PPSSMSS-TGERQY---------------------TEQ--ASRESNGA-DRNARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence154', source_id='KAH6626466.1', sequence='MEQEQQAMAPPLPITPTTGIASDAPLVP---A-----------AAAAQVPLPH----------SLSPPLQIDPHDDTL---------SSAGTVSHQ---ALPDHNNFHEHNGYHD------QPQHPIQFQ-----PLDHSVN---NSPRSYYPADQTDSEPTARYAT-PPVA--APAISR-PSSGLSGQGAGYGAD--HVSRAG-----------------SNGAAAESSQAPGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNLSREEQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEITNVGEPLLIYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence155', source_id='ORX96310.1', sequence='-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MEAEAQKKNSVVVKVGLVGDAQIGKTSLMVKYVEGAFDEDYIQTLGVNFMEKTIHIRNTEITFSLWDLGGQREFINMLPLVCNDAVAILFLFDLSRKSTLNSIKEWYRQARGFNKTAIPILVGTKYDQFAECPPEEQEEVTRQARKFSKAMRAPLIFCSTSHSINVQKIFKIVLSKAFDLRCTIPEISDVGAPILEYHID---------------------------------------------------------------------------------'), Sequence(id='sequence156', source_id='XP_028477951.1', sequence='---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MTD-P--------------------------------GYASSG-SGSGRVSGGEGGDRNAIVLKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKAITIRNTEITFSIWDLGGQREFVSMLPLVSNDAVAILFMFDLTRKATLNSVKEWYRQARGFNKTAIPVLIGTKYDKFAALSREEQEEITKQAKRFSKAMHAPLIFCSTSHSINVQKIFKIVLAKAFDLKCVIPEIDQVGEPILLYNDL---------------------------------------------------------------------------------'), Sequence(id='sequence157', source_id='XP_024666830.1', sequence='-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSRDRVPVDLNDQQQQVTVKVGLIGDAQIGKTSLMVKYVNNTFDDDYIQTLGVNFLEKSVNIRNTQITFSIWDLGGQREFINMLPLVCNDAAALVFMFDLTRKSTLNSVRNWYRQARGFNRTAVPLLVGTKFDMFYEMSDQEQLEITEQAKKYAQAMKAPLVFCSTAMGINVQKLFKIVLAKTFDLKLTIPELAATGEPILIYQQW---------------------------------------------------------------------------------'), Sequence(id='sequence158', source_id='KAI0099584.1', sequence='-----------------------------------------------------------------------------------------MHIPGHLP---------GES-SSSHEPHH--RQSQSLDQGL-----ANSAP-------------PLPDDIDPNAQYEA-HQYDPPQQPVQR-PASSMSS-TGERQY---------------------NEQ--ASRESNGA-DRNARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence159', source_id='KAI1801530.1', sequence='---------------------------------------------------------------------------------------------MHIA---------GEPGV--HEPHH--RQSRSLDQGL-----ANSAHADDIDTHAVDPHAIDPIAVDHNAQYEA-HSYEPPAQSMSR-PASS--SGTGERHL---------------------NGE--ASREGNGA-DRNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence160', source_id='KAF9351078.1', sequence='-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSD-------------------------TPESTKKGSGNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKTTLNSIKEWYRQARGFNKTAIPFLVGTKYDYFAMFSKEEQEEVTKQARKFARAMKAPLIFCSTAQSINVQKIFKIVLSKAFDLKCTIPEISESGAPILEYQSY---------------------------------------------------------------------------------'), Sequence(id='sequence161', source_id='KAF9160900.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MAATS-----------------------------ES--AKKSSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDYFSTFSKEEQEEVTKQARKFARAMKAPLIFCSTAHSINVQKIFKIVLSKAFDLKCTIPEISESGAPILEYATYCDRDRKKLTI-----------------------------------------------------------------------'), Sequence(id='sequence162', source_id='KAG0263740.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MAAAGD-------------------------SGKKS--SSPNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDYFSTFSKEEQEEVTKQARKFARAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTIPEISEAGAPILEYTDK---------------------------------------------------------------------------------'), Sequence(id='sequence163', source_id='KAI1135662.1', sequence='-----------------------------------------------MEQDPV----------A--APVPHDIHEDTI---------GGIEGSMHIP---------AEPSTSHEPHRH--RQSQSLDRGL-----ASSK---------------HPEDIDPNAQYDT-PQYDPPQQSMPR-PASS-SS-AGERHY---------------------AEQ--ASRESNGA-DRNARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence164', source_id='XP_045969802.1', sequence='---------------------------------------MTTTPP----PLEN----------NGSLPSHID----ID---------VA---------------------ATPRQEHY--TSSSD----------PSLAFSP---QDSNSPSRAN---IGDDQRHSG-TPPLSQSQLY--------GNGGGMNSFTSAAG------AA----------------AGGGQGAEAKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIEHVGEPLLLYQDVM--------------------------------------------------------------------------------'), Sequence(id='sequence165', source_id='KAI1414505.1', sequence='-----------------------------------------------------------------------------------------MHFSGE--------------PSSSHEPLH--RQSQSLDQGL-----ANSAHP-------------HPDDIDPNAQYEA-HQYDPPQQSMQR-PTSSMSS-GGERHY---------------------TEQ--APRESNGT-DRNARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence166', source_id='KAG0239750.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MATLGD-------------------------SGKKSSNSSHNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKATLNSIKEWYRQARGFNKTAIPFLVGTKYDYFTMFSKEEQEEVTKQARKFARAMKAPLIFCSTAQSINVQKIFKIVLSKAFDLKCTIPEINEAGAPILEYQSY---------------------------------------------------------------------------------'), Sequence(id='sequence167', source_id='XP_044688071.1', sequence='---------------------------------------MTTTPP----PPEN----------NGSLPSHID----VD---------VA---------------------ATPRQEHY--TS-SD----------PSLTFSP---QDSNSPSRAI-----GDERNSG-TPPLSQSQLY--------GNGGGMNNFTSAAA------------------------AAGGQGAEAKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIEHVGEPLLLYQDVM--------------------------------------------------------------------------------'), Sequence(id='sequence168', source_id='RPB01516.1', sequence='---------------------------------------MTTTPPLLFSPSP-------PPP-LPDSLYPDEPEEVTTPTA-TLPPPP------PSPPP----------RQPSPARHQ---HSGSAPA---------TVG-----------NF---GSPP------PNPPPPPQSLAYQQ-N--GAGTTPTQAHYGG-----------------------------GGAVDMGKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIEHVGEPLLLYQDV---------------------------------------------------------------------------------'), Sequence(id='sequence169', source_id='KAG0236582.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MAA-----------------------------SADS--ARRSSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDFFSTFSKEEQEEITKQARKFARAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTIPEISEPGAPILEYTS----------------------------------------------------------------------------------'), Sequence(id='sequence170', source_id='KAH6640987.1', sequence='MEQD-QAIS------PAYAVAPDSALA------------------PARIP--------------SPAGFPTDPHDDTL---------SGVESVTHQ---AVPDHH-IHEHNGFHE------Q-QHISQLQ-----PLDHNVT---NSPRSPYPTDTTDSEPTARYAT-PPIQ--APTISR-PPSGLSGQGAAYGAD--QVSRAG-----------------SNGAQAESSQSPGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNLSREEQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEITNVGEPLLIYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence171', source_id='XP_002493958.1', sequence='-----------------------------------------------------------------------------------------------------------------------------------------------------------------------MPDSPR-------------------RNQHRRS----------------------HSEQQNVPHSQRETNSVAVKIGLIGDAQIGKTSLMVKYVEGCYDENYTQTLGANFMERIINIRNTQITLSIWDLGGEKEFINMLPLVTTDAVVIIFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDLFIDLPDEDQIEITNQAKKYARAMSASLIFSSTSHSINIQKLFKVILSKVFDIKATIPEIVNTGEPLLLYQSI---------------------------------------------------------------------------------'), Sequence(id='sequence172', source_id='KAA8914877.1', sequence='---------------------------------------MTTTPPPSRTSTSDMDHSARTPS-SSSSSIPEEYIHTELRLAPS----LSSLQSPPTPDR----------GSPSRYHHS---HSNSATSAP----------------------------SDGASYYGGSPPA-MRDRD-RE-GYYGNGAGA-AGGSGGGAG--------------------SSA-YNMAEQQRTKQNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQEV---------------------------------------------------------------------------------'), Sequence(id='sequence173', source_id='XP_018701974.1', sequence='---------------------------------------METDDV--PAATLH----------D-----NLD----DT---------LG----GLDGSPQVPSSSHY--SNHHHDHQY--QNPHHSNN-------DTHEHEP---QSPG-GGPSH---HQ-QQHHDE-DPPC--TRY-TP-PAPGSS-APASAAPGSRAGSEMSNPSSSQQQHQAYGEYASSRQGSGEPAAPNGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPIQDQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence174', source_id='KAI2643608.1', sequence='---------------------------------------MEHDLHGAPVSGLE----------P--HAHHDD---DSL---------NDADEHSDI--------AS--SLNGHESYHQ---PSQSLDYVL-----SHG---------------QDTDEADPNSQYET-QPTTSQPQSISR-PPSGLSGAGGDRQTA------------------------HSDRGSNGADQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence175', source_id='KAG0125076.1', sequence='---------------------------------------MTTTPPPLFSPSP-------PPP-LPDSLCPDDPEEVTTPTS-NLPPPP-----LPSPPP----------RQPSPVRHH---HSGPAPA---------AVG-----------NF---GSPP------PNPPPPPQSLAYQQ-N--GAGTTPTQAHYGS-----------------------------GGAVDLGKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIEHVGEPLLLYQDV---------------------------------------------------------------------------------'), Sequence(id='sequence176', source_id='KAH9904989.1', sequence='---------------------------------------MEQDPV--------------------AAAVPQDGYDDTLG---------GIEGSPHVGPT----------QINREKRHQ---QSQSLDNGL-----P-NNG-----------HA---DEIDPNARYDTPPN-PLQPHSISR-PPSGLS-GAGDRHNAYSDH--------------------ASR-GSNGAEQNNGRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQARRFAKAMRAPLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence177', source_id='VEU24358.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------MDNRSVSTRIPRSHSTSEALSEEPARSVSSTV--DGYDNYY-----------GHQH---HHAHRHRYGEEERQSAEKNTVTIKVGLIGDAQVGKTSLMVKYVENCFDEIYTQTLGVNFMERTIRIKNTEITFSIWDLGGEAEFTNMLPLVASDAVAVLFMFDLSRKSTLNSVKDWYRQARGFNRTAIPFLVGTKYDLFVDLPDEEQEEITRQARKYAKAMNAPLIFSSTCASINIQKIFKIVISKTFDLRLKIPEIVNTGEPILLYQNV---------------------------------------------------------------------------------'), Sequence(id='sequence178', source_id='KAI1283572.1', sequence='------------------------------------MDTMEQDFHAAPIPGPH----------E--HLD--EPLPDTF---------ADVEGGPHV--------SP--SQNGHEVYHHHHQQSQSLDHGL-----ASS---------------QNHDEADLNGRYET-PPSTAHPQSISR-PPSGLS--GGDRQTA------------------------YSDRGSNGADQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence179', source_id='KAI1500557.1', sequence='--------------------------------------MMEHDPAFATAPGPH----------N-----GIDD--------------------MLGGIEGSPTLASG--QNGHETYHH--HHSQSFDQ-------E----IP---LN---ENPDD---MDTTAQYDT-PPVTAQPQSISR-PPSALD-GAAGER-----------------------HASNGDRGSNGADYNNTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENIGEPLLLYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence180', source_id='KAI2623093.1', sequence='---------------------------------------MDQDPITTPVQAPA----------Q--DPTPHELHEDTF---------GGIEGSMHLS---------GEPGT--PEAHH--RQSQSLDQGL-----ANSV---------------HPDEVDPNTQYEA-HQYDAPPQSMPR-PASSMSG-AGERQY---------------------PEH--ASRESNGA-DRNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence181', source_id='NP_593285.1', sequence='-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MADARKNNVTIKVGMIGDSSIGKTSLMVTYVQGSFDEESTQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPMVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAVPILIGTKYDHFMTFPREDQEEITKQARRYAKAMKASLVFCSTSHSINVQKIFKIVLAKVFDLKCTIPEIKNVGDPILEYIDR---------------------------------------------------------------------------------'), Sequence(id='sequence182', source_id='KAI0431960.1', sequence='------------------------------------MDTMEQDFHAAPIPGPH----------E--HLD--ETLPDTL---------ADVEGAPHV--------SP--SQNGHEVYHHH-QQSHSLDQGL-----ANS---------------QTSDEPDLNGRYET-PPSTGHAQSISR-PPSGLS--GGDRQTA------------------------YSDRGSNGADQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence183', source_id='KAH8926511.1', sequence='-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSDSAGP-----LALE-----KGGAEAGEKNSVVLKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLIGTKYDHFSNFSRDEQEEITRQSRRFARAMKAPLIFCSTSHSINVQKIFKIVLSKSFDLKCTIPEITDVGEPMLIYIDV---------------------------------------------------------------------------------'), Sequence(id='sequence184', source_id='RMJ24013.1', sequence='-----------------------------------------MNPS-------------------------------YH---------NGYSSDSHA--QYSTGPAGF--NPPVHDS-----TSQDAEQ-------TRLTFSP---SI---------------TQQPQ-PPSL---SRPS---SAFSS-GPERHG-------------------------ASQQHHETSQRAQPAKNSVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLIGTKYDHFVNFPREDQEEISVQAKRFAKAMKASLIFSSTSHSINVQKIFKIVLAKAFDLKCTIPEIENVGEPLLLYKSV---------------------------------------------------------------------------------'), Sequence(id='sequence185', source_id='KAF8931046.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MAATG-----------------------------ES--AKKSSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDYFSTFSKEEQEEVTKQARKFARAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTIPEISEAGAPILEYASN---------------------------------------------------------------------------------'), Sequence(id='sequence186', source_id='ODQ76250.1', sequence='-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSS------AA----------------PNGSDGSVARKNAVVIKVGMIGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRDTEITFSIWDLGGQREFVNMLPLVSNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDTFAQFPREDQEEITKQARRFAKVMKASLIFCSTSHSINIQKIFKIVLSKAFELKCVIPEIATIGDPILLYHDV---------------------------------------------------------------------------------'), Sequence(id='sequence187', source_id='KXJ93426.1', sequence='---------------------------------------MDQEPAAL------------PPTRNPLDVAPDD----TL---------GGIESSPRVYSD----------PESTIRTHH---HSQSLDQGL-----ASSAH-----------YQHNSEDMD-HQTRQDTPPIPQQPQSISR-PPSGLSGAGDRQPAQYSDH--------------------ASRSSGGQPEPQNGRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFPREDQEEISNQARRFAKAMRAPLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence188', source_id='XP_051368163.1', sequence='---------------------------------------MDQDLLG-----------------T--PTAPHDTLDDAL---------AGVEGPLHLA---------SESGN--LEPHH--RQSQSLDRGL-----ANNAQVDDF---------------DTAVPFDS-PQYDTPPPAMQR-PASSD-SAAGEKQL---------------------AEH--ASREANGADRNNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence189', source_id='GES63634.1', sequence='-------METIHNL--NTGV-SEPVEQQP------QESAFEASPVSHPAGSTD----------E-----PTSASVYHR---------SGYNSDSHA--QYSSLA----------------------------------------------------------THQPQ-PP------TSSR-PSSGLS-GPERYGP----------------------SQEVTQKQPSQPPSSQTKNSVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLVGTKYDHFVNFPREDQEEISIQAKRFAKAMKASLIFSSTSHSINVQKIFKIVLAKAFDLKCTIPEIENIGEPLLLYKNV---------------------------------------------------------------------------------'), Sequence(id='sequence190', source_id='RPA74746.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------M---------------ADHHE-GSSH---SYDR---TSHSS-RP-------------------------------ATAEKQPAPKEETKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLIGTKYDHYVNFPIEDQEEISKQAKRFAKAMKASLIFSSTSHSINIQKIFKIVLSKAFDLKCTIPEITEIGEPLLLYQDV---------------------------------------------------------------------------------'), Sequence(id='sequence191', source_id='XP_024675402.1', sequence='-------MDTPQPSDPLAGVAPERHEQHPQPQSAPQQSQYPVNPA-GPYPSHV----------ESVPPEVIPSASTYH---------AGYSSDSHAN--YSSNAVDF--NS--------------------------GSEYP---PQPRAELPRA---QEAVPSMMH-PPAA---PSSSR-PSSGLSSGPDRL-----------------------GSVQSGQELPQKQPIPSNKNSVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLVGTKYDHFVNFPREDQEEISIQAKRFAKAMKASLIFSSTSHSINVQKIFKIVLAKAFDLKCTIPEIENIGEPLLLYKNL---------------------------------------------------------------------------------'), Sequence(id='sequence192', source_id='KAH6850716.1', sequence='MEQE-QAFN------PAYTMAPDPALA------------------PAPIPAPI----------SSPVGLPTDPHDDTL---------SGVESVTHQ---ALPDHN-IHDHNGFHE------Q-QHLVQLQ-----PLDHSVN---NSPRSPYPTDTTDSEPTARYAT-PPIP--APTISR-PPSGLSGQGAAYGAD--QVSRAG-----------------SNGAQAESSQSPGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNLSREEQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEITNVGEPLLIYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence193', source_id='PHH71636.1', sequence='---------------------------------------MEHQQPE-LDQ--Q----------PPPLHAAHDSLDDTL---------GGIEGSPHVAA----------ANNGFHQ------QSQSLDSAV-----P---------NSPR--------YDDDAANRHT-P-PVSSAPSLSR-PGSQMS-----------------NPSSSNPPQQMHG----NDHRQGSNEPPNGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPPQDQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQNV---------------------------------------------------------------------------------'), Sequence(id='sequence194', source_id='KAJ3562589.1', sequence='------------------------------------MDTMEQDLHTTPIPGVH----------E--HHHLDDALPDPH---------ADVDARPHS--------AP--GQNGHEVYH---QQSHSLDQGI-----AHG---------------QHPDEADLNGRYDT-PPSATHPQSISR-PPSGLSGAGGDRQTT------------------------YSDRGSNGTDQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQQTV--------------------------------------------------------------------------------'), Sequence(id='sequence195', source_id='RDA84390.1', sequence='---------------------------------------MDHQPAA-DQEQPQ----------ELPRPASHDGLDDTL---------GGIEGSPHPVA----------SSNGFHA------HQ-----EA-----P---------GSPR--------YDDDNAARQT-P-PVSA--PLSR-PGSQMS-----------------N-----PPQHASG----SDYRQGSNEPPNGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPPQDQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQNV---------------------------------------------------------------------------------'), Sequence(id='sequence196', source_id='XP_007413704.1', sequence='----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSNMTSSTGP-----AGSSGSTSNSSLQQNDDKNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLIGTKYDHFAAFSKDEQEEITRQSRRFAKAMRAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTIPEINGSGEPLLIYLDV---------------------------------------------------------------------------------'), Sequence(id='sequence197', source_id='KAI0376630.1', sequence='---------------------------------------------------------------------------------------------MHLP---------NEPHN--HETHH--RQSQSLDQGL-----ANNV---------------HPDDVDPNAQYEA-HQYDQPSQSVPR-PASSMSSTGGERQY---------------------SDQ--AARESNGAADRNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence198', source_id='XP_047831721.1', sequence='---------------------------------------MEQDFHTAPIPGPR----------E--HLDALPDTHDTH---------ADVVARPHT--------AP--DQNGHEVYH---QQSQSLDQGL-----SDS---------------QHHDDADVAGRYET-HPSTTHPQSISR-PPSGLSGAGGDRQAT------------------------YSDRGSNGTDQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISSQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence199', source_id='KAI9294962.1', sequence='-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MAEEGKNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQHEFVNMLPLVCNDAVAILFMFDLSRKATLNSIKEWYRQARGFNKTAMPFLVGTKYDHFASFNREEQEEITKQARKFAKAMRAPLIFCSTSHSINVQKVFKVVLSKAFDLKCTIPEISDIGAPILEYEVGSE-------------------------------------------------------------------------------')], standard_numberings=[StandardNumbering(id='standardnumbering0', reference_id='BAH60832.1', numbered_id='CAI4663910.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '9.213', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222.425', '223.426', '224.427', '225.428', '226.429', '227.430', '228.431', '229.432', '230', '231', '232.433', '233.434', '234.435', '235.436', '236.437', '237.438', '237.439', '238.440', '239.441', '240.442', '241.443', '242', '243', '243.444', '243.445', '243.446', '243.447', '243.448', '243.449', '243.450', '243.451', '243.452', '244', '245', '246', '247', '248', '249', '250', '251', '252.453', '253.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486', '254.487', '254.488']), StandardNumbering(id='standardnumbering1', reference_id='BAH60832.1', numbered_id='EJT44931.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '9.213', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222.425', '223.426', '224.427', '225.428', '226.429', '227.430', '228.431', '229.432', '230', '231', '232.433', '233.434', '234.435', '235.436', '236.437', '237.438', '237.439', '238.440', '239.441', '240.442', '241.443', '242', '243', '243.444', '243.445', '243.446', '243.447', '243.448', '243.449', '243.450', '243.451', '243.452', '244', '245', '246', '247', '248', '249', '250', '251', '252.453', '253.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486', '254.487', '254.488']), StandardNumbering(id='standardnumbering2', reference_id='BAH60832.1', numbered_id='XP_037139093.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9.212', '10.213', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222.425', '223.426', '224.427', '225.428', '226.429', '227.430', '228.431', '229.432', '230.433', '231', '232', '233.434', '234.435', '235.436', '236.437', '237.438', '237.439', '238.440', '239.441', '240.442', '241', '242', '243', '243.443', '243.444', '243.445', '243.446', '243.447', '243.448', '243.449', '243.450', '243.451', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484']), StandardNumbering(id='standardnumbering3', reference_id='BAH60832.1', numbered_id='XP_003680887.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11.212', '12.213', '13.214', '14.215', '15.216', '16.217', '17.218', '18.219', '19.220', '20.221', '21.222', '22.223', '23.224', '24.225', '25.226', '26.227', '27.228', '28.229', '29.230', '30.231', '31.232', '32.233', '33.234', '34.235', '35.236', '36.237', '37.238', '38.239', '39.240', '40.241', '41.242', '42.243', '43.244', '44.245', '45.246', '46.247', '47.248', '48.249', '49.250', '50.251', '51.252', '52.253', '53.254', '54.255', '55.256', '56.257', '57.258', '58.259', '59.260', '60.261', '61.262', '62.263', '63.264', '64.265', '65.266', '66.267', '67.268', '68.269', '69.270', '70.271', '71.272', '72.273', '73.274', '74.275', '75.276', '76.277', '77.278', '78.279', '79.280', '80.281', '81.282', '82.283', '83.284', '84.285', '85.286', '86.287', '87.288', '88.289', '89.290', '90.291', '91.292', '92.293', '93.294', '94.295', '95.296', '96.297', '97.298', '98.299', '99.300', '100.301', '101.302', '102.303', '103.304', '104.305', '105.306', '106.307', '107.308', '108.309', '109.310', '110.311', '111.312', '112.313', '113.314', '114.315', '115.316', '116.317', '117.318', '118.319', '119.320', '120.321', '121.322', '122.323', '123.324', '124.325', '125.326', '126.327', '127.328', '128.329', '129.330', '130.331', '131.332', '132.333', '133.334', '134.335', '135.336', '136.337', '137.338', '138.339', '139.340', '140.341', '141.342', '142.343', '143.344', '144.345', '145.346', '146.347', '147.348', '148.349', '149.350', '150.351', '151.352', '152.353', '153.354', '154.355', '155.356', '156.357', '157.358', '158.359', '159.360', '160.361', '161.362', '162.363', '163.364', '164.365', '165.366', '166.367', '167.368', '168.369', '169.370', '170.371', '171.372', '172.373', '173.374', '174.375', '175.376', '176.377', '177.378', '178.379', '179.380', '180.381', '181.382', '182.383', '183.384', '184.385', '185.386', '186.387', '187.388', '188.389', '189.390', '190.391', '191.392', '192.393', '193.394', '194.395', '195.396', '196.397', '197.398', '198.399', '199.400', '200.401', '201.402', '202.403', '203.404', '204.405', '205.406', '206.407', '207.408', '208.409', '209.410', '210.411', '211.412', '212.413', '213.414', '214.415', '215.416', '216.417', '217.418', '218.419', '219.420', '220.421', '221.422', '222.423', '223.424', '224.425', '225.426', '226.427', '227.428', '228.429', '229.430', '230.431', '231', '232', '233.432', '234.433', '235.434', '236.435', '237.436', '237.437', '238.438', '239.439', '240.440', '241', '242', '243', '243.441', '243.442', '243.443', '243.444', '243.445', '243.446', '243.447', '243.448', '243.449', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482']), StandardNumbering(id='standardnumbering4', reference_id='BAH60832.1', numbered_id='XP_037144827.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1.181', '2.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '3.195', '4.196', '5.197', '5.198', '5.199', '5.200', '5.201', '5.202', '6.203', '7.204', '7.205', '7.206', '7.207', '7.208', '7.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '8.217', '8.218', '8.219', '9.220', '10.221', '11.222', '12.223', '13.224', '14.225', '15.226', '16.227', '17.228', '18.229', '19.230', '20.231', '21.232', '22.233', '23.234', '24.235', '25.236', '26.237', '27.238', '28.239', '29.240', '30.241', '31.242', '32.243', '33.244', '34.245', '35.246', '36.247', '37.248', '38.249', '39.250', '40.251', '41.252', '42.253', '43.254', '44.255', '45.256', '46.257', '47.258', '48.259', '49.260', '50.261', '51.262', '52.263', '53.264', '54.265', '55.266', '56.267', '57.268', '58.269', '59.270', '60.271', '61.272', '62.273', '63.274', '64.275', '65.276', '66.277', '67.278', '68.279', '69.280', '70.281', '71.282', '72.283', '73.284', '74.285', '75.286', '76.287', '77.288', '78.289', '79.290', '80.291', '81.292', '82.293', '83.294', '84.295', '85.296', '86.297', '87.298', '88.299', '89.300', '90.301', '91.302', '92.303', '93.304', '94.305', '95.306', '96.307', '97.308', '98.309', '99.310', '100.311', '101.312', '102.313', '103.314', '104.315', '105.316', '106.317', '107.318', '108.319', '109.320', '110.321', '111.322', '112.323', '113.324', '114.325', '115.326', '116.327', '117.328', '118.329', '119.330', '120.331', '121.332', '122.333', '123.334', '124.335', '125.336', '126.337', '127.338', '128.339', '129.340', '130.341', '131.342', '132.343', '133.344', '134.345', '135.346', '136.347', '137.348', '138.349', '139.350', '140.351', '141.352', '142.353', '143.354', '144.355', '145.356', '146.357', '147.358', '148.359', '149.360', '150.361', '151.362', '152.363', '153.364', '154.365', '155.366', '156.367', '157.368', '158.369', '159.370', '160.371', '161.372', '162.373', '163.374', '164.375', '165.376', '166.377', '167.378', '168.379', '169.380', '170.381', '171.382', '172.383', '173.384', '174.385', '175.386', '176.387', '177.388', '178.389', '179.390', '180.391', '181.392', '182.393', '183.394', '184.395', '185.396', '186.397', '187.398', '188.399', '189.400', '190.401', '191.402', '192.403', '193.404', '194.405', '195.406', '196.407', '197.408', '198.409', '199.410', '200.411', '201.412', '202.413', '203.414', '204.415', '205.416', '206.417', '207.418', '208.419', '209.420', '210.421', '211.422', '212.423', '213.424', '214.425', '215.426', '216.427', '217.428', '218.429', '219.430', '220.431', '221.432', '222.433', '223.434', '224.435', '225.436', '226.437', '227.438', '228.439', '229.440', '230.441', '231', '232', '233.442', '234.443', '235.444', '236.445', '237.446', '237.447', '238.448', '239.449', '240.450', '241.451', '242', '243', '243.452', '243.453', '243.454', '243.455', '243.456', '243.457', '243.458', '243.459', '243.460', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486', '254.487', '254.488', '254.489', '254.490', '254.491', '254.492', '254.493']), StandardNumbering(id='standardnumbering5', reference_id='BAH60832.1', numbered_id='AQZ18344.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9.212', '10.213', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222.425', '223.426', '224.427', '225.428', '226.429', '227.430', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.431', '238', '239', '240', '241', '242', '243', '243.432', '243.433', '243.434', '243.435', '243.436', '243.437', '243.438', '243.439', '243.440', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473']), StandardNumbering(id='standardnumbering6', reference_id='BAH60832.1', numbered_id='XP_002495560.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1.181', '2.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '3.195', '4.196', '5.197', '5.198', '5.199', '5.200', '5.201', '5.202', '6.203', '7.204', '7.205', '7.206', '7.207', '7.208', '7.209', '8', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '8.217', '8.218', '9.219', '10.220', '11.221', '12.222', '13.223', '14.224', '15.225', '16.226', '17.227', '18.228', '19.229', '20.230', '21.231', '22.232', '23.233', '24.234', '25.235', '26.236', '27.237', '28.238', '29.239', '30.240', '31.241', '32.242', '33.243', '34.244', '35.245', '36.246', '37.247', '38.248', '39.249', '40.250', '41.251', '42.252', '43.253', '44.254', '45.255', '46.256', '47.257', '48.258', '49.259', '50.260', '51.261', '52.262', '53.263', '54.264', '55.265', '56.266', '57.267', '58.268', '59.269', '60.270', '61.271', '62.272', '63.273', '64.274', '65.275', '66.276', '67.277', '68.278', '69.279', '70.280', '71.281', '72.282', '73.283', '74.284', '75.285', '76.286', '77.287', '78.288', '79.289', '80.290', '81.291', '82.292', '83.293', '84.294', '85.295', '86.296', '87.297', '88.298', '89.299', '90.300', '91.301', '92.302', '93.303', '94.304', '95.305', '96.306', '97.307', '98.308', '99.309', '100.310', '101.311', '102.312', '103.313', '104.314', '105.315', '106.316', '107.317', '108.318', '109.319', '110.320', '111.321', '112.322', '113.323', '114.324', '115.325', '116.326', '117.327', '118.328', '119.329', '120.330', '121.331', '122.332', '123.333', '124.334', '125.335', '126.336', '127.337', '128.338', '129.339', '130.340', '131.341', '132.342', '133.343', '134.344', '135.345', '136.346', '137.347', '138.348', '139.349', '140.350', '141.351', '142.352', '143.353', '144.354', '145.355', '146.356', '147.357', '148.358', '149.359', '150.360', '151.361', '152.362', '153.363', '154.364', '155.365', '156.366', '157.367', '158.368', '159.369', '160.370', '161.371', '162.372', '163.373', '164.374', '165.375', '166.376', '167.377', '168.378', '169.379', '170.380', '171.381', '172.382', '173.383', '174.384', '175.385', '176.386', '177.387', '178.388', '179.389', '180.390', '181.391', '182.392', '183.393', '184.394', '185.395', '186.396', '187.397', '188.398', '189.399', '190.400', '191.401', '192.402', '193.403', '194.404', '195.405', '196.406', '197.407', '198.408', '199.409', '200.410', '201.411', '202.412', '203.413', '204.414', '205.415', '206.416', '207.417', '208.418', '209.419', '210.420', '211.421', '212.422', '213.423', '214.424', '215.425', '216.426', '217.427', '218.428', '219.429', '220.430', '221.431', '222.432', '223.433', '224.434', '225.435', '226.436', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.437', '238', '239', '240', '241', '242', '243', '243.438', '243.439', '243.440', '243.441', '243.442', '243.443', '243.444', '243.445', '243.446', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479']), StandardNumbering(id='standardnumbering7', reference_id='BAH60832.1', numbered_id='XP_003673548.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9.212', '10.213', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222.425', '223.426', '224.427', '225.428', '226.429', '227.430', '228.431', '229.432', '230.433', '231.434', '232.435', '233.436', '234', '235', '236', '237', '237.437', '238', '239', '240', '241', '242', '243', '243.438', '243.439', '243.440', '243.441', '243.442', '243.443', '243.444', '243.445', '243.446', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479']), StandardNumbering(id='standardnumbering8', reference_id='BAH60832.1', numbered_id='XP_003958955.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9.212', '10.213', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222.425', '223.426', '224.427', '225.428', '226.429', '227.430', '228.431', '229.432', '230.433', '231.434', '232.435', '233.436', '234.437', '235', '236.438', '237.439', '237.440', '238', '239', '240', '241', '242', '243', '243.441', '243.442', '243.443', '243.444', '243.445', '243.446', '243.447', '243.448', '243.449', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482']), StandardNumbering(id='standardnumbering9', reference_id='BAH60832.1', numbered_id='XP_001644471.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14', '15.212', '16.213', '17.214', '18.215', '19.216', '20.217', '21.218', '22.219', '23.220', '24.221', '25.222', '26.223', '27.224', '28.225', '29.226', '30.227', '31.228', '32.229', '33.230', '34.231', '35.232', '36.233', '37.234', '38.235', '39.236', '40.237', '41.238', '42.239', '43.240', '44.241', '45.242', '46.243', '47.244', '48.245', '49.246', '50.247', '51.248', '52.249', '53.250', '54.251', '55.252', '56.253', '57.254', '58.255', '59.256', '60.257', '61.258', '62.259', '63.260', '64.261', '65.262', '66.263', '67.264', '68.265', '69.266', '70.267', '71.268', '72.269', '73.270', '74.271', '75.272', '76.273', '77.274', '78.275', '79.276', '80.277', '81.278', '82.279', '83.280', '84.281', '85.282', '86.283', '87.284', '88.285', '89.286', '90.287', '91.288', '92.289', '93.290', '94.291', '95.292', '96.293', '97.294', '98.295', '99.296', '100.297', '101.298', '102.299', '103.300', '104.301', '105.302', '106.303', '107.304', '108.305', '109.306', '110.307', '111.308', '112.309', '113.310', '114.311', '115.312', '116.313', '117.314', '118.315', '119.316', '120.317', '121.318', '122.319', '123.320', '124.321', '125.322', '126.323', '127.324', '128.325', '129.326', '130.327', '131.328', '132.329', '133.330', '134.331', '135.332', '136.333', '137.334', '138.335', '139.336', '140.337', '141.338', '142.339', '143.340', '144.341', '145.342', '146.343', '147.344', '148.345', '149.346', '150.347', '151.348', '152.349', '153.350', '154.351', '155.352', '156.353', '157.354', '158.355', '159.356', '160.357', '161.358', '162.359', '163.360', '164.361', '165.362', '166.363', '167.364', '168.365', '169.366', '170.367', '171.368', '172.369', '173.370', '174.371', '175.372', '176.373', '177.374', '178.375', '179.376', '180.377', '181.378', '182.379', '183.380', '184.381', '185.382', '186.383', '187.384', '188.385', '189.386', '190.387', '191.388', '192.389', '193.390', '194.391', '195.392', '196.393', '197.394', '198.395', '199.396', '200.397', '201.398', '202.399', '203.400', '204.401', '205.402', '206.403', '207.404', '208.405', '209.406', '210.407', '211.408', '212.409', '213.410', '214.411', '215.412', '216.413', '217.414', '218.415', '219.416', '220.417', '221.418', '222.419', '223.420', '224.421', '225.422', '226.423', '227.424', '228.425', '229.426', '230', '231', '232.427', '233.428', '234.429', '235', '236', '237', '237.430', '238', '239', '240', '241.431', '242', '243', '243.432', '243.433', '243.434', '243.435', '243.436', '243.437', '243.438', '243.439', '243.440', '244', '245', '246', '247', '248', '249', '250', '251', '252.441', '253.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476']), StandardNumbering(id='standardnumbering10', reference_id='BAH60832.1', numbered_id='XP_003684279.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1.181', '2.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '3.195', '4.196', '5.197', '5.198', '5.199', '5.200', '5.201', '5.202', '6.203', '7.204', '7.205', '7.206', '7.207', '7.208', '7.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '8.217', '8.218', '8.219', '9.220', '10', '11.221', '12.222', '13.223', '14.224', '15.225', '16.226', '17.227', '18.228', '19.229', '20.230', '21.231', '22.232', '23.233', '24.234', '25.235', '26.236', '27.237', '28.238', '29.239', '30.240', '31.241', '32.242', '33.243', '34.244', '35.245', '36.246', '37.247', '38.248', '39.249', '40.250', '41.251', '42.252', '43.253', '44.254', '45.255', '46.256', '47.257', '48.258', '49.259', '50.260', '51.261', '52.262', '53.263', '54.264', '55.265', '56.266', '57.267', '58.268', '59.269', '60.270', '61.271', '62.272', '63.273', '64.274', '65.275', '66.276', '67.277', '68.278', '69.279', '70.280', '71.281', '72.282', '73.283', '74.284', '75.285', '76.286', '77.287', '78.288', '79.289', '80.290', '81.291', '82.292', '83.293', '84.294', '85.295', '86.296', '87.297', '88.298', '89.299', '90.300', '91.301', '92.302', '93.303', '94.304', '95.305', '96.306', '97.307', '98.308', '99.309', '100.310', '101.311', '102.312', '103.313', '104.314', '105.315', '106.316', '107.317', '108.318', '109.319', '110.320', '111.321', '112.322', '113.323', '114.324', '115.325', '116.326', '117.327', '118.328', '119.329', '120.330', '121.331', '122.332', '123.333', '124.334', '125.335', '126.336', '127.337', '128.338', '129.339', '130.340', '131.341', '132.342', '133.343', '134.344', '135.345', '136.346', '137.347', '138.348', '139.349', '140.350', '141.351', '142.352', '143.353', '144.354', '145.355', '146.356', '147.357', '148.358', '149.359', '150.360', '151.361', '152.362', '153.363', '154.364', '155.365', '156.366', '157.367', '158.368', '159.369', '160.370', '161.371', '162.372', '163.373', '164.374', '165.375', '166.376', '167.377', '168.378', '169.379', '170.380', '171.381', '172.382', '173.383', '174.384', '175.385', '176.386', '177.387', '178.388', '179.389', '180.390', '181.391', '182.392', '183.393', '184.394', '185.395', '186.396', '187.397', '188.398', '189.399', '190.400', '191.401', '192.402', '193.403', '194.404', '195.405', '196.406', '197.407', '198.408', '199.409', '200.410', '201.411', '202.412', '203.413', '204.414', '205.415', '206.416', '207.417', '208.418', '209.419', '210.420', '211.421', '212.422', '213.423', '214.424', '215.425', '216.426', '217.427', '218.428', '219.429', '220.430', '221.431', '222.432', '223.433', '224.434', '225.435', '226.436', '227.437', '228.438', '229.439', '230.440', '231.441', '232.442', '233.443', '234.444', '235.445', '236.446', '237.447', '237.448', '238.449', '239.450', '240.451', '241.452', '242.453', '243.454', '243.455', '243.456', '243.457', '243.458', '243.459', '243.460', '243.461', '243.462', '243.463', '244.464', '245.465', '246.466', '247.467', '248.468', '249.469', '250.470', '251.471', '252.472', '253.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486', '254.487', '254.488', '254.489', '254.490', '254.491', '254.492', '254.493', '254.494', '254.495', '254.496', '254.497', '254.498', '254.499', '254.500', '254.501', '254.502', '254.503', '254.504', '254.505', '254.506', '254.507']), StandardNumbering(id='standardnumbering11', reference_id='BAH60832.1', numbered_id='SMN18735.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10.212', '11.213', '12.214', '13.215', '14.216', '15.217', '16.218', '17.219', '18.220', '19.221', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217.419', '218.420', '219.421', '220.422', '221.423', '222.424', '223.425', '224.426', '225.427', '226.428', '227.429', '228.430', '229.431', '230.432', '231.433', '232.434', '233.435', '234.436', '235.437', '236.438', '237.439', '237.440', '238', '239', '240.441', '241.442', '242.443', '243.444', '243.445', '243.446', '243.447', '243.448', '243.449', '243.450', '243.451', '243.452', '243.453', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486']), StandardNumbering(id='standardnumbering12', reference_id='BAH60832.1', numbered_id='CAD1779387.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10.212', '11.213', '12.214', '13.215', '14.216', '15.217', '16.218', '17.219', '18.220', '19.221', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217.419', '218.420', '219.421', '220.422', '221.423', '222.424', '223.425', '224.426', '225.427', '226.428', '227.429', '228.430', '229.431', '230.432', '231.433', '232.434', '233.435', '234.436', '235.437', '236.438', '237.439', '237.440', '238', '239', '240.441', '241.442', '242.443', '243.444', '243.445', '243.446', '243.447', '243.448', '243.449', '243.450', '243.451', '243.452', '243.453', '244.454', '245.455', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486', '254.487', '254.488']), StandardNumbering(id='standardnumbering13', reference_id='BAH60832.1', numbered_id='KAG0666170.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10.212', '11.213', '12.214', '13.215', '14.216', '15.217', '16.218', '17.219', '18.220', '19.221', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217.419', '218.420', '219.421', '220.422', '221.423', '222.424', '223.425', '224.426', '225.427', '226.428', '227.429', '228.430', '229.431', '230.432', '231.433', '232.434', '233.435', '234.436', '235.437', '236.438', '237.439', '237.440', '238.441', '239.442', '240.443', '241.444', '242.445', '243.446', '243.447', '243.448', '243.449', '243.450', '243.451', '243.452', '243.453', '243.454', '243.455', '244.456', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486', '254.487', '254.488', '254.489']), StandardNumbering(id='standardnumbering14', reference_id='BAH60832.1', numbered_id='XP_022464898.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10.212', '11.213', '12.214', '13.215', '14.216', '15.217', '16.218', '17.219', '18.220', '19.221', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217.419', '218.420', '219.421', '220.422', '221.423', '222.424', '223.425', '224.426', '225.427', '226.428', '227.429', '228.430', '229.431', '230.432', '231.433', '232.434', '233.435', '234.436', '235.437', '236.438', '237.439', '237.440', '238.441', '239.442', '240.443', '241.444', '242.445', '243.446', '243.447', '243.448', '243.449', '243.450', '243.451', '243.452', '243.453', '243.454', '243.455', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486', '254.487', '254.488']), StandardNumbering(id='standardnumbering15', reference_id='BAH60832.1', numbered_id='XP_003669861.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9.212', '10.213', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222.425', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.426', '238', '239', '240', '241', '242', '243', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468']), StandardNumbering(id='standardnumbering16', reference_id='BAH60832.1', numbered_id='XP_003678517.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217.422', '218.423', '219.424', '220.425', '221.426', '222.427', '223.428', '224.429', '225.430', '226.431', '227.432', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.433', '238', '239', '240', '241', '242', '243', '243.434', '243.435', '243.436', '243.437', '243.438', '243.439', '243.440', '243.441', '243.442', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475']), StandardNumbering(id='standardnumbering17', reference_id='BAH60832.1', numbered_id='KAG0659075.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9.212', '10.213', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222.425', '223.426', '224.427', '225.428', '226.429', '227.430', '228.431', '229.432', '230.433', '231.434', '232.435', '233.436', '234.437', '235.438', '236.439', '237.440', '237.441', '238.442', '239', '240', '241', '242', '243', '243.443', '243.444', '243.445', '243.446', '243.447', '243.448', '243.449', '243.450', '243.451', '244.452', '245.453', '246.454', '247.455', '248.456', '249.457', '250.458', '251.459', '252.460', '253.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486', '254.487', '254.488', '254.489', '254.490', '254.491', '254.492', '254.493', '254.494', '254.495']), StandardNumbering(id='standardnumbering18', reference_id='BAH60832.1', numbered_id='XP_451758.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13.212', '14.213', '15.214', '16.215', '17.216', '18.217', '19.218', '20.219', '21.220', '22.221', '23.222', '24.223', '25.224', '26.225', '27.226', '28.227', '29.228', '30.229', '31.230', '32.231', '33.232', '34.233', '35.234', '36.235', '37.236', '38.237', '39.238', '40.239', '41.240', '42.241', '43.242', '44.243', '45.244', '46.245', '47.246', '48.247', '49.248', '50.249', '51.250', '52.251', '53.252', '54.253', '55.254', '56.255', '57.256', '58.257', '59.258', '60.259', '61.260', '62.261', '63.262', '64.263', '65.264', '66.265', '67.266', '68.267', '69.268', '70.269', '71.270', '72.271', '73.272', '74.273', '75.274', '76.275', '77.276', '78.277', '79.278', '80.279', '81.280', '82.281', '83.282', '84.283', '85.284', '86.285', '87.286', '88.287', '89.288', '90.289', '91.290', '92.291', '93.292', '94.293', '95.294', '96.295', '97.296', '98.297', '99.298', '100.299', '101.300', '102.301', '103.302', '104.303', '105.304', '106.305', '107.306', '108.307', '109.308', '110.309', '111.310', '112.311', '113.312', '114.313', '115.314', '116.315', '117.316', '118.317', '119.318', '120.319', '121.320', '122.321', '123.322', '124.323', '125.324', '126.325', '127.326', '128.327', '129.328', '130.329', '131.330', '132.331', '133.332', '134.333', '135.334', '136.335', '137.336', '138.337', '139.338', '140.339', '141.340', '142.341', '143.342', '144.343', '145.344', '146.345', '147.346', '148.347', '149.348', '150.349', '151.350', '152.351', '153.352', '154.353', '155.354', '156.355', '157.356', '158.357', '159.358', '160.359', '161.360', '162.361', '163.362', '164.363', '165.364', '166.365', '167.366', '168.367', '169.368', '170.369', '171.370', '172.371', '173.372', '174.373', '175.374', '176.375', '177.376', '178.377', '179.378', '180.379', '181.380', '182.381', '183.382', '184.383', '185.384', '186.385', '187.386', '188.387', '189.388', '190.389', '191.390', '192.391', '193.392', '194.393', '195.394', '196.395', '197.396', '198.397', '199.398', '200.399', '201.400', '202.401', '203.402', '204.403', '205.404', '206.405', '207.406', '208.407', '209.408', '210.409', '211.410', '212.411', '213.412', '214.413', '215.414', '216.415', '217.416', '218.417', '219.418', '220.419', '221.420', '222.421', '223.422', '224.423', '225', '226.424', '227.425', '228.426', '229.427', '230.428', '231', '232', '233', '234', '235', '236.429', '237.430', '237.431', '238.432', '239.433', '240.434', '241', '242', '243', '243.435', '243.436', '243.437', '243.438', '243.439', '243.440', '243.441', '243.442', '243.443', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476']), StandardNumbering(id='standardnumbering19', reference_id='BAH60832.1', numbered_id='NP_984991.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14.212', '15.213', '16.214', '17.215', '18.216', '19.217', '20.218', '21.219', '22.220', '23.221', '24.222', '25.223', '26.224', '27.225', '28.226', '29.227', '30.228', '31.229', '32.230', '33.231', '34.232', '35.233', '36.234', '37.235', '38.236', '39.237', '40.238', '41.239', '42.240', '43.241', '44.242', '45.243', '46.244', '47.245', '48.246', '49.247', '50.248', '51.249', '52.250', '53.251', '54.252', '55.253', '56.254', '57.255', '58.256', '59.257', '60.258', '61.259', '62.260', '63.261', '64.262', '65.263', '66.264', '67.265', '68.266', '69.267', '70.268', '71.269', '72.270', '73.271', '74.272', '75.273', '76.274', '77.275', '78.276', '79.277', '80.278', '81.279', '82.280', '83.281', '84.282', '85.283', '86.284', '87.285', '88.286', '89.287', '90.288', '91.289', '92.290', '93.291', '94.292', '95.293', '96.294', '97.295', '98.296', '99.297', '100.298', '101.299', '102.300', '103.301', '104.302', '105.303', '106.304', '107.305', '108.306', '109.307', '110.308', '111.309', '112.310', '113.311', '114.312', '115.313', '116.314', '117.315', '118.316', '119.317', '120.318', '121.319', '122.320', '123.321', '124.322', '125.323', '126.324', '127.325', '128.326', '129.327', '130.328', '131.329', '132.330', '133.331', '134.332', '135.333', '136.334', '137.335', '138.336', '139.337', '140.338', '141.339', '142.340', '143.341', '144.342', '145.343', '146.344', '147.345', '148.346', '149.347', '150.348', '151.349', '152.350', '153.351', '154.352', '155.353', '156.354', '157.355', '158.356', '159.357', '160.358', '161.359', '162.360', '163.361', '164.362', '165.363', '166.364', '167.365', '168.366', '169.367', '170.368', '171.369', '172.370', '173.371', '174.372', '175.373', '176.374', '177.375', '178.376', '179.377', '180.378', '181.379', '182.380', '183.381', '184.382', '185.383', '186.384', '187.385', '188.386', '189.387', '190.388', '191.389', '192.390', '193.391', '194.392', '195.393', '196.394', '197.395', '198.396', '199.397', '200.398', '201.399', '202.400', '203.401', '204.402', '205.403', '206.404', '207.405', '208.406', '209.407', '210.408', '211.409', '212.410', '213.411', '214.412', '215.413', '216.414', '217.415', '218.416', '219.417', '220.418', '221.419', '222.420', '223.421', '224.422', '225.423', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.424', '238', '239', '240', '241', '242', '243', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '244.434', '245.435', '246.436', '247.437', '248.438', '249.439', '250.440', '251.441', '252', '253', '254', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474']), StandardNumbering(id='standardnumbering20', reference_id='BAH60832.1', numbered_id='XP_017989070.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14.212', '15.213', '16.214', '17.215', '18.216', '19.217', '20.218', '21.219', '22.220', '23.221', '24.222', '25.223', '26.224', '27.225', '28.226', '29.227', '30.228', '31.229', '32.230', '33.231', '34.232', '35.233', '36.234', '37.235', '38.236', '39.237', '40.238', '41.239', '42.240', '43.241', '44.242', '45.243', '46.244', '47.245', '48.246', '49.247', '50.248', '51.249', '52.250', '53.251', '54.252', '55.253', '56.254', '57.255', '58.256', '59.257', '60.258', '61.259', '62.260', '63.261', '64.262', '65.263', '66.264', '67.265', '68.266', '69.267', '70.268', '71.269', '72.270', '73.271', '74.272', '75.273', '76.274', '77.275', '78.276', '79.277', '80.278', '81.279', '82.280', '83.281', '84.282', '85.283', '86.284', '87.285', '88.286', '89.287', '90.288', '91.289', '92.290', '93.291', '94.292', '95.293', '96.294', '97.295', '98.296', '99.297', '100.298', '101.299', '102.300', '103.301', '104.302', '105.303', '106.304', '107.305', '108.306', '109.307', '110.308', '111.309', '112.310', '113.311', '114.312', '115.313', '116.314', '117.315', '118.316', '119.317', '120.318', '121.319', '122.320', '123.321', '124.322', '125.323', '126.324', '127.325', '128.326', '129.327', '130.328', '131.329', '132.330', '133.331', '134.332', '135.333', '136.334', '137.335', '138.336', '139.337', '140.338', '141.339', '142.340', '143.341', '144.342', '145.343', '146.344', '147.345', '148.346', '149.347', '150.348', '151.349', '152.350', '153.351', '154.352', '155.353', '156.354', '157.355', '158.356', '159.357', '160.358', '161.359', '162.360', '163.361', '164.362', '165.363', '166.364', '167.365', '168.366', '169.367', '170.368', '171.369', '172.370', '173.371', '174.372', '175.373', '176.374', '177.375', '178.376', '179.377', '180.378', '181.379', '182.380', '183.381', '184.382', '185.383', '186.384', '187.385', '188.386', '189.387', '190.388', '191.389', '192.390', '193.391', '194.392', '195.393', '196.394', '197.395', '198.396', '199.397', '200.398', '201.399', '202.400', '203.401', '204.402', '205.403', '206.404', '207.405', '208.406', '209.407', '210.408', '211.409', '212.410', '213.411', '214.412', '215.413', '216.414', '217.415', '218.416', '219.417', '220.418', '221.419', '222.420', '223.421', '224.422', '225.423', '226.424', '227.425', '228.426', '229.427', '230.428', '231', '232', '233', '234', '235', '236.429', '237.430', '237.431', '238.432', '239.433', '240.434', '241.435', '242.436', '243.437', '243.438', '243.439', '243.440', '243.441', '243.442', '243.443', '243.444', '243.445', '243.446', '244.447', '245.448', '246.449', '247.450', '248.451', '249.452', '250.453', '251.454', '252', '253', '254', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486', '254.487']), StandardNumbering(id='standardnumbering21', reference_id='BAH60832.1', numbered_id='KAG0673910.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14', '15.212', '16.213', '17.214', '18.215', '19.216', '20.217', '21.218', '22.219', '23.220', '24.221', '25.222', '26.223', '27.224', '28.225', '29.226', '30.227', '31.228', '32.229', '33.230', '34.231', '35.232', '36.233', '37.234', '38.235', '39.236', '40.237', '41.238', '42.239', '43.240', '44.241', '45.242', '46.243', '47.244', '48.245', '49.246', '50.247', '51.248', '52.249', '53.250', '54.251', '55.252', '56.253', '57.254', '58.255', '59.256', '60.257', '61.258', '62.259', '63.260', '64.261', '65.262', '66.263', '67.264', '68.265', '69.266', '70.267', '71.268', '72.269', '73.270', '74.271', '75.272', '76.273', '77.274', '78.275', '79.276', '80.277', '81.278', '82.279', '83.280', '84.281', '85.282', '86.283', '87.284', '88.285', '89.286', '90.287', '91.288', '92.289', '93.290', '94.291', '95.292', '96.293', '97.294', '98.295', '99.296', '100.297', '101.298', '102.299', '103.300', '104.301', '105.302', '106.303', '107.304', '108.305', '109.306', '110.307', '111.308', '112.309', '113.310', '114.311', '115.312', '116.313', '117.314', '118.315', '119.316', '120.317', '121.318', '122.319', '123.320', '124.321', '125.322', '126.323', '127.324', '128.325', '129.326', '130.327', '131.328', '132.329', '133.330', '134.331', '135.332', '136.333', '137.334', '138.335', '139.336', '140.337', '141.338', '142.339', '143.340', '144.341', '145.342', '146.343', '147.344', '148.345', '149.346', '150.347', '151.348', '152.349', '153.350', '154.351', '155.352', '156.353', '157.354', '158.355', '159.356', '160.357', '161.358', '162.359', '163.360', '164.361', '165.362', '166.363', '167.364', '168.365', '169.366', '170.367', '171.368', '172.369', '173.370', '174.371', '175.372', '176.373', '177.374', '178.375', '179.376', '180.377', '181.378', '182.379', '183.380', '184.381', '185.382', '186.383', '187.384', '188.385', '189.386', '190.387', '191.388', '192.389', '193.390', '194.391', '195.392', '196.393', '197.394', '198.395', '199.396', '200.397', '201.398', '202.399', '203.400', '204.401', '205.402', '206.403', '207.404', '208.405', '209.406', '210.407', '211.408', '212.409', '213.410', '214.411', '215.412', '216.413', '217.414', '218.415', '219.416', '220.417', '221.418', '222.419', '223.420', '224.421', '225.422', '226.423', '227.424', '228.425', '229.426', '230.427', '231', '232', '233', '234', '235', '236.428', '237.429', '237.430', '238.431', '239.432', '240.433', '241', '242', '243', '243.434', '243.435', '243.436', '243.437', '243.438', '243.439', '243.440', '243.441', '243.442', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475']), StandardNumbering(id='standardnumbering22', reference_id='BAH60832.1', numbered_id='SMN21971.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10.212', '11.213', '12.214', '13.215', '14', '15', '16', '17', '18.216', '19.217', '20.218', '21.219', '22.220', '23.221', '24.222', '25.223', '26.224', '27.225', '28.226', '29.227', '30.228', '31.229', '32.230', '33.231', '34.232', '35.233', '36.234', '37.235', '38.236', '39.237', '40.238', '41.239', '42.240', '43.241', '44.242', '45.243', '46.244', '47.245', '48.246', '49.247', '50.248', '51.249', '52.250', '53.251', '54.252', '55.253', '56.254', '57.255', '58.256', '59.257', '60.258', '61.259', '62.260', '63.261', '64.262', '65.263', '66.264', '67.265', '68.266', '69.267', '70.268', '71.269', '72.270', '73.271', '74.272', '75.273', '76.274', '77.275', '78.276', '79.277', '80.278', '81.279', '82.280', '83.281', '84.282', '85.283', '86.284', '87.285', '88.286', '89.287', '90.288', '91.289', '92.290', '93.291', '94.292', '95.293', '96.294', '97.295', '98.296', '99.297', '100.298', '101.299', '102.300', '103.301', '104.302', '105.303', '106.304', '107.305', '108.306', '109.307', '110.308', '111.309', '112.310', '113.311', '114.312', '115.313', '116.314', '117.315', '118.316', '119.317', '120.318', '121.319', '122.320', '123.321', '124.322', '125.323', '126.324', '127.325', '128.326', '129.327', '130.328', '131.329', '132.330', '133.331', '134.332', '135.333', '136.334', '137.335', '138.336', '139.337', '140.338', '141.339', '142.340', '143.341', '144.342', '145.343', '146.344', '147.345', '148.346', '149.347', '150.348', '151.349', '152.350', '153.351', '154.352', '155.353', '156.354', '157.355', '158.356', '159.357', '160.358', '161.359', '162.360', '163.361', '164.362', '165.363', '166.364', '167.365', '168.366', '169.367', '170.368', '171.369', '172.370', '173.371', '174.372', '175.373', '176.374', '177.375', '178.376', '179.377', '180.378', '181.379', '182.380', '183.381', '184.382', '185.383', '186.384', '187.385', '188.386', '189.387', '190.388', '191.389', '192.390', '193.391', '194.392', '195.393', '196.394', '197.395', '198.396', '199.397', '200.398', '201.399', '202.400', '203.401', '204.402', '205.403', '206.404', '207.405', '208.406', '209.407', '210.408', '211.409', '212.410', '213.411', '214.412', '215.413', '216.414', '217.415', '218.416', '219.417', '220.418', '221.419', '222.420', '223.421', '224.422', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.423', '238', '239', '240', '241', '242', '243', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465']), StandardNumbering(id='standardnumbering23', reference_id='BAH60832.1', numbered_id='KAG0661436.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10.212', '11.213', '12.214', '13.215', '14.216', '15.217', '16.218', '17.219', '18.220', '19.221', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217.419', '218.420', '219.421', '220.422', '221.423', '222.424', '223.425', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.426', '238', '239', '240', '241', '242', '243', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468']), StandardNumbering(id='standardnumbering24', reference_id='BAH60832.1', numbered_id='SCV02624.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13.212', '14.213', '15.214', '16.215', '17.216', '18.217', '19.218', '20.219', '21.220', '22.221', '23.222', '24.223', '25.224', '26.225', '27.226', '28.227', '29.228', '30.229', '31.230', '32.231', '33.232', '34.233', '35.234', '36.235', '37.236', '38.237', '39.238', '40.239', '41.240', '42.241', '43.242', '44.243', '45.244', '46.245', '47.246', '48.247', '49.248', '50.249', '51.250', '52.251', '53.252', '54.253', '55.254', '56.255', '57.256', '58.257', '59.258', '60.259', '61.260', '62.261', '63.262', '64.263', '65.264', '66.265', '67.266', '68.267', '69.268', '70.269', '71.270', '72.271', '73.272', '74.273', '75.274', '76.275', '77.276', '78.277', '79.278', '80.279', '81.280', '82.281', '83.282', '84.283', '85.284', '86.285', '87.286', '88.287', '89.288', '90.289', '91.290', '92.291', '93.292', '94.293', '95.294', '96.295', '97.296', '98.297', '99.298', '100.299', '101.300', '102.301', '103.302', '104.303', '105.304', '106.305', '107.306', '108.307', '109.308', '110.309', '111.310', '112.311', '113.312', '114.313', '115.314', '116.315', '117.316', '118.317', '119.318', '120.319', '121.320', '122.321', '123.322', '124.323', '125.324', '126.325', '127.326', '128.327', '129.328', '130.329', '131.330', '132.331', '133.332', '134.333', '135.334', '136.335', '137.336', '138.337', '139.338', '140.339', '141.340', '142.341', '143.342', '144.343', '145.344', '146.345', '147.346', '148.347', '149.348', '150.349', '151.350', '152.351', '153.352', '154.353', '155.354', '156.355', '157.356', '158.357', '159.358', '160.359', '161.360', '162.361', '163.362', '164.363', '165.364', '166.365', '167.366', '168.367', '169.368', '170.369', '171.370', '172.371', '173.372', '174.373', '175.374', '176.375', '177.376', '178.377', '179.378', '180.379', '181.380', '182.381', '183.382', '184.383', '185.384', '186.385', '187.386', '188.387', '189.388', '190.389', '191.390', '192.391', '193.392', '194.393', '195.394', '196.395', '197.396', '198.397', '199.398', '200.399', '201.400', '202.401', '203.402', '204.403', '205.404', '206.405', '207.406', '208.407', '209.408', '210.409', '211.410', '212.411', '213.412', '214.413', '215.414', '216.415', '217.416', '218.417', '219.418', '220.419', '221.420', '222.421', '223.422', '224.423', '225.424', '226.425', '227.426', '228.427', '229.428', '230.429', '231.430', '232.431', '233.432', '234.433', '235', '236.434', '237.435', '237.436', '238.437', '239.438', '240.439', '241.440', '242.441', '243', '243.442', '243.443', '243.444', '243.445', '243.446', '243.447', '243.448', '243.449', '243.450', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483']), StandardNumbering(id='standardnumbering25', reference_id='BAH60832.1', numbered_id='SCV99388.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13.212', '14.213', '15.214', '16.215', '17.216', '18.217', '19.218', '20.219', '21.220', '22.221', '23.222', '24.223', '25.224', '26.225', '27.226', '28.227', '29.228', '30.229', '31.230', '32.231', '33.232', '34.233', '35.234', '36.235', '37.236', '38.237', '39.238', '40.239', '41.240', '42.241', '43.242', '44.243', '45.244', '46.245', '47.246', '48.247', '49.248', '50.249', '51.250', '52.251', '53.252', '54.253', '55.254', '56.255', '57.256', '58.257', '59.258', '60.259', '61.260', '62.261', '63.262', '64.263', '65.264', '66.265', '67.266', '68.267', '69.268', '70.269', '71.270', '72.271', '73.272', '74.273', '75.274', '76.275', '77.276', '78.277', '79.278', '80.279', '81.280', '82.281', '83.282', '84.283', '85.284', '86.285', '87.286', '88.287', '89.288', '90.289', '91.290', '92.291', '93.292', '94.293', '95.294', '96.295', '97.296', '98.297', '99.298', '100.299', '101.300', '102.301', '103.302', '104.303', '105.304', '106.305', '107.306', '108.307', '109.308', '110.309', '111.310', '112.311', '113.312', '114.313', '115.314', '116.315', '117.316', '118.317', '119.318', '120.319', '121.320', '122.321', '123.322', '124.323', '125.324', '126.325', '127.326', '128.327', '129.328', '130.329', '131.330', '132.331', '133.332', '134.333', '135.334', '136.335', '137.336', '138.337', '139.338', '140.339', '141.340', '142.341', '143.342', '144.343', '145.344', '146.345', '147.346', '148.347', '149.348', '150.349', '151.350', '152.351', '153.352', '154.353', '155.354', '156.355', '157.356', '158.357', '159.358', '160.359', '161.360', '162.361', '163.362', '164.363', '165.364', '166.365', '167.366', '168.367', '169.368', '170.369', '171.370', '172.371', '173.372', '174.373', '175.374', '176.375', '177.376', '178.377', '179.378', '180.379', '181.380', '182.381', '183.382', '184.383', '185.384', '186.385', '187.386', '188.387', '189.388', '190.389', '191.390', '192.391', '193.392', '194.393', '195.394', '196.395', '197.396', '198.397', '199.398', '200.399', '201.400', '202.401', '203.402', '204.403', '205.404', '206.405', '207.406', '208.407', '209.408', '210.409', '211.410', '212.411', '213.412', '214.413', '215.414', '216.415', '217.416', '218.417', '219.418', '220.419', '221.420', '222.421', '223.422', '224.423', '225.424', '226.425', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.426', '238', '239', '240', '241', '242', '243', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468']), StandardNumbering(id='standardnumbering26', reference_id='BAH60832.1', numbered_id='CUS20182.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13.212', '14.213', '15.214', '16.215', '17.216', '18.217', '19.218', '20.219', '21.220', '22.221', '23.222', '24.223', '25.224', '26.225', '27.226', '28.227', '29.228', '30.229', '31.230', '32.231', '33.232', '34.233', '35.234', '36.235', '37.236', '38.237', '39.238', '40.239', '41.240', '42.241', '43.242', '44.243', '45.244', '46.245', '47.246', '48.247', '49.248', '50.249', '51.250', '52.251', '53.252', '54.253', '55.254', '56.255', '57.256', '58.257', '59.258', '60.259', '61.260', '62.261', '63.262', '64.263', '65.264', '66.265', '67.266', '68.267', '69.268', '70.269', '71.270', '72.271', '73.272', '74.273', '75.274', '76.275', '77.276', '78.277', '79.278', '80.279', '81.280', '82.281', '83.282', '84.283', '85.284', '86.285', '87.286', '88.287', '89.288', '90.289', '91.290', '92.291', '93.292', '94.293', '95.294', '96.295', '97.296', '98.297', '99.298', '100.299', '101.300', '102.301', '103.302', '104.303', '105.304', '106.305', '107.306', '108.307', '109.308', '110.309', '111.310', '112.311', '113.312', '114.313', '115.314', '116.315', '117.316', '118.317', '119.318', '120.319', '121.320', '122.321', '123.322', '124.323', '125.324', '126.325', '127.326', '128.327', '129.328', '130.329', '131.330', '132.331', '133.332', '134.333', '135.334', '136.335', '137.336', '138.337', '139.338', '140.339', '141.340', '142.341', '143.342', '144.343', '145.344', '146.345', '147.346', '148.347', '149.348', '150.349', '151.350', '152.351', '153.352', '154.353', '155.354', '156.355', '157.356', '158.357', '159.358', '160.359', '161.360', '162.361', '163.362', '164.363', '165.364', '166.365', '167.366', '168.367', '169.368', '170.369', '171.370', '172.371', '173.372', '174.373', '175.374', '176.375', '177.376', '178.377', '179.378', '180.379', '181.380', '182.381', '183.382', '184.383', '185.384', '186.385', '187.386', '188.387', '189.388', '190.389', '191.390', '192.391', '193.392', '194.393', '195.394', '196.395', '197.396', '198.397', '199.398', '200.399', '201.400', '202.401', '203.402', '204.403', '205.404', '206.405', '207.406', '208.407', '209.408', '210.409', '211.410', '212.411', '213.412', '214.413', '215.414', '216.415', '217.416', '218.417', '219.418', '220.419', '221.420', '222.421', '223.422', '224.423', '225.424', '226.425', '227.426', '228.427', '229.428', '230.429', '231.430', '232.431', '233.432', '234', '235', '236', '237', '237.433', '238', '239', '240', '241', '242', '243', '243.434', '243.435', '243.436', '243.437', '243.438', '243.439', '243.440', '243.441', '243.442', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475']), StandardNumbering(id='standardnumbering27', reference_id='BAH60832.1', numbered_id='XP_045933944.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1.181', '2.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '3.195', '4.196', '5.197', '5.198', '5.199', '5.200', '5.201', '5.202', '6.203', '7.204', '7.205', '7.206', '7.207', '7.208', '7.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '8.217', '8.218', '8.219', '9', '10', '11', '12', '13.220', '14.221', '15.222', '16.223', '17.224', '18.225', '19.226', '20.227', '21.228', '22.229', '23.230', '24.231', '25.232', '26.233', '27.234', '28.235', '29.236', '30.237', '31.238', '32.239', '33.240', '34.241', '35.242', '36.243', '37.244', '38.245', '39.246', '40.247', '41.248', '42.249', '43.250', '44.251', '45.252', '46.253', '47.254', '48.255', '49.256', '50.257', '51.258', '52.259', '53.260', '54.261', '55.262', '56.263', '57.264', '58.265', '59.266', '60.267', '61.268', '62.269', '63.270', '64.271', '65.272', '66.273', '67.274', '68.275', '69.276', '70.277', '71.278', '72.279', '73.280', '74.281', '75.282', '76.283', '77.284', '78.285', '79.286', '80.287', '81.288', '82.289', '83.290', '84.291', '85.292', '86.293', '87.294', '88.295', '89.296', '90.297', '91.298', '92.299', '93.300', '94.301', '95.302', '96.303', '97.304', '98.305', '99.306', '100.307', '101.308', '102.309', '103.310', '104.311', '105.312', '106.313', '107.314', '108.315', '109.316', '110.317', '111.318', '112.319', '113.320', '114.321', '115.322', '116.323', '117.324', '118.325', '119.326', '120.327', '121.328', '122.329', '123.330', '124.331', '125.332', '126.333', '127.334', '128.335', '129.336', '130.337', '131.338', '132.339', '133.340', '134.341', '135.342', '136.343', '137.344', '138.345', '139.346', '140.347', '141.348', '142.349', '143.350', '144.351', '145.352', '146.353', '147.354', '148.355', '149.356', '150.357', '151.358', '152.359', '153.360', '154.361', '155.362', '156.363', '157.364', '158.365', '159.366', '160.367', '161.368', '162.369', '163.370', '164.371', '165.372', '166.373', '167.374', '168.375', '169.376', '170.377', '171.378', '172.379', '173.380', '174.381', '175.382', '176.383', '177.384', '178.385', '179.386', '180.387', '181.388', '182.389', '183.390', '184.391', '185.392', '186.393', '187.394', '188.395', '189.396', '190.397', '191.398', '192.399', '193.400', '194.401', '195.402', '196.403', '197.404', '198.405', '199.406', '200.407', '201.408', '202.409', '203.410', '204.411', '205.412', '206.413', '207.414', '208.415', '209.416', '210.417', '211.418', '212.419', '213.420', '214.421', '215.422', '216.423', '217.424', '218.425', '219.426', '220.427', '221.428', '222.429', '223.430', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.431', '238', '239', '240', '241', '242', '243', '243.432', '243.433', '243.434', '243.435', '243.436', '243.437', '243.438', '243.439', '243.440', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473']), StandardNumbering(id='standardnumbering28', reference_id='BAH60832.1', numbered_id='KAA8901327.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '4', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11', '12', '13', '14', '15.214', '16.215', '17.216', '18.217', '19.218', '20.219', '21.220', '22.221', '23.222', '24.223', '25.224', '26.225', '27.226', '28.227', '29.228', '30.229', '31.230', '32.231', '33.232', '34.233', '35.234', '36.235', '37.236', '38.237', '39.238', '40.239', '41.240', '42.241', '43.242', '44.243', '45.244', '46.245', '47.246', '48.247', '49.248', '50.249', '51.250', '52.251', '53.252', '54.253', '55.254', '56.255', '57.256', '58.257', '59.258', '60.259', '61.260', '62.261', '63.262', '64.263', '65.264', '66.265', '67.266', '68.267', '69.268', '70.269', '71.270', '72.271', '73.272', '74.273', '75.274', '76.275', '77.276', '78.277', '79.278', '80.279', '81.280', '82.281', '83.282', '84.283', '85.284', '86.285', '87.286', '88.287', '89.288', '90.289', '91.290', '92.291', '93.292', '94.293', '95.294', '96.295', '97.296', '98.297', '99.298', '100.299', '101.300', '102.301', '103.302', '104.303', '105.304', '106.305', '107.306', '108.307', '109.308', '110.309', '111.310', '112.311', '113.312', '114.313', '115.314', '116.315', '117.316', '118.317', '119.318', '120.319', '121.320', '122.321', '123.322', '124.323', '125.324', '126.325', '127.326', '128.327', '129.328', '130.329', '131.330', '132.331', '133.332', '134.333', '135.334', '136.335', '137.336', '138.337', '139.338', '140.339', '141.340', '142.341', '143.342', '144.343', '145.344', '146.345', '147.346', '148.347', '149.348', '150.349', '151.350', '152.351', '153.352', '154.353', '155.354', '156.355', '157.356', '158.357', '159.358', '160.359', '161.360', '162.361', '163.362', '164.363', '165.364', '166.365', '167.366', '168.367', '169.368', '170.369', '171.370', '172.371', '173.372', '174.373', '175.374', '176.375', '177.376', '178.377', '179.378', '180.379', '181.380', '182.381', '183.382', '184.383', '185.384', '186.385', '187.386', '188.387', '189.388', '190.389', '191.390', '192.391', '193.392', '194.393', '195.394', '196.395', '197.396', '198.397', '199.398', '200.399', '201.400', '202.401', '203.402', '204.403', '205.404', '206.405', '207.406', '208.407', '209.408', '210.409', '211.410', '212.411', '213.412', '214.413', '215.414', '216.415', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.416', '238', '239', '240', '241', '242', '243', '243.417', '243.418', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458']), StandardNumbering(id='standardnumbering29', reference_id='BAH60832.1', numbered_id='KAF8417303.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11', '12.214', '13.215', '14.216', '15.217', '16.218', '17.219', '18.220', '19.221', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.419', '238', '239', '240', '241', '242', '243', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461']), StandardNumbering(id='standardnumbering30', reference_id='BAH60832.1', numbered_id='KAF3929277.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21', '22.226', '23.227', '24.228', '25.229', '26.230', '27.231', '28.232', '29.233', '30.234', '31.235', '32.236', '33.237', '34.238', '35.239', '36.240', '37.241', '38.242', '39.243', '40.244', '41.245', '42.246', '43.247', '44.248', '45.249', '46.250', '47.251', '48.252', '49.253', '50.254', '51.255', '52.256', '53.257', '54.258', '55.259', '56.260', '57.261', '58.262', '59.263', '60.264', '61.265', '62.266', '63.267', '64.268', '65.269', '66.270', '67.271', '68.272', '69.273', '70.274', '71.275', '72.276', '73.277', '74.278', '75.279', '76.280', '77.281', '78.282', '79.283', '80.284', '81.285', '82.286', '83.287', '84.288', '85.289', '86.290', '87.291', '88.292', '89.293', '90.294', '91.295', '92.296', '93.297', '94.298', '95.299', '96.300', '97.301', '98.302', '99.303', '100.304', '101.305', '102.306', '103.307', '104.308', '105.309', '106.310', '107.311', '108.312', '109.313', '110.314', '111.315', '112.316', '113.317', '114.318', '115.319', '116.320', '117.321', '118.322', '119.323', '120.324', '121.325', '122.326', '123.327', '124.328', '125.329', '126.330', '127.331', '128.332', '129.333', '130.334', '131.335', '132.336', '133.337', '134.338', '135.339', '136.340', '137.341', '138.342', '139.343', '140.344', '141.345', '142.346', '143.347', '144.348', '145.349', '146.350', '147.351', '148.352', '149.353', '150.354', '151.355', '152.356', '153.357', '154.358', '155.359', '156.360', '157.361', '158.362', '159.363', '160.364', '161.365', '162.366', '163.367', '164.368', '165.369', '166.370', '167.371', '168.372', '169.373', '170.374', '171.375', '172.376', '173.377', '174.378', '175.379', '176.380', '177.381', '178.382', '179.383', '180.384', '181.385', '182.386', '183.387', '184.388', '185.389', '186.390', '187.391', '188.392', '189.393', '190.394', '191.395', '192.396', '193.397', '194.398', '195.399', '196.400', '197.401', '198.402', '199.403', '200.404', '201.405', '202.406', '203.407', '204.408', '205.409', '206.410', '207.411', '208.412', '209.413', '210.414', '211.415', '212.416', '213.417', '214.418', '215.419', '216.420', '217.421', '218.422', '219.423', '220.424', '221.425', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.426', '238', '239', '240', '241', '242', '243', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468']), StandardNumbering(id='standardnumbering31', reference_id='BAH60832.1', numbered_id='OEJ86227.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6.200', '7.201', '7.202', '7.203', '7.204', '7.205', '7.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '9', '10', '11', '12', '13.217', '14.218', '15.219', '16.220', '17.221', '18.222', '19.223', '20.224', '21.225', '22.226', '23.227', '24.228', '25.229', '26.230', '27.231', '28.232', '29.233', '30.234', '31.235', '32.236', '33.237', '34.238', '35.239', '36.240', '37.241', '38.242', '39.243', '40.244', '41.245', '42.246', '43.247', '44.248', '45.249', '46.250', '47.251', '48.252', '49.253', '50.254', '51.255', '52.256', '53.257', '54.258', '55.259', '56.260', '57.261', '58.262', '59.263', '60.264', '61.265', '62.266', '63.267', '64.268', '65.269', '66.270', '67.271', '68.272', '69.273', '70.274', '71.275', '72.276', '73.277', '74.278', '75.279', '76.280', '77.281', '78.282', '79.283', '80.284', '81.285', '82.286', '83.287', '84.288', '85.289', '86.290', '87.291', '88.292', '89.293', '90.294', '91.295', '92.296', '93.297', '94.298', '95.299', '96.300', '97.301', '98.302', '99.303', '100.304', '101.305', '102.306', '103.307', '104.308', '105.309', '106.310', '107.311', '108.312', '109.313', '110.314', '111.315', '112.316', '113.317', '114.318', '115.319', '116.320', '117.321', '118.322', '119.323', '120.324', '121.325', '122.326', '123.327', '124.328', '125.329', '126.330', '127.331', '128.332', '129.333', '130.334', '131.335', '132.336', '133.337', '134.338', '135.339', '136.340', '137.341', '138.342', '139.343', '140.344', '141.345', '142.346', '143.347', '144.348', '145.349', '146.350', '147.351', '148.352', '149.353', '150.354', '151.355', '152.356', '153.357', '154.358', '155.359', '156.360', '157.361', '158.362', '159.363', '160.364', '161.365', '162.366', '163.367', '164.368', '165.369', '166.370', '167.371', '168.372', '169.373', '170.374', '171.375', '172.376', '173.377', '174.378', '175.379', '176.380', '177.381', '178.382', '179.383', '180.384', '181.385', '182.386', '183.387', '184.388', '185.389', '186.390', '187.391', '188.392', '189.393', '190.394', '191.395', '192.396', '193.397', '194.398', '195.399', '196.400', '197.401', '198.402', '199.403', '200.404', '201.405', '202.406', '203.407', '204.408', '205.409', '206.410', '207.411', '208.412', '209.413', '210.414', '211.415', '212.416', '213.417', '214.418', '215.419', '216.420', '217.421', '218.422', '219.423', '220.424', '221.425', '222.426', '223.427', '224.428', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.429', '238', '239', '240', '241', '242', '243', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '243.436', '243.437', '243.438', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471']), StandardNumbering(id='standardnumbering32', reference_id='BAH60832.1', numbered_id='XP_046060918.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14', '15', '16', '17', '18', '19', '20', '21', '22.212', '23.213', '24.214', '25.215', '26.216', '27.217', '28.218', '29.219', '30.220', '31.221', '32.222', '33.223', '34.224', '35.225', '36.226', '37.227', '38.228', '39.229', '40.230', '41.231', '42.232', '43.233', '44.234', '45.235', '46.236', '47.237', '48.238', '49.239', '50.240', '51.241', '52.242', '53.243', '54.244', '55.245', '56.246', '57.247', '58.248', '59.249', '60.250', '61.251', '62.252', '63.253', '64.254', '65.255', '66.256', '67.257', '68.258', '69.259', '70.260', '71.261', '72.262', '73.263', '74.264', '75.265', '76.266', '77.267', '78.268', '79.269', '80.270', '81.271', '82.272', '83.273', '84.274', '85.275', '86.276', '87.277', '88.278', '89.279', '90.280', '91.281', '92.282', '93.283', '94.284', '95.285', '96.286', '97.287', '98.288', '99.289', '100.290', '101.291', '102.292', '103.293', '104.294', '105.295', '106.296', '107.297', '108.298', '109.299', '110.300', '111.301', '112.302', '113.303', '114.304', '115.305', '116.306', '117.307', '118.308', '119.309', '120.310', '121.311', '122.312', '123.313', '124.314', '125.315', '126.316', '127.317', '128.318', '129.319', '130.320', '131.321', '132.322', '133.323', '134.324', '135.325', '136.326', '137.327', '138.328', '139.329', '140.330', '141.331', '142.332', '143.333', '144.334', '145.335', '146.336', '147.337', '148.338', '149.339', '150.340', '151.341', '152.342', '153.343', '154.344', '155.345', '156.346', '157.347', '158.348', '159.349', '160.350', '161.351', '162.352', '163.353', '164.354', '165.355', '166.356', '167.357', '168.358', '169.359', '170.360', '171.361', '172.362', '173.363', '174.364', '175.365', '176.366', '177.367', '178.368', '179.369', '180.370', '181.371', '182.372', '183.373', '184.374', '185.375', '186.376', '187.377', '188.378', '189.379', '190.380', '191.381', '192.382', '193.383', '194.384', '195.385', '196.386', '197.387', '198.388', '199.389', '200.390', '201.391', '202.392', '203.393', '204.394', '205.395', '206.396', '207.397', '208.398', '209.399', '210.400', '211.401', '212.402', '213.403', '214.404', '215.405', '216.406', '217.407', '218.408', '219.409', '220.410', '221.411', '222.412', '223.413', '224.414', '225.415', '226.416', '227.417', '228.418', '229.419', '230.420', '231.421', '232.422', '233', '234', '235', '236', '237', '237.423', '238', '239', '240', '241', '242', '243', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465']), StandardNumbering(id='standardnumbering33', reference_id='BAH60832.1', numbered_id='EPS36031.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21', '22.226', '23.227', '24.228', '25.229', '26.230', '27.231', '28.232', '29.233', '30.234', '31.235', '32.236', '33.237', '34.238', '35.239', '36.240', '37.241', '38.242', '39.243', '40.244', '41.245', '42.246', '43.247', '44.248', '45.249', '46.250', '47.251', '48.252', '49.253', '50.254', '51.255', '52.256', '53.257', '54.258', '55.259', '56.260', '57.261', '58.262', '59.263', '60.264', '61.265', '62.266', '63.267', '64.268', '65.269', '66.270', '67.271', '68.272', '69.273', '70.274', '71.275', '72.276', '73.277', '74.278', '75.279', '76.280', '77.281', '78.282', '79.283', '80.284', '81.285', '82.286', '83.287', '84.288', '85.289', '86.290', '87.291', '88.292', '89.293', '90.294', '91.295', '92.296', '93.297', '94.298', '95.299', '96.300', '97.301', '98.302', '99.303', '100.304', '101.305', '102.306', '103.307', '104.308', '105.309', '106.310', '107.311', '108.312', '109.313', '110.314', '111.315', '112.316', '113.317', '114.318', '115.319', '116.320', '117.321', '118.322', '119.323', '120.324', '121.325', '122.326', '123.327', '124.328', '125.329', '126.330', '127.331', '128.332', '129.333', '130.334', '131.335', '132.336', '133.337', '134.338', '135.339', '136.340', '137.341', '138.342', '139.343', '140.344', '141.345', '142.346', '143.347', '144.348', '145.349', '146.350', '147.351', '148.352', '149.353', '150.354', '151.355', '152.356', '153.357', '154.358', '155.359', '156.360', '157.361', '158.362', '159.363', '160.364', '161.365', '162.366', '163.367', '164.368', '165.369', '166.370', '167.371', '168.372', '169.373', '170.374', '171.375', '172.376', '173.377', '174.378', '175.379', '176.380', '177.381', '178.382', '179.383', '180.384', '181.385', '182.386', '183.387', '184.388', '185.389', '186.390', '187.391', '188.392', '189.393', '190.394', '191.395', '192.396', '193.397', '194.398', '195.399', '196.400', '197.401', '198.402', '199.403', '200.404', '201.405', '202.406', '203.407', '204.408', '205.409', '206.410', '207.411', '208.412', '209.413', '210.414', '211.415', '212.416', '213.417', '214.418', '215.419', '216.420', '217.421', '218.422', '219.423', '220.424', '221.425', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.426', '238', '239', '240', '241', '242', '243', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468']), StandardNumbering(id='standardnumbering34', reference_id='BAH60832.1', numbered_id='KAI5807151.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '4.194', '5.195', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10.215', '11.216', '12.217', '13', '14.218', '15.219', '16.220', '17.221', '18.222', '19.223', '20.224', '21.225', '22.226', '23.227', '24.228', '25.229', '26.230', '27.231', '28.232', '29.233', '30.234', '31.235', '32.236', '33.237', '34.238', '35.239', '36.240', '37.241', '38.242', '39.243', '40.244', '41.245', '42.246', '43.247', '44.248', '45.249', '46.250', '47.251', '48.252', '49.253', '50.254', '51.255', '52.256', '53.257', '54.258', '55.259', '56.260', '57.261', '58.262', '59.263', '60.264', '61.265', '62.266', '63.267', '64.268', '65.269', '66.270', '67.271', '68.272', '69.273', '70.274', '71.275', '72.276', '73.277', '74.278', '75.279', '76.280', '77.281', '78.282', '79.283', '80.284', '81.285', '82.286', '83.287', '84.288', '85.289', '86.290', '87.291', '88.292', '89.293', '90.294', '91.295', '92.296', '93.297', '94.298', '95.299', '96.300', '97.301', '98.302', '99.303', '100.304', '101.305', '102.306', '103.307', '104.308', '105.309', '106.310', '107.311', '108.312', '109.313', '110.314', '111.315', '112.316', '113.317', '114.318', '115.319', '116.320', '117.321', '118.322', '119.323', '120.324', '121.325', '122.326', '123.327', '124.328', '125.329', '126.330', '127.331', '128.332', '129.333', '130.334', '131.335', '132.336', '133.337', '134.338', '135.339', '136.340', '137.341', '138.342', '139.343', '140.344', '141.345', '142.346', '143.347', '144.348', '145.349', '146.350', '147.351', '148.352', '149.353', '150.354', '151.355', '152.356', '153.357', '154.358', '155.359', '156.360', '157.361', '158.362', '159.363', '160.364', '161.365', '162.366', '163.367', '164.368', '165.369', '166.370', '167.371', '168.372', '169.373', '170.374', '171.375', '172.376', '173.377', '174.378', '175.379', '176.380', '177.381', '178.382', '179.383', '180.384', '181.385', '182.386', '183.387', '184.388', '185.389', '186.390', '187.391', '188.392', '189.393', '190.394', '191.395', '192.396', '193.397', '194.398', '195.399', '196.400', '197.401', '198.402', '199.403', '200.404', '201.405', '202.406', '203.407', '204.408', '205.409', '206.410', '207.411', '208.412', '209.413', '210.414', '211.415', '212.416', '213.417', '214.418', '215.419', '216.420', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.421', '238', '239', '240', '241', '242', '243', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463']), StandardNumbering(id='standardnumbering35', reference_id='BAH60832.1', numbered_id='XP_011117899.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17', '18.222', '19.223', '20.224', '21', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.425', '238', '239', '240', '241', '242', '243', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467']), StandardNumbering(id='standardnumbering36', reference_id='BAH60832.1', numbered_id='KAI1438264.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering37', reference_id='BAH60832.1', numbered_id='XP_022456167.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14', '15', '16', '17', '18', '19', '20', '21.212', '22.213', '23.214', '24.215', '25.216', '26.217', '27.218', '28.219', '29.220', '30.221', '31.222', '32.223', '33.224', '34.225', '35.226', '36.227', '37.228', '38.229', '39.230', '40.231', '41.232', '42.233', '43.234', '44.235', '45.236', '46.237', '47.238', '48.239', '49.240', '50.241', '51.242', '52.243', '53.244', '54.245', '55.246', '56.247', '57.248', '58.249', '59.250', '60.251', '61.252', '62.253', '63.254', '64.255', '65.256', '66.257', '67.258', '68.259', '69.260', '70.261', '71.262', '72.263', '73.264', '74.265', '75.266', '76.267', '77.268', '78.269', '79.270', '80.271', '81.272', '82.273', '83.274', '84.275', '85.276', '86.277', '87.278', '88.279', '89.280', '90.281', '91.282', '92.283', '93.284', '94.285', '95.286', '96.287', '97.288', '98.289', '99.290', '100.291', '101.292', '102.293', '103.294', '104.295', '105.296', '106.297', '107.298', '108.299', '109.300', '110.301', '111.302', '112.303', '113.304', '114.305', '115.306', '116.307', '117.308', '118.309', '119.310', '120.311', '121.312', '122.313', '123.314', '124.315', '125.316', '126.317', '127.318', '128.319', '129.320', '130.321', '131.322', '132.323', '133.324', '134.325', '135.326', '136.327', '137.328', '138.329', '139.330', '140.331', '141.332', '142.333', '143.334', '144.335', '145.336', '146.337', '147.338', '148.339', '149.340', '150.341', '151.342', '152.343', '153.344', '154.345', '155.346', '156.347', '157.348', '158.349', '159.350', '160.351', '161.352', '162.353', '163.354', '164.355', '165.356', '166.357', '167.358', '168.359', '169.360', '170.361', '171.362', '172.363', '173.364', '174.365', '175.366', '176.367', '177.368', '178.369', '179.370', '180.371', '181.372', '182.373', '183.374', '184.375', '185.376', '186.377', '187.378', '188.379', '189.380', '190.381', '191.382', '192.383', '193.384', '194.385', '195.386', '196.387', '197.388', '198.389', '199.390', '200.391', '201.392', '202.393', '203.394', '204.395', '205.396', '206.397', '207.398', '208.399', '209.400', '210.401', '211.402', '212.403', '213.404', '214.405', '215.406', '216.407', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.408', '238', '239', '240', '241', '242', '243', '243.409', '243.410', '243.411', '243.412', '243.413', '243.414', '243.415', '243.416', '243.417', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.418', '254.419', '254.420', '254.421', '254.422', '254.423', '254.424', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450']), StandardNumbering(id='standardnumbering38', reference_id='BAH60832.1', numbered_id='KAF3908940.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17', '18.222', '19.223', '20.224', '21.225', '22.226', '23.227', '24.228', '25.229', '26.230', '27.231', '28.232', '29.233', '30.234', '31.235', '32.236', '33.237', '34.238', '35.239', '36.240', '37.241', '38.242', '39.243', '40.244', '41.245', '42.246', '43.247', '44.248', '45.249', '46.250', '47.251', '48.252', '49.253', '50.254', '51.255', '52.256', '53.257', '54.258', '55.259', '56.260', '57.261', '58.262', '59.263', '60.264', '61.265', '62.266', '63.267', '64.268', '65.269', '66.270', '67.271', '68.272', '69.273', '70.274', '71.275', '72.276', '73.277', '74.278', '75.279', '76.280', '77.281', '78.282', '79.283', '80.284', '81.285', '82.286', '83.287', '84.288', '85.289', '86.290', '87.291', '88.292', '89.293', '90.294', '91.295', '92.296', '93.297', '94.298', '95.299', '96.300', '97.301', '98.302', '99.303', '100.304', '101.305', '102.306', '103.307', '104.308', '105.309', '106.310', '107.311', '108.312', '109.313', '110.314', '111.315', '112.316', '113.317', '114.318', '115.319', '116.320', '117.321', '118.322', '119.323', '120.324', '121.325', '122.326', '123.327', '124.328', '125.329', '126.330', '127.331', '128.332', '129.333', '130.334', '131.335', '132.336', '133.337', '134.338', '135.339', '136.340', '137.341', '138.342', '139.343', '140.344', '141.345', '142.346', '143.347', '144.348', '145.349', '146.350', '147.351', '148.352', '149.353', '150.354', '151.355', '152.356', '153.357', '154.358', '155.359', '156.360', '157.361', '158.362', '159.363', '160.364', '161.365', '162.366', '163.367', '164.368', '165.369', '166.370', '167.371', '168.372', '169.373', '170.374', '171.375', '172.376', '173.377', '174.378', '175.379', '176.380', '177.381', '178.382', '179.383', '180.384', '181.385', '182.386', '183.387', '184.388', '185.389', '186.390', '187.391', '188.392', '189.393', '190.394', '191.395', '192.396', '193.397', '194.398', '195.399', '196.400', '197.401', '198.402', '199.403', '200.404', '201.405', '202.406', '203.407', '204.408', '205.409', '206.410', '207.411', '208.412', '209.413', '210.414', '211.415', '212.416', '213.417', '214.418', '215.419', '216.420', '217.421', '218.422', '219.423', '220.424', '221.425', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.426', '238', '239', '240', '241', '242', '243', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468']), StandardNumbering(id='standardnumbering39', reference_id='BAH60832.1', numbered_id='XP_006693239.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5.196', '5.197', '5.198', '5.199', '5.200', '5.201', '6.202', '7.203', '7.204', '7.205', '7.206', '7.207', '7.208', '8', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '8.217', '9.218', '10.219', '11.220', '12.221', '13.222', '14.223', '15.224', '16.225', '17.226', '18.227', '19.228', '20.229', '21.230', '22.231', '23.232', '24.233', '25.234', '26.235', '27.236', '28.237', '29.238', '30.239', '31.240', '32.241', '33.242', '34.243', '35.244', '36.245', '37.246', '38.247', '39.248', '40.249', '41.250', '42.251', '43.252', '44.253', '45.254', '46.255', '47.256', '48.257', '49.258', '50.259', '51.260', '52.261', '53.262', '54.263', '55.264', '56.265', '57.266', '58.267', '59.268', '60.269', '61.270', '62.271', '63.272', '64.273', '65.274', '66.275', '67.276', '68.277', '69.278', '70.279', '71.280', '72.281', '73.282', '74.283', '75.284', '76.285', '77.286', '78.287', '79.288', '80.289', '81.290', '82.291', '83.292', '84.293', '85.294', '86.295', '87.296', '88.297', '89.298', '90.299', '91.300', '92.301', '93.302', '94.303', '95.304', '96.305', '97.306', '98.307', '99.308', '100.309', '101.310', '102.311', '103.312', '104.313', '105.314', '106.315', '107.316', '108.317', '109.318', '110.319', '111.320', '112.321', '113.322', '114.323', '115.324', '116.325', '117.326', '118.327', '119.328', '120.329', '121.330', '122.331', '123.332', '124.333', '125.334', '126.335', '127.336', '128.337', '129.338', '130.339', '131.340', '132.341', '133.342', '134.343', '135.344', '136.345', '137.346', '138.347', '139.348', '140.349', '141.350', '142.351', '143.352', '144.353', '145.354', '146.355', '147.356', '148.357', '149.358', '150.359', '151.360', '152.361', '153.362', '154.363', '155.364', '156.365', '157.366', '158.367', '159.368', '160.369', '161.370', '162.371', '163.372', '164.373', '165.374', '166.375', '167.376', '168.377', '169.378', '170.379', '171.380', '172.381', '173.382', '174.383', '175.384', '176.385', '177.386', '178.387', '179.388', '180.389', '181.390', '182.391', '183.392', '184.393', '185.394', '186.395', '187.396', '188.397', '189.398', '190.399', '191.400', '192.401', '193.402', '194.403', '195.404', '196.405', '197.406', '198.407', '199.408', '200.409', '201.410', '202.411', '203.412', '204.413', '205.414', '206.415', '207.416', '208.417', '209.418', '210.419', '211.420', '212.421', '213.422', '214.423', '215.424', '216.425', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.426', '238', '239', '240', '241', '242', '243', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468']), StandardNumbering(id='standardnumbering40', reference_id='BAH60832.1', numbered_id='EWC45326.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217.422', '218.423', '219.424', '220.425', '221.426', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.427', '238', '239', '240', '241', '242', '243', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '243.436', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469']), StandardNumbering(id='standardnumbering41', reference_id='BAH60832.1', numbered_id='KAF3930522.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19', '20', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.425', '238', '239', '240', '241', '242', '243', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467']), StandardNumbering(id='standardnumbering42', reference_id='BAH60832.1', numbered_id='KAF8249497.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5.196', '5.197', '5.198', '5.199', '5.200', '5.201', '6', '7', '7.202', '7.203', '7.204', '7.205', '7.206', '8', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '9', '10', '11', '12', '13', '14', '15.216', '16.217', '17.218', '18.219', '19.220', '20.221', '21.222', '22.223', '23.224', '24.225', '25.226', '26.227', '27.228', '28.229', '29.230', '30.231', '31.232', '32.233', '33.234', '34.235', '35.236', '36.237', '37.238', '38.239', '39.240', '40.241', '41.242', '42.243', '43.244', '44.245', '45.246', '46.247', '47.248', '48.249', '49.250', '50.251', '51.252', '52.253', '53.254', '54.255', '55.256', '56.257', '57.258', '58.259', '59.260', '60.261', '61.262', '62.263', '63.264', '64.265', '65.266', '66.267', '67.268', '68.269', '69.270', '70.271', '71.272', '72.273', '73.274', '74.275', '75.276', '76.277', '77.278', '78.279', '79.280', '80.281', '81.282', '82.283', '83.284', '84.285', '85.286', '86.287', '87.288', '88.289', '89.290', '90.291', '91.292', '92.293', '93.294', '94.295', '95.296', '96.297', '97.298', '98.299', '99.300', '100.301', '101.302', '102.303', '103.304', '104.305', '105.306', '106.307', '107.308', '108.309', '109.310', '110.311', '111.312', '112.313', '113.314', '114.315', '115.316', '116.317', '117.318', '118.319', '119.320', '120.321', '121.322', '122.323', '123.324', '124.325', '125.326', '126.327', '127.328', '128.329', '129.330', '130.331', '131.332', '132.333', '133.334', '134.335', '135.336', '136.337', '137.338', '138.339', '139.340', '140.341', '141.342', '142.343', '143.344', '144.345', '145.346', '146.347', '147.348', '148.349', '149.350', '150.351', '151.352', '152.353', '153.354', '154.355', '155.356', '156.357', '157.358', '158.359', '159.360', '160.361', '161.362', '162.363', '163.364', '164.365', '165.366', '166.367', '167.368', '168.369', '169.370', '170.371', '171.372', '172.373', '173.374', '174.375', '175.376', '176.377', '177.378', '178.379', '179.380', '180.381', '181.382', '182.383', '183.384', '184.385', '185.386', '186.387', '187.388', '188.389', '189.390', '190.391', '191.392', '192.393', '193.394', '194.395', '195.396', '196.397', '197.398', '198.399', '199.400', '200.401', '201.402', '202.403', '203.404', '204.405', '205.406', '206.407', '207.408', '208.409', '209.410', '210.411', '211.412', '212.413', '213.414', '214.415', '215.416', '216.417', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.418', '238', '239', '240', '241', '242', '243', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460']), StandardNumbering(id='standardnumbering43', reference_id='BAH60832.1', numbered_id='XP_002174495.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14', '15', '16', '17', '18', '19.212', '20.213', '21.214', '22.215', '23.216', '24.217', '25.218', '26.219', '27.220', '28.221', '29.222', '30.223', '31.224', '32.225', '33.226', '34.227', '35.228', '36.229', '37.230', '38.231', '39.232', '40.233', '41.234', '42.235', '43.236', '44.237', '45.238', '46.239', '47.240', '48.241', '49.242', '50.243', '51.244', '52.245', '53.246', '54.247', '55.248', '56.249', '57.250', '58.251', '59.252', '60.253', '61.254', '62.255', '63.256', '64.257', '65.258', '66.259', '67.260', '68.261', '69.262', '70.263', '71.264', '72.265', '73.266', '74.267', '75.268', '76.269', '77.270', '78.271', '79.272', '80.273', '81.274', '82.275', '83.276', '84.277', '85.278', '86.279', '87.280', '88.281', '89.282', '90.283', '91.284', '92.285', '93.286', '94.287', '95.288', '96.289', '97.290', '98.291', '99.292', '100.293', '101.294', '102.295', '103.296', '104.297', '105.298', '106.299', '107.300', '108.301', '109.302', '110.303', '111.304', '112.305', '113.306', '114.307', '115.308', '116.309', '117.310', '118.311', '119.312', '120.313', '121.314', '122.315', '123.316', '124.317', '125.318', '126.319', '127.320', '128.321', '129.322', '130.323', '131.324', '132.325', '133.326', '134.327', '135.328', '136.329', '137.330', '138.331', '139.332', '140.333', '141.334', '142.335', '143.336', '144.337', '145.338', '146.339', '147.340', '148.341', '149.342', '150.343', '151.344', '152.345', '153.346', '154.347', '155.348', '156.349', '157.350', '158.351', '159.352', '160.353', '161.354', '162.355', '163.356', '164.357', '165.358', '166.359', '167.360', '168.361', '169.362', '170.363', '171.364', '172.365', '173.366', '174.367', '175.368', '176.369', '177.370', '178.371', '179.372', '180.373', '181.374', '182.375', '183.376', '184.377', '185.378', '186.379', '187.380', '188.381', '189.382', '190.383', '191.384', '192.385', '193.386', '194.387', '195.388', '196.389', '197.390', '198.391', '199.392', '200.393', '201.394', '202.395', '203.396', '204.397', '205.398', '206.399', '207.400', '208.401', '209.402', '210.403', '211.404', '212.405', '213.406', '214.407', '215.408', '216.409', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.410', '238', '239', '240', '241', '242', '243', '243.411', '243.412', '243.413', '243.414', '243.415', '243.416', '243.417', '243.418', '243.419', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.420', '254.421', '254.422', '254.423', '254.424', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452']), StandardNumbering(id='standardnumbering44', reference_id='BAH60832.1', numbered_id='PRP83484.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5.196', '5.197', '5.198', '5.199', '5.200', '5.201', '6', '7', '7.202', '7.203', '7.204', '7.205', '7.206', '8', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '9', '10', '11', '12', '13', '14', '15', '16.216', '17.217', '18.218', '19.219', '20.220', '21.221', '22.222', '23.223', '24.224', '25.225', '26.226', '27.227', '28.228', '29.229', '30.230', '31.231', '32.232', '33.233', '34.234', '35.235', '36.236', '37.237', '38.238', '39.239', '40.240', '41.241', '42.242', '43.243', '44.244', '45.245', '46.246', '47.247', '48.248', '49.249', '50.250', '51.251', '52.252', '53.253', '54.254', '55.255', '56.256', '57.257', '58.258', '59.259', '60.260', '61.261', '62.262', '63.263', '64.264', '65.265', '66.266', '67.267', '68.268', '69.269', '70.270', '71.271', '72.272', '73.273', '74.274', '75.275', '76.276', '77.277', '78.278', '79.279', '80.280', '81.281', '82.282', '83.283', '84.284', '85.285', '86.286', '87.287', '88.288', '89.289', '90.290', '91.291', '92.292', '93.293', '94.294', '95.295', '96.296', '97.297', '98.298', '99.299', '100.300', '101.301', '102.302', '103.303', '104.304', '105.305', '106.306', '107.307', '108.308', '109.309', '110.310', '111.311', '112.312', '113.313', '114.314', '115.315', '116.316', '117.317', '118.318', '119.319', '120.320', '121.321', '122.322', '123.323', '124.324', '125.325', '126.326', '127.327', '128.328', '129.329', '130.330', '131.331', '132.332', '133.333', '134.334', '135.335', '136.336', '137.337', '138.338', '139.339', '140.340', '141.341', '142.342', '143.343', '144.344', '145.345', '146.346', '147.347', '148.348', '149.349', '150.350', '151.351', '152.352', '153.353', '154.354', '155.355', '156.356', '157.357', '158.358', '159.359', '160.360', '161.361', '162.362', '163.363', '164.364', '165.365', '166.366', '167.367', '168.368', '169.369', '170.370', '171.371', '172.372', '173.373', '174.374', '175.375', '176.376', '177.377', '178.378', '179.379', '180.380', '181.381', '182.382', '183.383', '184.384', '185.385', '186.386', '187.387', '188.388', '189.389', '190.390', '191.391', '192.392', '193.393', '194.394', '195.395', '196.396', '197.397', '198.398', '199.399', '200.400', '201.401', '202.402', '203.403', '204.404', '205.405', '206.406', '207.407', '208.408', '209.409', '210.410', '211.411', '212.412', '213.413', '214.414', '215.415', '216.416', '217.417', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.418', '238', '239', '240', '241', '242', '243', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460']), StandardNumbering(id='standardnumbering45', reference_id='BAH60832.1', numbered_id='GAA97202.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10.214', '11.215', '12.216', '13', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.420', '238', '239', '240', '241', '242', '243', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462']), StandardNumbering(id='standardnumbering46', reference_id='BAH60832.1', numbered_id='OBA26219.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1.181', '2.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '3.195', '4', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6.201', '7.202', '7.203', '7.204', '7.205', '7.206', '7.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '8.217', '9.218', '10.219', '11.220', '12.221', '13.222', '14.223', '15.224', '16.225', '17.226', '18.227', '19.228', '20.229', '21.230', '22.231', '23.232', '24.233', '25.234', '26.235', '27.236', '28.237', '29.238', '30.239', '31.240', '32.241', '33.242', '34.243', '35.244', '36.245', '37.246', '38.247', '39.248', '40.249', '41.250', '42.251', '43.252', '44.253', '45.254', '46.255', '47.256', '48.257', '49.258', '50.259', '51.260', '52.261', '53.262', '54.263', '55.264', '56.265', '57.266', '58.267', '59.268', '60.269', '61.270', '62.271', '63.272', '64.273', '65.274', '66.275', '67.276', '68.277', '69.278', '70.279', '71.280', '72.281', '73.282', '74.283', '75.284', '76.285', '77.286', '78.287', '79.288', '80.289', '81.290', '82.291', '83.292', '84.293', '85.294', '86.295', '87.296', '88.297', '89.298', '90.299', '91.300', '92.301', '93.302', '94.303', '95.304', '96.305', '97.306', '98.307', '99.308', '100.309', '101.310', '102.311', '103.312', '104.313', '105.314', '106.315', '107.316', '108.317', '109.318', '110.319', '111.320', '112.321', '113.322', '114.323', '115.324', '116.325', '117.326', '118.327', '119.328', '120.329', '121.330', '122.331', '123.332', '124.333', '125.334', '126.335', '127.336', '128.337', '129.338', '130.339', '131.340', '132.341', '133.342', '134.343', '135.344', '136.345', '137.346', '138.347', '139.348', '140.349', '141.350', '142.351', '143.352', '144.353', '145.354', '146.355', '147.356', '148.357', '149.358', '150.359', '151.360', '152.361', '153.362', '154.363', '155.364', '156.365', '157.366', '158.367', '159.368', '160.369', '161.370', '162.371', '163.372', '164.373', '165.374', '166.375', '167.376', '168.377', '169.378', '170.379', '171.380', '172.381', '173.382', '174.383', '175.384', '176.385', '177.386', '178.387', '179.388', '180.389', '181.390', '182.391', '183.392', '184.393', '185.394', '186.395', '187.396', '188.397', '189.398', '190.399', '191.400', '192.401', '193.402', '194.403', '195.404', '196.405', '197.406', '198.407', '199.408', '200.409', '201.410', '202.411', '203.412', '204.413', '205.414', '206.415', '207.416', '208.417', '209.418', '210.419', '211.420', '212.421', '213.422', '214.423', '215.424', '216.425', '217.426', '218.427', '219.428', '220.429', '221.430', '222.431', '223.432', '224.433', '225.434', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.435', '238', '239', '240', '241', '242', '243', '243.436', '243.437', '243.438', '243.439', '243.440', '243.441', '243.442', '243.443', '243.444', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477']), StandardNumbering(id='standardnumbering47', reference_id='BAH60832.1', numbered_id='KAI1823332.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering48', reference_id='BAH60832.1', numbered_id='CDO57487.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5.196', '5.197', '5.198', '5.199', '5.200', '5.201', '6', '7', '7.202', '7.203', '7.204', '7.205', '7.206', '8', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '9', '10', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering49', reference_id='BAH60832.1', numbered_id='KAI2629167.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.419', '238', '239', '240', '241', '242', '243', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461']), StandardNumbering(id='standardnumbering50', reference_id='BAH60832.1', numbered_id='KAI5811198.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9.215', '10.216', '11.217', '12.218', '13.219', '14.220', '15.221', '16.222', '17.223', '18.224', '19.225', '20.226', '21.227', '22.228', '23.229', '24.230', '25.231', '26.232', '27.233', '28.234', '29.235', '30.236', '31.237', '32.238', '33.239', '34.240', '35.241', '36.242', '37.243', '38.244', '39.245', '40.246', '41.247', '42.248', '43.249', '44.250', '45.251', '46.252', '47.253', '48.254', '49.255', '50.256', '51.257', '52.258', '53.259', '54.260', '55.261', '56.262', '57.263', '58.264', '59.265', '60.266', '61.267', '62.268', '63.269', '64.270', '65.271', '66.272', '67.273', '68.274', '69.275', '70.276', '71.277', '72.278', '73.279', '74.280', '75.281', '76.282', '77.283', '78.284', '79.285', '80.286', '81.287', '82.288', '83.289', '84.290', '85.291', '86.292', '87.293', '88.294', '89.295', '90.296', '91.297', '92.298', '93.299', '94.300', '95.301', '96.302', '97.303', '98.304', '99.305', '100.306', '101.307', '102.308', '103.309', '104.310', '105.311', '106.312', '107.313', '108.314', '109.315', '110.316', '111.317', '112.318', '113.319', '114.320', '115.321', '116.322', '117.323', '118.324', '119.325', '120.326', '121.327', '122.328', '123.329', '124.330', '125.331', '126.332', '127.333', '128.334', '129.335', '130.336', '131.337', '132.338', '133.339', '134.340', '135.341', '136.342', '137.343', '138.344', '139.345', '140.346', '141.347', '142.348', '143.349', '144.350', '145.351', '146.352', '147.353', '148.354', '149.355', '150.356', '151.357', '152.358', '153.359', '154.360', '155.361', '156.362', '157.363', '158.364', '159.365', '160.366', '161.367', '162.368', '163.369', '164.370', '165.371', '166.372', '167.373', '168.374', '169.375', '170.376', '171.377', '172.378', '173.379', '174.380', '175.381', '176.382', '177.383', '178.384', '179.385', '180.386', '181.387', '182.388', '183.389', '184.390', '185.391', '186.392', '187.393', '188.394', '189.395', '190.396', '191.397', '192.398', '193.399', '194.400', '195.401', '196.402', '197.403', '198.404', '199.405', '200.406', '201.407', '202.408', '203.409', '204.410', '205.411', '206.412', '207.413', '208.414', '209.415', '210.416', '211.417', '212.418', '213.419', '214.420', '215.421', '216.422', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.423', '238', '239', '240', '241', '242', '243', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465']), StandardNumbering(id='standardnumbering51', reference_id='BAH60832.1', numbered_id='KAG9017701.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10.214', '11.215', '12.216', '13', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.420', '238', '239', '240', '241', '242', '243', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462']), StandardNumbering(id='standardnumbering52', reference_id='BAH60832.1', numbered_id='OTA67948.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.419', '238', '239', '240', '241', '242', '243', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461']), StandardNumbering(id='standardnumbering53', reference_id='BAH60832.1', numbered_id='KAH6626466.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6.201', '7.202', '7.203', '7.204', '7.205', '7.206', '7.207', '8', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '9', '10', '11.217', '12.218', '13.219', '14.220', '15.221', '16.222', '17.223', '18.224', '19.225', '20.226', '21.227', '22.228', '23.229', '24.230', '25.231', '26.232', '27.233', '28.234', '29.235', '30.236', '31.237', '32.238', '33.239', '34.240', '35.241', '36.242', '37.243', '38.244', '39.245', '40.246', '41.247', '42.248', '43.249', '44.250', '45.251', '46.252', '47.253', '48.254', '49.255', '50.256', '51.257', '52.258', '53.259', '54.260', '55.261', '56.262', '57.263', '58.264', '59.265', '60.266', '61.267', '62.268', '63.269', '64.270', '65.271', '66.272', '67.273', '68.274', '69.275', '70.276', '71.277', '72.278', '73.279', '74.280', '75.281', '76.282', '77.283', '78.284', '79.285', '80.286', '81.287', '82.288', '83.289', '84.290', '85.291', '86.292', '87.293', '88.294', '89.295', '90.296', '91.297', '92.298', '93.299', '94.300', '95.301', '96.302', '97.303', '98.304', '99.305', '100.306', '101.307', '102.308', '103.309', '104.310', '105.311', '106.312', '107.313', '108.314', '109.315', '110.316', '111.317', '112.318', '113.319', '114.320', '115.321', '116.322', '117.323', '118.324', '119.325', '120.326', '121.327', '122.328', '123.329', '124.330', '125.331', '126.332', '127.333', '128.334', '129.335', '130.336', '131.337', '132.338', '133.339', '134.340', '135.341', '136.342', '137.343', '138.344', '139.345', '140.346', '141.347', '142.348', '143.349', '144.350', '145.351', '146.352', '147.353', '148.354', '149.355', '150.356', '151.357', '152.358', '153.359', '154.360', '155.361', '156.362', '157.363', '158.364', '159.365', '160.366', '161.367', '162.368', '163.369', '164.370', '165.371', '166.372', '167.373', '168.374', '169.375', '170.376', '171.377', '172.378', '173.379', '174.380', '175.381', '176.382', '177.383', '178.384', '179.385', '180.386', '181.387', '182.388', '183.389', '184.390', '185.391', '186.392', '187.393', '188.394', '189.395', '190.396', '191.397', '192.398', '193.399', '194.400', '195.401', '196.402', '197.403', '198.404', '199.405', '200.406', '201.407', '202.408', '203.409', '204.410', '205.411', '206.412', '207.413', '208.414', '209.415', '210.416', '211.417', '212.418', '213.419', '214.420', '215.421', '216.422', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.423', '238', '239', '240', '241', '242', '243', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465']), StandardNumbering(id='standardnumbering54', reference_id='BAH60832.1', numbered_id='ORX96310.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14', '15', '16', '17.212', '18.213', '19.214', '20.215', '21.216', '22.217', '23.218', '24.219', '25.220', '26.221', '27.222', '28.223', '29.224', '30.225', '31.226', '32.227', '33.228', '34.229', '35.230', '36.231', '37.232', '38.233', '39.234', '40.235', '41.236', '42.237', '43.238', '44.239', '45.240', '46.241', '47.242', '48.243', '49.244', '50.245', '51.246', '52.247', '53.248', '54.249', '55.250', '56.251', '57.252', '58.253', '59.254', '60.255', '61.256', '62.257', '63.258', '64.259', '65.260', '66.261', '67.262', '68.263', '69.264', '70.265', '71.266', '72.267', '73.268', '74.269', '75.270', '76.271', '77.272', '78.273', '79.274', '80.275', '81.276', '82.277', '83.278', '84.279', '85.280', '86.281', '87.282', '88.283', '89.284', '90.285', '91.286', '92.287', '93.288', '94.289', '95.290', '96.291', '97.292', '98.293', '99.294', '100.295', '101.296', '102.297', '103.298', '104.299', '105.300', '106.301', '107.302', '108.303', '109.304', '110.305', '111.306', '112.307', '113.308', '114.309', '115.310', '116.311', '117.312', '118.313', '119.314', '120.315', '121.316', '122.317', '123.318', '124.319', '125.320', '126.321', '127.322', '128.323', '129.324', '130.325', '131.326', '132.327', '133.328', '134.329', '135.330', '136.331', '137.332', '138.333', '139.334', '140.335', '141.336', '142.337', '143.338', '144.339', '145.340', '146.341', '147.342', '148.343', '149.344', '150.345', '151.346', '152.347', '153.348', '154.349', '155.350', '156.351', '157.352', '158.353', '159.354', '160.355', '161.356', '162.357', '163.358', '164.359', '165.360', '166.361', '167.362', '168.363', '169.364', '170.365', '171.366', '172.367', '173.368', '174.369', '175.370', '176.371', '177.372', '178.373', '179.374', '180.375', '181.376', '182.377', '183.378', '184.379', '185.380', '186.381', '187.382', '188.383', '189.384', '190.385', '191.386', '192.387', '193.388', '194.389', '195.390', '196.391', '197.392', '198.393', '199.394', '200.395', '201.396', '202.397', '203.398', '204.399', '205.400', '206.401', '207.402', '208.403', '209.404', '210.405', '211.406', '212.407', '213.408', '214.409', '215.410', '216.411', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.412', '238', '239', '240', '241', '242', '243', '243.413', '243.414', '243.415', '243.416', '243.417', '243.418', '243.419', '243.420', '243.421', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.422', '254.423', '254.424', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454']), StandardNumbering(id='standardnumbering55', reference_id='BAH60832.1', numbered_id='XP_028477951.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '4', '5', '5.194', '5.195', '5.196', '5.197', '5.198', '6', '7', '7.199', '7.200', '7.201', '7.202', '7.203', '8', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '9.213', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.420', '238', '239', '240', '241', '242', '243', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462']), StandardNumbering(id='standardnumbering56', reference_id='BAH60832.1', numbered_id='XP_024666830.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11.212', '12.213', '13.214', '14.215', '15.216', '16.217', '17.218', '18.219', '19.220', '20.221', '21.222', '22.223', '23.224', '24.225', '25.226', '26.227', '27.228', '28.229', '29.230', '30.231', '31.232', '32.233', '33.234', '34.235', '35.236', '36.237', '37.238', '38.239', '39.240', '40.241', '41.242', '42.243', '43.244', '44.245', '45.246', '46.247', '47.248', '48.249', '49.250', '50.251', '51.252', '52.253', '53.254', '54.255', '55.256', '56.257', '57.258', '58.259', '59.260', '60.261', '61.262', '62.263', '63.264', '64.265', '65.266', '66.267', '67.268', '68.269', '69.270', '70.271', '71.272', '72.273', '73.274', '74.275', '75.276', '76.277', '77.278', '78.279', '79.280', '80.281', '81.282', '82.283', '83.284', '84.285', '85.286', '86.287', '87.288', '88.289', '89.290', '90.291', '91.292', '92.293', '93.294', '94.295', '95.296', '96.297', '97.298', '98.299', '99.300', '100.301', '101.302', '102.303', '103.304', '104.305', '105.306', '106.307', '107.308', '108.309', '109.310', '110.311', '111.312', '112.313', '113.314', '114.315', '115.316', '116.317', '117.318', '118.319', '119.320', '120.321', '121.322', '122.323', '123.324', '124.325', '125.326', '126.327', '127.328', '128.329', '129.330', '130.331', '131.332', '132.333', '133.334', '134.335', '135.336', '136.337', '137.338', '138.339', '139.340', '140.341', '141.342', '142.343', '143.344', '144.345', '145.346', '146.347', '147.348', '148.349', '149.350', '150.351', '151.352', '152.353', '153.354', '154.355', '155.356', '156.357', '157.358', '158.359', '159.360', '160.361', '161.362', '162.363', '163.364', '164.365', '165.366', '166.367', '167.368', '168.369', '169.370', '170.371', '171.372', '172.373', '173.374', '174.375', '175.376', '176.377', '177.378', '178.379', '179.380', '180.381', '181.382', '182.383', '183.384', '184.385', '185.386', '186.387', '187.388', '188.389', '189.390', '190.391', '191.392', '192.393', '193.394', '194.395', '195.396', '196.397', '197.398', '198.399', '199.400', '200.401', '201.402', '202.403', '203.404', '204.405', '205.406', '206.407', '207.408', '208.409', '209.410', '210.411', '211.412', '212.413', '213.414', '214.415', '215.416', '216.417', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.418', '238', '239', '240', '241', '242', '243', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460']), StandardNumbering(id='standardnumbering57', reference_id='BAH60832.1', numbered_id='KAI0099584.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.419', '238', '239', '240', '241', '242', '243', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461']), StandardNumbering(id='standardnumbering58', reference_id='BAH60832.1', numbered_id='KAI1801530.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.419', '238', '239', '240', '241', '242', '243', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461']), StandardNumbering(id='standardnumbering59', reference_id='BAH60832.1', numbered_id='KAF9351078.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14', '15.212', '16.213', '17.214', '18.215', '19.216', '20.217', '21.218', '22.219', '23.220', '24.221', '25.222', '26.223', '27.224', '28.225', '29.226', '30.227', '31.228', '32.229', '33.230', '34.231', '35.232', '36.233', '37.234', '38.235', '39.236', '40.237', '41.238', '42.239', '43.240', '44.241', '45.242', '46.243', '47.244', '48.245', '49.246', '50.247', '51.248', '52.249', '53.250', '54.251', '55.252', '56.253', '57.254', '58.255', '59.256', '60.257', '61.258', '62.259', '63.260', '64.261', '65.262', '66.263', '67.264', '68.265', '69.266', '70.267', '71.268', '72.269', '73.270', '74.271', '75.272', '76.273', '77.274', '78.275', '79.276', '80.277', '81.278', '82.279', '83.280', '84.281', '85.282', '86.283', '87.284', '88.285', '89.286', '90.287', '91.288', '92.289', '93.290', '94.291', '95.292', '96.293', '97.294', '98.295', '99.296', '100.297', '101.298', '102.299', '103.300', '104.301', '105.302', '106.303', '107.304', '108.305', '109.306', '110.307', '111.308', '112.309', '113.310', '114.311', '115.312', '116.313', '117.314', '118.315', '119.316', '120.317', '121.318', '122.319', '123.320', '124.321', '125.322', '126.323', '127.324', '128.325', '129.326', '130.327', '131.328', '132.329', '133.330', '134.331', '135.332', '136.333', '137.334', '138.335', '139.336', '140.337', '141.338', '142.339', '143.340', '144.341', '145.342', '146.343', '147.344', '148.345', '149.346', '150.347', '151.348', '152.349', '153.350', '154.351', '155.352', '156.353', '157.354', '158.355', '159.356', '160.357', '161.358', '162.359', '163.360', '164.361', '165.362', '166.363', '167.364', '168.365', '169.366', '170.367', '171.368', '172.369', '173.370', '174.371', '175.372', '176.373', '177.374', '178.375', '179.376', '180.377', '181.378', '182.379', '183.380', '184.381', '185.382', '186.383', '187.384', '188.385', '189.386', '190.387', '191.388', '192.389', '193.390', '194.391', '195.392', '196.393', '197.394', '198.395', '199.396', '200.397', '201.398', '202.399', '203.400', '204.401', '205.402', '206.403', '207.404', '208.405', '209.406', '210.407', '211.408', '212.409', '213.410', '214.411', '215.412', '216.413', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.414', '238', '239', '240', '241', '242', '243', '243.415', '243.416', '243.417', '243.418', '243.419', '243.420', '243.421', '243.422', '243.423', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.424', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456']), StandardNumbering(id='standardnumbering60', reference_id='BAH60832.1', numbered_id='KAF9160900.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11', '12', '13', '14', '15', '16', '17', '18.214', '19.215', '20', '21', '22.216', '23.217', '24.218', '25.219', '26.220', '27.221', '28.222', '29.223', '30.224', '31.225', '32.226', '33.227', '34.228', '35.229', '36.230', '37.231', '38.232', '39.233', '40.234', '41.235', '42.236', '43.237', '44.238', '45.239', '46.240', '47.241', '48.242', '49.243', '50.244', '51.245', '52.246', '53.247', '54.248', '55.249', '56.250', '57.251', '58.252', '59.253', '60.254', '61.255', '62.256', '63.257', '64.258', '65.259', '66.260', '67.261', '68.262', '69.263', '70.264', '71.265', '72.266', '73.267', '74.268', '75.269', '76.270', '77.271', '78.272', '79.273', '80.274', '81.275', '82.276', '83.277', '84.278', '85.279', '86.280', '87.281', '88.282', '89.283', '90.284', '91.285', '92.286', '93.287', '94.288', '95.289', '96.290', '97.291', '98.292', '99.293', '100.294', '101.295', '102.296', '103.297', '104.298', '105.299', '106.300', '107.301', '108.302', '109.303', '110.304', '111.305', '112.306', '113.307', '114.308', '115.309', '116.310', '117.311', '118.312', '119.313', '120.314', '121.315', '122.316', '123.317', '124.318', '125.319', '126.320', '127.321', '128.322', '129.323', '130.324', '131.325', '132.326', '133.327', '134.328', '135.329', '136.330', '137.331', '138.332', '139.333', '140.334', '141.335', '142.336', '143.337', '144.338', '145.339', '146.340', '147.341', '148.342', '149.343', '150.344', '151.345', '152.346', '153.347', '154.348', '155.349', '156.350', '157.351', '158.352', '159.353', '160.354', '161.355', '162.356', '163.357', '164.358', '165.359', '166.360', '167.361', '168.362', '169.363', '170.364', '171.365', '172.366', '173.367', '174.368', '175.369', '176.370', '177.371', '178.372', '179.373', '180.374', '181.375', '182.376', '183.377', '184.378', '185.379', '186.380', '187.381', '188.382', '189.383', '190.384', '191.385', '192.386', '193.387', '194.388', '195.389', '196.390', '197.391', '198.392', '199.393', '200.394', '201.395', '202.396', '203.397', '204.398', '205.399', '206.400', '207.401', '208.402', '209.403', '210.404', '211.405', '212.406', '213.407', '214.408', '215.409', '216.410', '217.411', '218.412', '219.413', '220.414', '221.415', '222.416', '223.417', '224.418', '225.419', '226.420', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.421', '238', '239', '240', '241', '242', '243', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463']), StandardNumbering(id='standardnumbering61', reference_id='BAH60832.1', numbered_id='KAG0263740.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11', '12', '13', '14', '15.214', '16.215', '17.216', '18.217', '19.218', '20', '21', '22.219', '23.220', '24.221', '25.222', '26.223', '27.224', '28.225', '29.226', '30.227', '31.228', '32.229', '33.230', '34.231', '35.232', '36.233', '37.234', '38.235', '39.236', '40.237', '41.238', '42.239', '43.240', '44.241', '45.242', '46.243', '47.244', '48.245', '49.246', '50.247', '51.248', '52.249', '53.250', '54.251', '55.252', '56.253', '57.254', '58.255', '59.256', '60.257', '61.258', '62.259', '63.260', '64.261', '65.262', '66.263', '67.264', '68.265', '69.266', '70.267', '71.268', '72.269', '73.270', '74.271', '75.272', '76.273', '77.274', '78.275', '79.276', '80.277', '81.278', '82.279', '83.280', '84.281', '85.282', '86.283', '87.284', '88.285', '89.286', '90.287', '91.288', '92.289', '93.290', '94.291', '95.292', '96.293', '97.294', '98.295', '99.296', '100.297', '101.298', '102.299', '103.300', '104.301', '105.302', '106.303', '107.304', '108.305', '109.306', '110.307', '111.308', '112.309', '113.310', '114.311', '115.312', '116.313', '117.314', '118.315', '119.316', '120.317', '121.318', '122.319', '123.320', '124.321', '125.322', '126.323', '127.324', '128.325', '129.326', '130.327', '131.328', '132.329', '133.330', '134.331', '135.332', '136.333', '137.334', '138.335', '139.336', '140.337', '141.338', '142.339', '143.340', '144.341', '145.342', '146.343', '147.344', '148.345', '149.346', '150.347', '151.348', '152.349', '153.350', '154.351', '155.352', '156.353', '157.354', '158.355', '159.356', '160.357', '161.358', '162.359', '163.360', '164.361', '165.362', '166.363', '167.364', '168.365', '169.366', '170.367', '171.368', '172.369', '173.370', '174.371', '175.372', '176.373', '177.374', '178.375', '179.376', '180.377', '181.378', '182.379', '183.380', '184.381', '185.382', '186.383', '187.384', '188.385', '189.386', '190.387', '191.388', '192.389', '193.390', '194.391', '195.392', '196.393', '197.394', '198.395', '199.396', '200.397', '201.398', '202.399', '203.400', '204.401', '205.402', '206.403', '207.404', '208.405', '209.406', '210.407', '211.408', '212.409', '213.410', '214.411', '215.412', '216.413', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.414', '238', '239', '240', '241', '242', '243', '243.415', '243.416', '243.417', '243.418', '243.419', '243.420', '243.421', '243.422', '243.423', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.424', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456']), StandardNumbering(id='standardnumbering62', reference_id='BAH60832.1', numbered_id='KAI1135662.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.419', '238', '239', '240', '241', '242', '243', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461']), StandardNumbering(id='standardnumbering63', reference_id='BAH60832.1', numbered_id='XP_045969802.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11', '12', '13', '14.214', '15.215', '16.216', '17.217', '18.218', '19.219', '20.220', '21.221', '22.222', '23.223', '24.224', '25.225', '26.226', '27.227', '28.228', '29.229', '30.230', '31.231', '32.232', '33.233', '34.234', '35.235', '36.236', '37.237', '38.238', '39.239', '40.240', '41.241', '42.242', '43.243', '44.244', '45.245', '46.246', '47.247', '48.248', '49.249', '50.250', '51.251', '52.252', '53.253', '54.254', '55.255', '56.256', '57.257', '58.258', '59.259', '60.260', '61.261', '62.262', '63.263', '64.264', '65.265', '66.266', '67.267', '68.268', '69.269', '70.270', '71.271', '72.272', '73.273', '74.274', '75.275', '76.276', '77.277', '78.278', '79.279', '80.280', '81.281', '82.282', '83.283', '84.284', '85.285', '86.286', '87.287', '88.288', '89.289', '90.290', '91.291', '92.292', '93.293', '94.294', '95.295', '96.296', '97.297', '98.298', '99.299', '100.300', '101.301', '102.302', '103.303', '104.304', '105.305', '106.306', '107.307', '108.308', '109.309', '110.310', '111.311', '112.312', '113.313', '114.314', '115.315', '116.316', '117.317', '118.318', '119.319', '120.320', '121.321', '122.322', '123.323', '124.324', '125.325', '126.326', '127.327', '128.328', '129.329', '130.330', '131.331', '132.332', '133.333', '134.334', '135.335', '136.336', '137.337', '138.338', '139.339', '140.340', '141.341', '142.342', '143.343', '144.344', '145.345', '146.346', '147.347', '148.348', '149.349', '150.350', '151.351', '152.352', '153.353', '154.354', '155.355', '156.356', '157.357', '158.358', '159.359', '160.360', '161.361', '162.362', '163.363', '164.364', '165.365', '166.366', '167.367', '168.368', '169.369', '170.370', '171.371', '172.372', '173.373', '174.374', '175.375', '176.376', '177.377', '178.378', '179.379', '180.380', '181.381', '182.382', '183.383', '184.384', '185.385', '186.386', '187.387', '188.388', '189.389', '190.390', '191.391', '192.392', '193.393', '194.394', '195.395', '196.396', '197.397', '198.398', '199.399', '200.400', '201.401', '202.402', '203.403', '204.404', '205.405', '206.406', '207.407', '208.408', '209.409', '210.410', '211.411', '212.412', '213.413', '214.414', '215.415', '216.416', '217.417', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.418', '238', '239', '240', '241', '242', '243', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460']), StandardNumbering(id='standardnumbering64', reference_id='BAH60832.1', numbered_id='KAI1414505.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.419', '238', '239', '240', '241', '242', '243', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461']), StandardNumbering(id='standardnumbering65', reference_id='BAH60832.1', numbered_id='KAG0239750.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11', '12', '13', '14', '15.214', '16.215', '17.216', '18.217', '19.218', '20.219', '21.220', '22.221', '23.222', '24.223', '25.224', '26.225', '27.226', '28.227', '29.228', '30.229', '31.230', '32.231', '33.232', '34.233', '35.234', '36.235', '37.236', '38.237', '39.238', '40.239', '41.240', '42.241', '43.242', '44.243', '45.244', '46.245', '47.246', '48.247', '49.248', '50.249', '51.250', '52.251', '53.252', '54.253', '55.254', '56.255', '57.256', '58.257', '59.258', '60.259', '61.260', '62.261', '63.262', '64.263', '65.264', '66.265', '67.266', '68.267', '69.268', '70.269', '71.270', '72.271', '73.272', '74.273', '75.274', '76.275', '77.276', '78.277', '79.278', '80.279', '81.280', '82.281', '83.282', '84.283', '85.284', '86.285', '87.286', '88.287', '89.288', '90.289', '91.290', '92.291', '93.292', '94.293', '95.294', '96.295', '97.296', '98.297', '99.298', '100.299', '101.300', '102.301', '103.302', '104.303', '105.304', '106.305', '107.306', '108.307', '109.308', '110.309', '111.310', '112.311', '113.312', '114.313', '115.314', '116.315', '117.316', '118.317', '119.318', '120.319', '121.320', '122.321', '123.322', '124.323', '125.324', '126.325', '127.326', '128.327', '129.328', '130.329', '131.330', '132.331', '133.332', '134.333', '135.334', '136.335', '137.336', '138.337', '139.338', '140.339', '141.340', '142.341', '143.342', '144.343', '145.344', '146.345', '147.346', '148.347', '149.348', '150.349', '151.350', '152.351', '153.352', '154.353', '155.354', '156.355', '157.356', '158.357', '159.358', '160.359', '161.360', '162.361', '163.362', '164.363', '165.364', '166.365', '167.366', '168.367', '169.368', '170.369', '171.370', '172.371', '173.372', '174.373', '175.374', '176.375', '177.376', '178.377', '179.378', '180.379', '181.380', '182.381', '183.382', '184.383', '185.384', '186.385', '187.386', '188.387', '189.388', '190.389', '191.390', '192.391', '193.392', '194.393', '195.394', '196.395', '197.396', '198.397', '199.398', '200.399', '201.400', '202.401', '203.402', '204.403', '205.404', '206.405', '207.406', '208.407', '209.408', '210.409', '211.410', '212.411', '213.412', '214.413', '215.414', '216.415', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.416', '238', '239', '240', '241', '242', '243', '243.417', '243.418', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458']), StandardNumbering(id='standardnumbering66', reference_id='BAH60832.1', numbered_id='XP_044688071.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11', '12', '13', '14.214', '15.215', '16.216', '17.217', '18.218', '19.219', '20.220', '21.221', '22.222', '23.223', '24.224', '25.225', '26.226', '27.227', '28.228', '29.229', '30.230', '31.231', '32.232', '33.233', '34.234', '35.235', '36.236', '37.237', '38.238', '39.239', '40.240', '41.241', '42.242', '43.243', '44.244', '45.245', '46.246', '47.247', '48.248', '49.249', '50.250', '51.251', '52.252', '53.253', '54.254', '55.255', '56.256', '57.257', '58.258', '59.259', '60.260', '61.261', '62.262', '63.263', '64.264', '65.265', '66.266', '67.267', '68.268', '69.269', '70.270', '71.271', '72.272', '73.273', '74.274', '75.275', '76.276', '77.277', '78.278', '79.279', '80.280', '81.281', '82.282', '83.283', '84.284', '85.285', '86.286', '87.287', '88.288', '89.289', '90.290', '91.291', '92.292', '93.293', '94.294', '95.295', '96.296', '97.297', '98.298', '99.299', '100.300', '101.301', '102.302', '103.303', '104.304', '105.305', '106.306', '107.307', '108.308', '109.309', '110.310', '111.311', '112.312', '113.313', '114.314', '115.315', '116.316', '117.317', '118.318', '119.319', '120.320', '121.321', '122.322', '123.323', '124.324', '125.325', '126.326', '127.327', '128.328', '129.329', '130.330', '131.331', '132.332', '133.333', '134.334', '135.335', '136.336', '137.337', '138.338', '139.339', '140.340', '141.341', '142.342', '143.343', '144.344', '145.345', '146.346', '147.347', '148.348', '149.349', '150.350', '151.351', '152.352', '153.353', '154.354', '155.355', '156.356', '157.357', '158.358', '159.359', '160.360', '161.361', '162.362', '163.363', '164.364', '165.365', '166.366', '167.367', '168.368', '169.369', '170.370', '171.371', '172.372', '173.373', '174.374', '175.375', '176.376', '177.377', '178.378', '179.379', '180.380', '181.381', '182.382', '183.383', '184.384', '185.385', '186.386', '187.387', '188.388', '189.389', '190.390', '191.391', '192.392', '193.393', '194.394', '195.395', '196.396', '197.397', '198.398', '199.399', '200.400', '201.401', '202.402', '203.403', '204.404', '205.405', '206.406', '207.407', '208.408', '209.409', '210.410', '211.411', '212.412', '213.413', '214.414', '215.415', '216.416', '217.417', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.418', '238', '239', '240', '241', '242', '243', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460']), StandardNumbering(id='standardnumbering67', reference_id='BAH60832.1', numbered_id='RPB01516.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '4.194', '5.195', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10', '11', '12', '13', '14', '15', '16.215', '17.216', '18.217', '19.218', '20.219', '21.220', '22.221', '23.222', '24.223', '25.224', '26.225', '27.226', '28.227', '29.228', '30.229', '31.230', '32.231', '33.232', '34.233', '35.234', '36.235', '37.236', '38.237', '39.238', '40.239', '41.240', '42.241', '43.242', '44.243', '45.244', '46.245', '47.246', '48.247', '49.248', '50.249', '51.250', '52.251', '53.252', '54.253', '55.254', '56.255', '57.256', '58.257', '59.258', '60.259', '61.260', '62.261', '63.262', '64.263', '65.264', '66.265', '67.266', '68.267', '69.268', '70.269', '71.270', '72.271', '73.272', '74.273', '75.274', '76.275', '77.276', '78.277', '79.278', '80.279', '81.280', '82.281', '83.282', '84.283', '85.284', '86.285', '87.286', '88.287', '89.288', '90.289', '91.290', '92.291', '93.292', '94.293', '95.294', '96.295', '97.296', '98.297', '99.298', '100.299', '101.300', '102.301', '103.302', '104.303', '105.304', '106.305', '107.306', '108.307', '109.308', '110.309', '111.310', '112.311', '113.312', '114.313', '115.314', '116.315', '117.316', '118.317', '119.318', '120.319', '121.320', '122.321', '123.322', '124.323', '125.324', '126.325', '127.326', '128.327', '129.328', '130.329', '131.330', '132.331', '133.332', '134.333', '135.334', '136.335', '137.336', '138.337', '139.338', '140.339', '141.340', '142.341', '143.342', '144.343', '145.344', '146.345', '147.346', '148.347', '149.348', '150.349', '151.350', '152.351', '153.352', '154.353', '155.354', '156.355', '157.356', '158.357', '159.358', '160.359', '161.360', '162.361', '163.362', '164.363', '165.364', '166.365', '167.366', '168.367', '169.368', '170.369', '171.370', '172.371', '173.372', '174.373', '175.374', '176.375', '177.376', '178.377', '179.378', '180.379', '181.380', '182.381', '183.382', '184.383', '185.384', '186.385', '187.386', '188.387', '189.388', '190.389', '191.390', '192.391', '193.392', '194.393', '195.394', '196.395', '197.396', '198.397', '199.398', '200.399', '201.400', '202.401', '203.402', '204.403', '205.404', '206.405', '207.406', '208.407', '209.408', '210.409', '211.410', '212.411', '213.412', '214.413', '215.414', '216.415', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.416', '238', '239', '240', '241', '242', '243', '243.417', '243.418', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458']), StandardNumbering(id='standardnumbering68', reference_id='BAH60832.1', numbered_id='KAG0236582.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11', '12', '13', '14', '15', '16.214', '17.215', '18.216', '19.217', '20', '21', '22.218', '23.219', '24.220', '25.221', '26.222', '27.223', '28.224', '29.225', '30.226', '31.227', '32.228', '33.229', '34.230', '35.231', '36.232', '37.233', '38.234', '39.235', '40.236', '41.237', '42.238', '43.239', '44.240', '45.241', '46.242', '47.243', '48.244', '49.245', '50.246', '51.247', '52.248', '53.249', '54.250', '55.251', '56.252', '57.253', '58.254', '59.255', '60.256', '61.257', '62.258', '63.259', '64.260', '65.261', '66.262', '67.263', '68.264', '69.265', '70.266', '71.267', '72.268', '73.269', '74.270', '75.271', '76.272', '77.273', '78.274', '79.275', '80.276', '81.277', '82.278', '83.279', '84.280', '85.281', '86.282', '87.283', '88.284', '89.285', '90.286', '91.287', '92.288', '93.289', '94.290', '95.291', '96.292', '97.293', '98.294', '99.295', '100.296', '101.297', '102.298', '103.299', '104.300', '105.301', '106.302', '107.303', '108.304', '109.305', '110.306', '111.307', '112.308', '113.309', '114.310', '115.311', '116.312', '117.313', '118.314', '119.315', '120.316', '121.317', '122.318', '123.319', '124.320', '125.321', '126.322', '127.323', '128.324', '129.325', '130.326', '131.327', '132.328', '133.329', '134.330', '135.331', '136.332', '137.333', '138.334', '139.335', '140.336', '141.337', '142.338', '143.339', '144.340', '145.341', '146.342', '147.343', '148.344', '149.345', '150.346', '151.347', '152.348', '153.349', '154.350', '155.351', '156.352', '157.353', '158.354', '159.355', '160.356', '161.357', '162.358', '163.359', '164.360', '165.361', '166.362', '167.363', '168.364', '169.365', '170.366', '171.367', '172.368', '173.369', '174.370', '175.371', '176.372', '177.373', '178.374', '179.375', '180.376', '181.377', '182.378', '183.379', '184.380', '185.381', '186.382', '187.383', '188.384', '189.385', '190.386', '191.387', '192.388', '193.389', '194.390', '195.391', '196.392', '197.393', '198.394', '199.395', '200.396', '201.397', '202.398', '203.399', '204.400', '205.401', '206.402', '207.403', '208.404', '209.405', '210.406', '211.407', '212.408', '213.409', '214.410', '215.411', '216', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.412', '238', '239', '240', '241', '242', '243', '243.413', '243.414', '243.415', '243.416', '243.417', '243.418', '243.419', '243.420', '243.421', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.422', '254.423', '254.424', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454']), StandardNumbering(id='standardnumbering69', reference_id='BAH60832.1', numbered_id='KAH6640987.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6.201', '7.202', '7.203', '7.204', '7.205', '7.206', '7.207', '8', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '9', '10', '11.217', '12.218', '13.219', '14.220', '15.221', '16.222', '17.223', '18.224', '19.225', '20.226', '21.227', '22.228', '23.229', '24.230', '25.231', '26.232', '27.233', '28.234', '29.235', '30.236', '31.237', '32.238', '33.239', '34.240', '35.241', '36.242', '37.243', '38.244', '39.245', '40.246', '41.247', '42.248', '43.249', '44.250', '45.251', '46.252', '47.253', '48.254', '49.255', '50.256', '51.257', '52.258', '53.259', '54.260', '55.261', '56.262', '57.263', '58.264', '59.265', '60.266', '61.267', '62.268', '63.269', '64.270', '65.271', '66.272', '67.273', '68.274', '69.275', '70.276', '71.277', '72.278', '73.279', '74.280', '75.281', '76.282', '77.283', '78.284', '79.285', '80.286', '81.287', '82.288', '83.289', '84.290', '85.291', '86.292', '87.293', '88.294', '89.295', '90.296', '91.297', '92.298', '93.299', '94.300', '95.301', '96.302', '97.303', '98.304', '99.305', '100.306', '101.307', '102.308', '103.309', '104.310', '105.311', '106.312', '107.313', '108.314', '109.315', '110.316', '111.317', '112.318', '113.319', '114.320', '115.321', '116.322', '117.323', '118.324', '119.325', '120.326', '121.327', '122.328', '123.329', '124.330', '125.331', '126.332', '127.333', '128.334', '129.335', '130.336', '131.337', '132.338', '133.339', '134.340', '135.341', '136.342', '137.343', '138.344', '139.345', '140.346', '141.347', '142.348', '143.349', '144.350', '145.351', '146.352', '147.353', '148.354', '149.355', '150.356', '151.357', '152.358', '153.359', '154.360', '155.361', '156.362', '157.363', '158.364', '159.365', '160.366', '161.367', '162.368', '163.369', '164.370', '165.371', '166.372', '167.373', '168.374', '169.375', '170.376', '171.377', '172.378', '173.379', '174.380', '175.381', '176.382', '177.383', '178.384', '179.385', '180.386', '181.387', '182.388', '183.389', '184.390', '185.391', '186.392', '187.393', '188.394', '189.395', '190.396', '191.397', '192.398', '193.399', '194.400', '195.401', '196.402', '197.403', '198.404', '199.405', '200.406', '201.407', '202.408', '203.409', '204.410', '205.411', '206.412', '207.413', '208.414', '209.415', '210.416', '211.417', '212.418', '213.419', '214.420', '215.421', '216.422', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.423', '238', '239', '240', '241', '242', '243', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465']), StandardNumbering(id='standardnumbering70', reference_id='BAH60832.1', numbered_id='XP_002493958.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.420', '238', '239', '240', '241', '242', '243', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462']), StandardNumbering(id='standardnumbering71', reference_id='BAH60832.1', numbered_id='KAA8914877.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5.196', '5.197', '5.198', '5.199', '5.200', '5.201', '6', '7', '7.202', '7.203', '7.204', '7.205', '7.206', '8', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '9', '10.216', '11.217', '12.218', '13', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering72', reference_id='BAH60832.1', numbered_id='XP_018701974.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5.196', '5.197', '5.198', '5.199', '5.200', '5.201', '6.202', '7.203', '7.204', '7.205', '7.206', '7.207', '7.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '8.217', '8.218', '9.219', '10.220', '11.221', '12.222', '13.223', '14.224', '15.225', '16.226', '17.227', '18.228', '19.229', '20.230', '21.231', '22.232', '23.233', '24.234', '25.235', '26.236', '27.237', '28.238', '29.239', '30.240', '31.241', '32.242', '33.243', '34.244', '35.245', '36.246', '37.247', '38.248', '39.249', '40.250', '41.251', '42.252', '43.253', '44.254', '45.255', '46.256', '47.257', '48.258', '49.259', '50.260', '51.261', '52.262', '53.263', '54.264', '55.265', '56.266', '57.267', '58.268', '59.269', '60.270', '61.271', '62.272', '63.273', '64.274', '65.275', '66.276', '67.277', '68.278', '69.279', '70.280', '71.281', '72.282', '73.283', '74.284', '75.285', '76.286', '77.287', '78.288', '79.289', '80.290', '81.291', '82.292', '83.293', '84.294', '85.295', '86.296', '87.297', '88.298', '89.299', '90.300', '91.301', '92.302', '93.303', '94.304', '95.305', '96.306', '97.307', '98.308', '99.309', '100.310', '101.311', '102.312', '103.313', '104.314', '105.315', '106.316', '107.317', '108.318', '109.319', '110.320', '111.321', '112.322', '113.323', '114.324', '115.325', '116.326', '117.327', '118.328', '119.329', '120.330', '121.331', '122.332', '123.333', '124.334', '125.335', '126.336', '127.337', '128.338', '129.339', '130.340', '131.341', '132.342', '133.343', '134.344', '135.345', '136.346', '137.347', '138.348', '139.349', '140.350', '141.351', '142.352', '143.353', '144.354', '145.355', '146.356', '147.357', '148.358', '149.359', '150.360', '151.361', '152.362', '153.363', '154.364', '155.365', '156.366', '157.367', '158.368', '159.369', '160.370', '161.371', '162.372', '163.373', '164.374', '165.375', '166.376', '167.377', '168.378', '169.379', '170.380', '171.381', '172.382', '173.383', '174.384', '175.385', '176.386', '177.387', '178.388', '179.389', '180.390', '181.391', '182.392', '183.393', '184.394', '185.395', '186.396', '187.397', '188.398', '189.399', '190.400', '191.401', '192.402', '193.403', '194.404', '195.405', '196.406', '197.407', '198.408', '199.409', '200.410', '201.411', '202.412', '203.413', '204.414', '205.415', '206.416', '207.417', '208.418', '209.419', '210.420', '211.421', '212.422', '213.423', '214.424', '215.425', '216.426', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.427', '238', '239', '240', '241', '242', '243', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '243.436', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469']), StandardNumbering(id='standardnumbering73', reference_id='BAH60832.1', numbered_id='KAI2643608.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering74', reference_id='BAH60832.1', numbered_id='KAG0125076.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '4.194', '5.195', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10', '11', '12', '13', '14', '15', '16.215', '17.216', '18.217', '19.218', '20.219', '21.220', '22.221', '23.222', '24.223', '25.224', '26.225', '27.226', '28.227', '29.228', '30.229', '31.230', '32.231', '33.232', '34.233', '35.234', '36.235', '37.236', '38.237', '39.238', '40.239', '41.240', '42.241', '43.242', '44.243', '45.244', '46.245', '47.246', '48.247', '49.248', '50.249', '51.250', '52.251', '53.252', '54.253', '55.254', '56.255', '57.256', '58.257', '59.258', '60.259', '61.260', '62.261', '63.262', '64.263', '65.264', '66.265', '67.266', '68.267', '69.268', '70.269', '71.270', '72.271', '73.272', '74.273', '75.274', '76.275', '77.276', '78.277', '79.278', '80.279', '81.280', '82.281', '83.282', '84.283', '85.284', '86.285', '87.286', '88.287', '89.288', '90.289', '91.290', '92.291', '93.292', '94.293', '95.294', '96.295', '97.296', '98.297', '99.298', '100.299', '101.300', '102.301', '103.302', '104.303', '105.304', '106.305', '107.306', '108.307', '109.308', '110.309', '111.310', '112.311', '113.312', '114.313', '115.314', '116.315', '117.316', '118.317', '119.318', '120.319', '121.320', '122.321', '123.322', '124.323', '125.324', '126.325', '127.326', '128.327', '129.328', '130.329', '131.330', '132.331', '133.332', '134.333', '135.334', '136.335', '137.336', '138.337', '139.338', '140.339', '141.340', '142.341', '143.342', '144.343', '145.344', '146.345', '147.346', '148.347', '149.348', '150.349', '151.350', '152.351', '153.352', '154.353', '155.354', '156.355', '157.356', '158.357', '159.358', '160.359', '161.360', '162.361', '163.362', '164.363', '165.364', '166.365', '167.366', '168.367', '169.368', '170.369', '171.370', '172.371', '173.372', '174.373', '175.374', '176.375', '177.376', '178.377', '179.378', '180.379', '181.380', '182.381', '183.382', '184.383', '185.384', '186.385', '187.386', '188.387', '189.388', '190.389', '191.390', '192.391', '193.392', '194.393', '195.394', '196.395', '197.396', '198.397', '199.398', '200.399', '201.400', '202.401', '203.402', '204.403', '205.404', '206.405', '207.406', '208.407', '209.408', '210.409', '211.410', '212.411', '213.412', '214.413', '215.414', '216.415', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.416', '238', '239', '240', '241', '242', '243', '243.417', '243.418', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458']), StandardNumbering(id='standardnumbering75', reference_id='BAH60832.1', numbered_id='KAH9904989.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5.196', '5.197', '5.198', '5.199', '5.200', '5.201', '6', '7', '7.202', '7.203', '7.204', '7.205', '7.206', '8', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '9', '10.216', '11.217', '12.218', '13', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering76', reference_id='BAH60832.1', numbered_id='VEU24358.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1.181', '2.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '3.195', '4.196', '5.197', '5.198', '5.199', '5.200', '5.201', '5.202', '6', '7', '7.203', '7.204', '7.205', '7.206', '7.207', '8', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '9.217', '10.218', '11.219', '12.220', '13.221', '14.222', '15.223', '16.224', '17.225', '18.226', '19.227', '20.228', '21.229', '22.230', '23.231', '24.232', '25.233', '26.234', '27.235', '28.236', '29.237', '30.238', '31.239', '32.240', '33.241', '34.242', '35.243', '36.244', '37.245', '38.246', '39.247', '40.248', '41.249', '42.250', '43.251', '44.252', '45.253', '46.254', '47.255', '48.256', '49.257', '50.258', '51.259', '52.260', '53.261', '54.262', '55.263', '56.264', '57.265', '58.266', '59.267', '60.268', '61.269', '62.270', '63.271', '64.272', '65.273', '66.274', '67.275', '68.276', '69.277', '70.278', '71.279', '72.280', '73.281', '74.282', '75.283', '76.284', '77.285', '78.286', '79.287', '80.288', '81.289', '82.290', '83.291', '84.292', '85.293', '86.294', '87.295', '88.296', '89.297', '90.298', '91.299', '92.300', '93.301', '94.302', '95.303', '96.304', '97.305', '98.306', '99.307', '100.308', '101.309', '102.310', '103.311', '104.312', '105.313', '106.314', '107.315', '108.316', '109.317', '110.318', '111.319', '112.320', '113.321', '114.322', '115.323', '116.324', '117.325', '118.326', '119.327', '120.328', '121.329', '122.330', '123.331', '124.332', '125.333', '126.334', '127.335', '128.336', '129.337', '130.338', '131.339', '132.340', '133.341', '134.342', '135.343', '136.344', '137.345', '138.346', '139.347', '140.348', '141.349', '142.350', '143.351', '144.352', '145.353', '146.354', '147.355', '148.356', '149.357', '150.358', '151.359', '152.360', '153.361', '154.362', '155.363', '156.364', '157.365', '158.366', '159.367', '160.368', '161.369', '162.370', '163.371', '164.372', '165.373', '166.374', '167.375', '168.376', '169.377', '170.378', '171.379', '172.380', '173.381', '174.382', '175.383', '176.384', '177.385', '178.386', '179.387', '180.388', '181.389', '182.390', '183.391', '184.392', '185.393', '186.394', '187.395', '188.396', '189.397', '190.398', '191.399', '192.400', '193.401', '194.402', '195.403', '196.404', '197.405', '198.406', '199.407', '200.408', '201.409', '202.410', '203.411', '204.412', '205.413', '206.414', '207.415', '208.416', '209.417', '210.418', '211.419', '212.420', '213.421', '214.422', '215.423', '216.424', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.425', '238', '239', '240', '241', '242', '243', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467']), StandardNumbering(id='standardnumbering77', reference_id='BAH60832.1', numbered_id='KAI1283572.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering78', reference_id='BAH60832.1', numbered_id='KAI1500557.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering79', reference_id='BAH60832.1', numbered_id='KAI2623093.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.419', '238', '239', '240', '241', '242', '243', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461']), StandardNumbering(id='standardnumbering80', reference_id='BAH60832.1', numbered_id='NP_593285.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14', '15', '16', '17', '18', '19.212', '20.213', '21.214', '22.215', '23.216', '24.217', '25.218', '26.219', '27.220', '28.221', '29.222', '30.223', '31.224', '32.225', '33.226', '34.227', '35.228', '36.229', '37.230', '38.231', '39.232', '40.233', '41.234', '42.235', '43.236', '44.237', '45.238', '46.239', '47.240', '48.241', '49.242', '50.243', '51.244', '52.245', '53.246', '54.247', '55.248', '56.249', '57.250', '58.251', '59.252', '60.253', '61.254', '62.255', '63.256', '64.257', '65.258', '66.259', '67.260', '68.261', '69.262', '70.263', '71.264', '72.265', '73.266', '74.267', '75.268', '76.269', '77.270', '78.271', '79.272', '80.273', '81.274', '82.275', '83.276', '84.277', '85.278', '86.279', '87.280', '88.281', '89.282', '90.283', '91.284', '92.285', '93.286', '94.287', '95.288', '96.289', '97.290', '98.291', '99.292', '100.293', '101.294', '102.295', '103.296', '104.297', '105.298', '106.299', '107.300', '108.301', '109.302', '110.303', '111.304', '112.305', '113.306', '114.307', '115.308', '116.309', '117.310', '118.311', '119.312', '120.313', '121.314', '122.315', '123.316', '124.317', '125.318', '126.319', '127.320', '128.321', '129.322', '130.323', '131.324', '132.325', '133.326', '134.327', '135.328', '136.329', '137.330', '138.331', '139.332', '140.333', '141.334', '142.335', '143.336', '144.337', '145.338', '146.339', '147.340', '148.341', '149.342', '150.343', '151.344', '152.345', '153.346', '154.347', '155.348', '156.349', '157.350', '158.351', '159.352', '160.353', '161.354', '162.355', '163.356', '164.357', '165.358', '166.359', '167.360', '168.361', '169.362', '170.363', '171.364', '172.365', '173.366', '174.367', '175.368', '176.369', '177.370', '178.371', '179.372', '180.373', '181.374', '182.375', '183.376', '184.377', '185.378', '186.379', '187.380', '188.381', '189.382', '190.383', '191.384', '192.385', '193.386', '194.387', '195.388', '196.389', '197.390', '198.391', '199.392', '200.393', '201.394', '202.395', '203.396', '204.397', '205.398', '206.399', '207.400', '208.401', '209.402', '210.403', '211.404', '212.405', '213.406', '214.407', '215.408', '216.409', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.410', '238', '239', '240', '241', '242', '243', '243.411', '243.412', '243.413', '243.414', '243.415', '243.416', '243.417', '243.418', '243.419', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.420', '254.421', '254.422', '254.423', '254.424', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452']), StandardNumbering(id='standardnumbering81', reference_id='BAH60832.1', numbered_id='KAI0431960.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering82', reference_id='BAH60832.1', numbered_id='KAH8926511.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '9.213', '10.214', '11', '12', '13', '14', '15', '16.215', '17.216', '18.217', '19.218', '20.219', '21.220', '22.221', '23.222', '24.223', '25.224', '26.225', '27.226', '28.227', '29.228', '30.229', '31.230', '32.231', '33.232', '34.233', '35.234', '36.235', '37.236', '38.237', '39.238', '40.239', '41.240', '42.241', '43.242', '44.243', '45.244', '46.245', '47.246', '48.247', '49.248', '50.249', '51.250', '52.251', '53.252', '54.253', '55.254', '56.255', '57.256', '58.257', '59.258', '60.259', '61.260', '62.261', '63.262', '64.263', '65.264', '66.265', '67.266', '68.267', '69.268', '70.269', '71.270', '72.271', '73.272', '74.273', '75.274', '76.275', '77.276', '78.277', '79.278', '80.279', '81.280', '82.281', '83.282', '84.283', '85.284', '86.285', '87.286', '88.287', '89.288', '90.289', '91.290', '92.291', '93.292', '94.293', '95.294', '96.295', '97.296', '98.297', '99.298', '100.299', '101.300', '102.301', '103.302', '104.303', '105.304', '106.305', '107.306', '108.307', '109.308', '110.309', '111.310', '112.311', '113.312', '114.313', '115.314', '116.315', '117.316', '118.317', '119.318', '120.319', '121.320', '122.321', '123.322', '124.323', '125.324', '126.325', '127.326', '128.327', '129.328', '130.329', '131.330', '132.331', '133.332', '134.333', '135.334', '136.335', '137.336', '138.337', '139.338', '140.339', '141.340', '142.341', '143.342', '144.343', '145.344', '146.345', '147.346', '148.347', '149.348', '150.349', '151.350', '152.351', '153.352', '154.353', '155.354', '156.355', '157.356', '158.357', '159.358', '160.359', '161.360', '162.361', '163.362', '164.363', '165.364', '166.365', '167.366', '168.367', '169.368', '170.369', '171.370', '172.371', '173.372', '174.373', '175.374', '176.375', '177.376', '178.377', '179.378', '180.379', '181.380', '182.381', '183.382', '184.383', '185.384', '186.385', '187.386', '188.387', '189.388', '190.389', '191.390', '192.391', '193.392', '194.393', '195.394', '196.395', '197.396', '198.397', '199.398', '200.399', '201.400', '202.401', '203.402', '204.403', '205.404', '206.405', '207.406', '208.407', '209.408', '210.409', '211.410', '212.411', '213.412', '214.413', '215.414', '216.415', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.416', '238', '239', '240', '241', '242', '243', '243.417', '243.418', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458']), StandardNumbering(id='standardnumbering83', reference_id='BAH60832.1', numbered_id='RMJ24013.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '4', '5', '5.194', '5.195', '5.196', '5.197', '5.198', '6', '7', '7.199', '7.200', '7.201', '7.202', '7.203', '8', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '9.213', '10.214', '11.215', '12.216', '13.217', '14.218', '15.219', '16.220', '17.221', '18.222', '19.223', '20.224', '21.225', '22.226', '23.227', '24.228', '25.229', '26.230', '27.231', '28.232', '29.233', '30.234', '31.235', '32.236', '33.237', '34.238', '35.239', '36.240', '37.241', '38.242', '39.243', '40.244', '41.245', '42.246', '43.247', '44.248', '45.249', '46.250', '47.251', '48.252', '49.253', '50.254', '51.255', '52.256', '53.257', '54.258', '55.259', '56.260', '57.261', '58.262', '59.263', '60.264', '61.265', '62.266', '63.267', '64.268', '65.269', '66.270', '67.271', '68.272', '69.273', '70.274', '71.275', '72.276', '73.277', '74.278', '75.279', '76.280', '77.281', '78.282', '79.283', '80.284', '81.285', '82.286', '83.287', '84.288', '85.289', '86.290', '87.291', '88.292', '89.293', '90.294', '91.295', '92.296', '93.297', '94.298', '95.299', '96.300', '97.301', '98.302', '99.303', '100.304', '101.305', '102.306', '103.307', '104.308', '105.309', '106.310', '107.311', '108.312', '109.313', '110.314', '111.315', '112.316', '113.317', '114.318', '115.319', '116.320', '117.321', '118.322', '119.323', '120.324', '121.325', '122.326', '123.327', '124.328', '125.329', '126.330', '127.331', '128.332', '129.333', '130.334', '131.335', '132.336', '133.337', '134.338', '135.339', '136.340', '137.341', '138.342', '139.343', '140.344', '141.345', '142.346', '143.347', '144.348', '145.349', '146.350', '147.351', '148.352', '149.353', '150.354', '151.355', '152.356', '153.357', '154.358', '155.359', '156.360', '157.361', '158.362', '159.363', '160.364', '161.365', '162.366', '163.367', '164.368', '165.369', '166.370', '167.371', '168.372', '169.373', '170.374', '171.375', '172.376', '173.377', '174.378', '175.379', '176.380', '177.381', '178.382', '179.383', '180.384', '181.385', '182.386', '183.387', '184.388', '185.389', '186.390', '187.391', '188.392', '189.393', '190.394', '191.395', '192.396', '193.397', '194.398', '195.399', '196.400', '197.401', '198.402', '199.403', '200.404', '201.405', '202.406', '203.407', '204.408', '205.409', '206.410', '207.411', '208.412', '209.413', '210.414', '211.415', '212.416', '213.417', '214.418', '215.419', '216.420', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.421', '238', '239', '240', '241', '242', '243', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463']), StandardNumbering(id='standardnumbering84', reference_id='BAH60832.1', numbered_id='KAF8931046.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11', '12', '13', '14', '15', '16', '17', '18.214', '19.215', '20', '21', '22.216', '23.217', '24.218', '25.219', '26.220', '27.221', '28.222', '29.223', '30.224', '31.225', '32.226', '33.227', '34.228', '35.229', '36.230', '37.231', '38.232', '39.233', '40.234', '41.235', '42.236', '43.237', '44.238', '45.239', '46.240', '47.241', '48.242', '49.243', '50.244', '51.245', '52.246', '53.247', '54.248', '55.249', '56.250', '57.251', '58.252', '59.253', '60.254', '61.255', '62.256', '63.257', '64.258', '65.259', '66.260', '67.261', '68.262', '69.263', '70.264', '71.265', '72.266', '73.267', '74.268', '75.269', '76.270', '77.271', '78.272', '79.273', '80.274', '81.275', '82.276', '83.277', '84.278', '85.279', '86.280', '87.281', '88.282', '89.283', '90.284', '91.285', '92.286', '93.287', '94.288', '95.289', '96.290', '97.291', '98.292', '99.293', '100.294', '101.295', '102.296', '103.297', '104.298', '105.299', '106.300', '107.301', '108.302', '109.303', '110.304', '111.305', '112.306', '113.307', '114.308', '115.309', '116.310', '117.311', '118.312', '119.313', '120.314', '121.315', '122.316', '123.317', '124.318', '125.319', '126.320', '127.321', '128.322', '129.323', '130.324', '131.325', '132.326', '133.327', '134.328', '135.329', '136.330', '137.331', '138.332', '139.333', '140.334', '141.335', '142.336', '143.337', '144.338', '145.339', '146.340', '147.341', '148.342', '149.343', '150.344', '151.345', '152.346', '153.347', '154.348', '155.349', '156.350', '157.351', '158.352', '159.353', '160.354', '161.355', '162.356', '163.357', '164.358', '165.359', '166.360', '167.361', '168.362', '169.363', '170.364', '171.365', '172.366', '173.367', '174.368', '175.369', '176.370', '177.371', '178.372', '179.373', '180.374', '181.375', '182.376', '183.377', '184.378', '185.379', '186.380', '187.381', '188.382', '189.383', '190.384', '191.385', '192.386', '193.387', '194.388', '195.389', '196.390', '197.391', '198.392', '199.393', '200.394', '201.395', '202.396', '203.397', '204.398', '205.399', '206.400', '207.401', '208.402', '209.403', '210.404', '211.405', '212.406', '213.407', '214.408', '215.409', '216.410', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.411', '238', '239', '240', '241', '242', '243', '243.412', '243.413', '243.414', '243.415', '243.416', '243.417', '243.418', '243.419', '243.420', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.421', '254.422', '254.423', '254.424', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453']), StandardNumbering(id='standardnumbering85', reference_id='BAH60832.1', numbered_id='ODQ76250.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14.212', '15.213', '16.214', '17.215', '18.216', '19.217', '20.218', '21.219', '22.220', '23.221', '24.222', '25.223', '26.224', '27.225', '28.226', '29.227', '30.228', '31.229', '32.230', '33.231', '34.232', '35.233', '36.234', '37.235', '38.236', '39.237', '40.238', '41.239', '42.240', '43.241', '44.242', '45.243', '46.244', '47.245', '48.246', '49.247', '50.248', '51.249', '52.250', '53.251', '54.252', '55.253', '56.254', '57.255', '58.256', '59.257', '60.258', '61.259', '62.260', '63.261', '64.262', '65.263', '66.264', '67.265', '68.266', '69.267', '70.268', '71.269', '72.270', '73.271', '74.272', '75.273', '76.274', '77.275', '78.276', '79.277', '80.278', '81.279', '82.280', '83.281', '84.282', '85.283', '86.284', '87.285', '88.286', '89.287', '90.288', '91.289', '92.290', '93.291', '94.292', '95.293', '96.294', '97.295', '98.296', '99.297', '100.298', '101.299', '102.300', '103.301', '104.302', '105.303', '106.304', '107.305', '108.306', '109.307', '110.308', '111.309', '112.310', '113.311', '114.312', '115.313', '116.314', '117.315', '118.316', '119.317', '120.318', '121.319', '122.320', '123.321', '124.322', '125.323', '126.324', '127.325', '128.326', '129.327', '130.328', '131.329', '132.330', '133.331', '134.332', '135.333', '136.334', '137.335', '138.336', '139.337', '140.338', '141.339', '142.340', '143.341', '144.342', '145.343', '146.344', '147.345', '148.346', '149.347', '150.348', '151.349', '152.350', '153.351', '154.352', '155.353', '156.354', '157.355', '158.356', '159.357', '160.358', '161.359', '162.360', '163.361', '164.362', '165.363', '166.364', '167.365', '168.366', '169.367', '170.368', '171.369', '172.370', '173.371', '174.372', '175.373', '176.374', '177.375', '178.376', '179.377', '180.378', '181.379', '182.380', '183.381', '184.382', '185.383', '186.384', '187.385', '188.386', '189.387', '190.388', '191.389', '192.390', '193.391', '194.392', '195.393', '196.394', '197.395', '198.396', '199.397', '200.398', '201.399', '202.400', '203.401', '204.402', '205.403', '206.404', '207.405', '208.406', '209.407', '210.408', '211.409', '212.410', '213.411', '214.412', '215.413', '216.414', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.415', '238', '239', '240', '241', '242', '243', '243.416', '243.417', '243.418', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457']), StandardNumbering(id='standardnumbering86', reference_id='BAH60832.1', numbered_id='KXJ93426.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5.196', '5.197', '5.198', '5.199', '5.200', '5.201', '6', '7', '7.202', '7.203', '7.204', '7.205', '7.206', '8', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '9', '10.216', '11.217', '12.218', '13.219', '14.220', '15.221', '16.222', '17.223', '18.224', '19.225', '20.226', '21.227', '22.228', '23.229', '24.230', '25.231', '26.232', '27.233', '28.234', '29.235', '30.236', '31.237', '32.238', '33.239', '34.240', '35.241', '36.242', '37.243', '38.244', '39.245', '40.246', '41.247', '42.248', '43.249', '44.250', '45.251', '46.252', '47.253', '48.254', '49.255', '50.256', '51.257', '52.258', '53.259', '54.260', '55.261', '56.262', '57.263', '58.264', '59.265', '60.266', '61.267', '62.268', '63.269', '64.270', '65.271', '66.272', '67.273', '68.274', '69.275', '70.276', '71.277', '72.278', '73.279', '74.280', '75.281', '76.282', '77.283', '78.284', '79.285', '80.286', '81.287', '82.288', '83.289', '84.290', '85.291', '86.292', '87.293', '88.294', '89.295', '90.296', '91.297', '92.298', '93.299', '94.300', '95.301', '96.302', '97.303', '98.304', '99.305', '100.306', '101.307', '102.308', '103.309', '104.310', '105.311', '106.312', '107.313', '108.314', '109.315', '110.316', '111.317', '112.318', '113.319', '114.320', '115.321', '116.322', '117.323', '118.324', '119.325', '120.326', '121.327', '122.328', '123.329', '124.330', '125.331', '126.332', '127.333', '128.334', '129.335', '130.336', '131.337', '132.338', '133.339', '134.340', '135.341', '136.342', '137.343', '138.344', '139.345', '140.346', '141.347', '142.348', '143.349', '144.350', '145.351', '146.352', '147.353', '148.354', '149.355', '150.356', '151.357', '152.358', '153.359', '154.360', '155.361', '156.362', '157.363', '158.364', '159.365', '160.366', '161.367', '162.368', '163.369', '164.370', '165.371', '166.372', '167.373', '168.374', '169.375', '170.376', '171.377', '172.378', '173.379', '174.380', '175.381', '176.382', '177.383', '178.384', '179.385', '180.386', '181.387', '182.388', '183.389', '184.390', '185.391', '186.392', '187.393', '188.394', '189.395', '190.396', '191.397', '192.398', '193.399', '194.400', '195.401', '196.402', '197.403', '198.404', '199.405', '200.406', '201.407', '202.408', '203.409', '204.410', '205.411', '206.412', '207.413', '208.414', '209.415', '210.416', '211.417', '212.418', '213.419', '214.420', '215.421', '216.422', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.423', '238', '239', '240', '241', '242', '243', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465']), StandardNumbering(id='standardnumbering87', reference_id='BAH60832.1', numbered_id='XP_051368163.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.420', '238', '239', '240', '241', '242', '243', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462']), StandardNumbering(id='standardnumbering88', reference_id='BAH60832.1', numbered_id='GES63634.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering89', reference_id='BAH60832.1', numbered_id='RPA74746.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '4', '5', '5.194', '5.195', '5.196', '5.197', '5.198', '6', '7', '7.199', '7.200', '7.201', '7.202', '7.203', '8', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '9', '10', '11.213', '12.214', '13.215', '14.216', '15.217', '16.218', '17.219', '18.220', '19.221', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.419', '238', '239', '240', '241', '242', '243', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461']), StandardNumbering(id='standardnumbering90', reference_id='BAH60832.1', numbered_id='XP_024675402.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering91', reference_id='BAH60832.1', numbered_id='KAH6850716.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6.201', '7.202', '7.203', '7.204', '7.205', '7.206', '7.207', '8', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '9', '10', '11.217', '12.218', '13.219', '14.220', '15.221', '16.222', '17.223', '18.224', '19.225', '20.226', '21.227', '22.228', '23.229', '24.230', '25.231', '26.232', '27.233', '28.234', '29.235', '30.236', '31.237', '32.238', '33.239', '34.240', '35.241', '36.242', '37.243', '38.244', '39.245', '40.246', '41.247', '42.248', '43.249', '44.250', '45.251', '46.252', '47.253', '48.254', '49.255', '50.256', '51.257', '52.258', '53.259', '54.260', '55.261', '56.262', '57.263', '58.264', '59.265', '60.266', '61.267', '62.268', '63.269', '64.270', '65.271', '66.272', '67.273', '68.274', '69.275', '70.276', '71.277', '72.278', '73.279', '74.280', '75.281', '76.282', '77.283', '78.284', '79.285', '80.286', '81.287', '82.288', '83.289', '84.290', '85.291', '86.292', '87.293', '88.294', '89.295', '90.296', '91.297', '92.298', '93.299', '94.300', '95.301', '96.302', '97.303', '98.304', '99.305', '100.306', '101.307', '102.308', '103.309', '104.310', '105.311', '106.312', '107.313', '108.314', '109.315', '110.316', '111.317', '112.318', '113.319', '114.320', '115.321', '116.322', '117.323', '118.324', '119.325', '120.326', '121.327', '122.328', '123.329', '124.330', '125.331', '126.332', '127.333', '128.334', '129.335', '130.336', '131.337', '132.338', '133.339', '134.340', '135.341', '136.342', '137.343', '138.344', '139.345', '140.346', '141.347', '142.348', '143.349', '144.350', '145.351', '146.352', '147.353', '148.354', '149.355', '150.356', '151.357', '152.358', '153.359', '154.360', '155.361', '156.362', '157.363', '158.364', '159.365', '160.366', '161.367', '162.368', '163.369', '164.370', '165.371', '166.372', '167.373', '168.374', '169.375', '170.376', '171.377', '172.378', '173.379', '174.380', '175.381', '176.382', '177.383', '178.384', '179.385', '180.386', '181.387', '182.388', '183.389', '184.390', '185.391', '186.392', '187.393', '188.394', '189.395', '190.396', '191.397', '192.398', '193.399', '194.400', '195.401', '196.402', '197.403', '198.404', '199.405', '200.406', '201.407', '202.408', '203.409', '204.410', '205.411', '206.412', '207.413', '208.414', '209.415', '210.416', '211.417', '212.418', '213.419', '214.420', '215.421', '216.422', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.423', '238', '239', '240', '241', '242', '243', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465']), StandardNumbering(id='standardnumbering92', reference_id='BAH60832.1', numbered_id='PHH71636.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10', '11.215', '12.216', '13.217', '14.218', '15.219', '16.220', '17.221', '18.222', '19.223', '20.224', '21.225', '22.226', '23.227', '24.228', '25.229', '26.230', '27.231', '28.232', '29.233', '30.234', '31.235', '32.236', '33.237', '34.238', '35.239', '36.240', '37.241', '38.242', '39.243', '40.244', '41.245', '42.246', '43.247', '44.248', '45.249', '46.250', '47.251', '48.252', '49.253', '50.254', '51.255', '52.256', '53.257', '54.258', '55.259', '56.260', '57.261', '58.262', '59.263', '60.264', '61.265', '62.266', '63.267', '64.268', '65.269', '66.270', '67.271', '68.272', '69.273', '70.274', '71.275', '72.276', '73.277', '74.278', '75.279', '76.280', '77.281', '78.282', '79.283', '80.284', '81.285', '82.286', '83.287', '84.288', '85.289', '86.290', '87.291', '88.292', '89.293', '90.294', '91.295', '92.296', '93.297', '94.298', '95.299', '96.300', '97.301', '98.302', '99.303', '100.304', '101.305', '102.306', '103.307', '104.308', '105.309', '106.310', '107.311', '108.312', '109.313', '110.314', '111.315', '112.316', '113.317', '114.318', '115.319', '116.320', '117.321', '118.322', '119.323', '120.324', '121.325', '122.326', '123.327', '124.328', '125.329', '126.330', '127.331', '128.332', '129.333', '130.334', '131.335', '132.336', '133.337', '134.338', '135.339', '136.340', '137.341', '138.342', '139.343', '140.344', '141.345', '142.346', '143.347', '144.348', '145.349', '146.350', '147.351', '148.352', '149.353', '150.354', '151.355', '152.356', '153.357', '154.358', '155.359', '156.360', '157.361', '158.362', '159.363', '160.364', '161.365', '162.366', '163.367', '164.368', '165.369', '166.370', '167.371', '168.372', '169.373', '170.374', '171.375', '172.376', '173.377', '174.378', '175.379', '176.380', '177.381', '178.382', '179.383', '180.384', '181.385', '182.386', '183.387', '184.388', '185.389', '186.390', '187.391', '188.392', '189.393', '190.394', '191.395', '192.396', '193.397', '194.398', '195.399', '196.400', '197.401', '198.402', '199.403', '200.404', '201.405', '202.406', '203.407', '204.408', '205.409', '206.410', '207.411', '208.412', '209.413', '210.414', '211.415', '212.416', '213.417', '214.418', '215.419', '216.420', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.421', '238', '239', '240', '241', '242', '243', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463']), StandardNumbering(id='standardnumbering93', reference_id='BAH60832.1', numbered_id='KAJ3562589.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217.422', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.423', '238', '239', '240', '241', '242', '243', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465']), StandardNumbering(id='standardnumbering94', reference_id='BAH60832.1', numbered_id='RDA84390.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.420', '238', '239', '240', '241', '242', '243', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462']), StandardNumbering(id='standardnumbering95', reference_id='BAH60832.1', numbered_id='XP_007413704.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6.198', '7.199', '7.200', '7.201', '7.202', '7.203', '7.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9.215', '10.216', '11.217', '12.218', '13.219', '14.220', '15.221', '16.222', '17.223', '18.224', '19.225', '20.226', '21.227', '22.228', '23.229', '24.230', '25.231', '26.232', '27.233', '28.234', '29.235', '30.236', '31.237', '32.238', '33.239', '34.240', '35.241', '36.242', '37.243', '38.244', '39.245', '40.246', '41.247', '42.248', '43.249', '44.250', '45.251', '46.252', '47.253', '48.254', '49.255', '50.256', '51.257', '52.258', '53.259', '54.260', '55.261', '56.262', '57.263', '58.264', '59.265', '60.266', '61.267', '62.268', '63.269', '64.270', '65.271', '66.272', '67.273', '68.274', '69.275', '70.276', '71.277', '72.278', '73.279', '74.280', '75.281', '76.282', '77.283', '78.284', '79.285', '80.286', '81.287', '82.288', '83.289', '84.290', '85.291', '86.292', '87.293', '88.294', '89.295', '90.296', '91.297', '92.298', '93.299', '94.300', '95.301', '96.302', '97.303', '98.304', '99.305', '100.306', '101.307', '102.308', '103.309', '104.310', '105.311', '106.312', '107.313', '108.314', '109.315', '110.316', '111.317', '112.318', '113.319', '114.320', '115.321', '116.322', '117.323', '118.324', '119.325', '120.326', '121.327', '122.328', '123.329', '124.330', '125.331', '126.332', '127.333', '128.334', '129.335', '130.336', '131.337', '132.338', '133.339', '134.340', '135.341', '136.342', '137.343', '138.344', '139.345', '140.346', '141.347', '142.348', '143.349', '144.350', '145.351', '146.352', '147.353', '148.354', '149.355', '150.356', '151.357', '152.358', '153.359', '154.360', '155.361', '156.362', '157.363', '158.364', '159.365', '160.366', '161.367', '162.368', '163.369', '164.370', '165.371', '166.372', '167.373', '168.374', '169.375', '170.376', '171.377', '172.378', '173.379', '174.380', '175.381', '176.382', '177.383', '178.384', '179.385', '180.386', '181.387', '182.388', '183.389', '184.390', '185.391', '186.392', '187.393', '188.394', '189.395', '190.396', '191.397', '192.398', '193.399', '194.400', '195.401', '196.402', '197.403', '198.404', '199.405', '200.406', '201.407', '202.408', '203.409', '204.410', '205.411', '206.412', '207.413', '208.414', '209.415', '210.416', '211.417', '212.418', '213.419', '214.420', '215.421', '216.422', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.423', '238', '239', '240', '241', '242', '243', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465']), StandardNumbering(id='standardnumbering96', reference_id='BAH60832.1', numbered_id='KAI0376630.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.420', '238', '239', '240', '241', '242', '243', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462']), StandardNumbering(id='standardnumbering97', reference_id='BAH60832.1', numbered_id='XP_047831721.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering98', reference_id='BAH60832.1', numbered_id='KAI9294962.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14', '15', '16', '17', '18', '19.212', '20.213', '21.214', '22.215', '23.216', '24.217', '25.218', '26.219', '27.220', '28.221', '29.222', '30.223', '31.224', '32.225', '33.226', '34.227', '35.228', '36.229', '37.230', '38.231', '39.232', '40.233', '41.234', '42.235', '43.236', '44.237', '45.238', '46.239', '47.240', '48.241', '49.242', '50.243', '51.244', '52.245', '53.246', '54.247', '55.248', '56.249', '57.250', '58.251', '59.252', '60.253', '61.254', '62.255', '63.256', '64.257', '65.258', '66.259', '67.260', '68.261', '69.262', '70.263', '71.264', '72.265', '73.266', '74.267', '75.268', '76.269', '77.270', '78.271', '79.272', '80.273', '81.274', '82.275', '83.276', '84.277', '85.278', '86.279', '87.280', '88.281', '89.282', '90.283', '91.284', '92.285', '93.286', '94.287', '95.288', '96.289', '97.290', '98.291', '99.292', '100.293', '101.294', '102.295', '103.296', '104.297', '105.298', '106.299', '107.300', '108.301', '109.302', '110.303', '111.304', '112.305', '113.306', '114.307', '115.308', '116.309', '117.310', '118.311', '119.312', '120.313', '121.314', '122.315', '123.316', '124.317', '125.318', '126.319', '127.320', '128.321', '129.322', '130.323', '131.324', '132.325', '133.326', '134.327', '135.328', '136.329', '137.330', '138.331', '139.332', '140.333', '141.334', '142.335', '143.336', '144.337', '145.338', '146.339', '147.340', '148.341', '149.342', '150.343', '151.344', '152.345', '153.346', '154.347', '155.348', '156.349', '157.350', '158.351', '159.352', '160.353', '161.354', '162.355', '163.356', '164.357', '165.358', '166.359', '167.360', '168.361', '169.362', '170.363', '171.364', '172.365', '173.366', '174.367', '175.368', '176.369', '177.370', '178.371', '179.372', '180.373', '181.374', '182.375', '183.376', '184.377', '185.378', '186.379', '187.380', '188.381', '189.382', '190.383', '191.384', '192.385', '193.386', '194.387', '195.388', '196.389', '197.390', '198.391', '199.392', '200.393', '201.394', '202.395', '203.396', '204.397', '205.398', '206.399', '207.400', '208.401', '209.402', '210.403', '211.404', '212.405', '213.406', '214.407', '215.408', '216.409', '217.410', '218.411', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.412', '238', '239', '240', '241', '242', '243', '243.413', '243.414', '243.415', '243.416', '243.417', '243.418', '243.419', '243.420', '243.421', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.422', '254.423', '254.424', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454'])])" - ] - }, - "execution_count": 9, - "metadata": {}, - "output_type": "execute_result" - } - ], - "source": [ - "alignment" - ] - }, - { - "cell_type": "code", - "execution_count": 1, - "metadata": {}, - "outputs": [], - "source": [] - }, - { - "cell_type": "code", - "execution_count": 1, - "metadata": {}, - "outputs": [ - { - "name": "stderr", - "output_type": "stream", - "text": [ - "⬇️ Fetching protein sequences: 100%|β–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆ| 4/4 [00:00<00:00, 1292.84it/s]\n" - ] - }, - { - "name": "stdout", - "output_type": "stream", - "text": [ - "πŸƒ Running CLUSTALO\n" - ] - } - ], - "source": [ - "from pyeed.core import ProteinInfo, Alignment\n", - "from pyeed.aligners import ClustalOmega\n", - "\n", - "# Get sequences\n", - "ncbi_accessions = [\"QGC48744.1\", \"AAT46413.1\", \"AAT46414.1\", \"AAT46415.1\"]\n", - "sequences = ProteinInfo.from_ncbi(ncbi_accessions)\n", - "\n", - "# Create and run alignment\n", - "alignment = Alignment.from_sequences(sequences, aligner=ClustalOmega)" - ] - }, - { - "cell_type": "code", - "execution_count": 2, - "metadata": {}, - "outputs": [ - { - "name": "stderr", - "output_type": "stream", - "text": [ - "⬇️ Fetching protein sequences: 100%|β–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆβ–ˆ| 2/2 [00:00<00:00, 558.68it/s]" - ] - }, - { - "name": "stdout", - "output_type": "stream", - "text": [ - "[Sequence(id='sequence8', source_id='QGC48744.1', sequence='ALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'), Sequence(id='sequence9', source_id='AAT46413.1', sequence='MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMLSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDHWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW')]\n" - ] - }, - { - "name": "stderr", - "output_type": "stream", - "text": [ - "\n" - ] - } - ], - "source": [ - "from pyeed.core import ProteinInfo, Alignment\n", - "from pyeed.aligners import PairwiseAligner\n", - "\n", - "# Get sequences\n", - "ncbi_accessions = [\"QGC48744.1\", \"AAT46413.1\"]\n", - "sequences = ProteinInfo.from_ncbi(ncbi_accessions)\n", - "\n", - "# Create and run alignment\n", - "alignment = Alignment.from_sequences(sequences, aligner=PairwiseAligner)" - ] - } - ], - "metadata": { - "kernelspec": { - "display_name": "pye", - "language": "python", - "name": "python3" - }, - "language_info": { - "codemirror_mode": { - "name": "ipython", - "version": 3 - }, - "file_extension": ".py", - "mimetype": "text/x-python", - "name": "python", - "nbconvert_exporter": "python", - "pygments_lexer": "ipython3", - "version": "3.10.13" - } - }, - "nbformat": 4, - "nbformat_minor": 2 -} diff --git a/mkdocs.yml b/mkdocs.yml index 42471fad..8f20defd 100644 --- a/mkdocs.yml +++ b/mkdocs.yml @@ -2,26 +2,36 @@ site_name: PyEED Documentation repo_url: https://github.com/PyEED/pyeed/ repo_name: PyEED/pyeed site_url: https://pyeed.github.io/pyeed/ +site_author: Max HΓ€ußler + nav: - 🏠 Home: index.md - ⚑️ Quick Start: - - The Sequence objects: examples/basics.md - - Finding Sequences: examples/blast.md - - Aligning Sequences: examples/alignments.md - - Clustering Sequences: examples/clustering.md - - Creating Sequence Networks: examples/networks.md + - quick_start/index.md + - The Sequence objects: quick_start/basics.md + - Finding Sequences: quick_start/blast.md + - Aligning Sequences: quick_start/alignments.md + - Clustering Sequences: quick_start/clustering.md + - Creating Sequence Networks: quick_start/networks.md - πŸ”Ž Use cases: - Get an Overview over a Protein Family: usecases/usecase1.md - ⬇️ Installation: - - PIP: installation/pip.md - - Docker: installation/docker.md + - Install PyEED: installation/install_pyeed.md + - Setup Local BLAST database: installation/setup_local_blast.md theme: name: material logo: figs/pyeed.png features: + - navigation.instant + - navigation.instant.progress + - navigation.instant.preview + - navigation.indexes + - navigation.footer + + - content.action.view - navigation.tabs - navigation.sections - toc.integrate diff --git a/pyeed/aligners/abstract_aligner.py b/pyeed/aligners/abstract_aligner.py index 0254da8f..17a65837 100644 --- a/pyeed/aligners/abstract_aligner.py +++ b/pyeed/aligners/abstract_aligner.py @@ -1,6 +1,6 @@ from typing import List from abc import ABC, abstractmethod -from pydantic import BaseModel, Field, PrivateAttr +from pydantic import BaseModel, Field class AbstractAligner(BaseModel, ABC): diff --git a/pyeed/aligners/clustalo.py b/pyeed/aligners/clustalo.py index 2a944898..8b82e1b4 100644 --- a/pyeed/aligners/clustalo.py +++ b/pyeed/aligners/clustalo.py @@ -48,7 +48,8 @@ def setup_command(self): Returns: str: The command to run the ClustalOmega container. """ - return "clustalo -i /data/input.fasta -o /data/output.clu --outfmt=clu" + threads = os.cpu_count() + return f"clustalo -i /data/input.fasta -o /data/output.clu --outfmt=clu --threads={threads}" def extract_output_data(self) -> MultipleSeqAlignment: """ diff --git a/pyeed/aligners/pairwise.py b/pyeed/aligners/pairwise.py index d1cc57eb..a66adcb0 100644 --- a/pyeed/aligners/pairwise.py +++ b/pyeed/aligners/pairwise.py @@ -1,14 +1,14 @@ -from numpy import short -from pydantic import BaseModel, Field, validator -import sdRDM -from typing import Any, List, Optional -from itertools import combinations -from Bio.Align import PairwiseAligner as BioPairwiseAligner -from tqdm import tqdm +from pydantic import Field, validator +from typing import TYPE_CHECKING, Any + from pyeed.aligners import AbstractAligner +from Bio.Align import PairwiseAligner as BioPairwiseAligner +if TYPE_CHECKING: + from Bio.Align import Alignment as BioAlignment + from Bio.Align.substitution_matrices import Array as BioSubstitutionMatrix -from joblib import Parallel, delayed, cpu_count +from pyeed.core.sequence import Sequence class PairwiseAligner(AbstractAligner): @@ -61,7 +61,7 @@ def substitution_matrix_validator(cls, substitution_matrix): return substitution_matrix - def align(self): + def align(self) -> "BioAlignment": """ Aligns two sequences using the specified alignment parameters of the `PairwiseAligner` class. @@ -84,74 +84,16 @@ def align(self): if self.substitution_matrix != "None": aligner.substitution_matrix = self._load_substitution_matrix() - shorter_seq, longer_seq = sorted(self.sequences, key=lambda x: len(x)) - - alignment_result = aligner.align(shorter_seq, longer_seq)[0] - - # aligned_sequences = [ - # Sequence(source_id=shorter_seq.source_id, sequence=alignment_result[0]), - # Sequence(source_id=longer_seq.source_id, sequence=alignment_result[1]), - # ] - - # gaps = alignment_result.counts().gaps - # mismatches = alignment_result.counts().mismatches - # identities = alignment_result.counts().identities - # identity = identities / len(shorter_seq.sequence) - - # standard_numbering = StandardNumbering( - # reference_id=shorter_seq.source_id, - # numbered_id=longer_seq.source_id, - # numbering=Alignment._get_numbering_string( - # shorter_seq.sequence, longer_seq.sequence - # ), - # ) - - # alignment = PairwiseAlignment( - # input_sequences=[shorter_seq, longer_seq], - # method=self.mode, - # aligned_sequences=aligned_sequences, - # standard_numberings=[standard_numbering], - # score=alignment_result.score, - # identity=identity, - # gaps=gaps, - # mismatches=mismatches, - # ) + alignment_result = aligner.align(self.sequences[0], self.sequences[1])[0] return alignment_result - def _load_substitution_matrix(self) -> Any: + def _load_substitution_matrix(self) -> "BioSubstitutionMatrix": from Bio.Align import substitution_matrices return substitution_matrices.load(self.substitution_matrix) -# def multi_pairwise_alignment( -# protien_infos: List[ProteinInfo], -# mode: str = "global", -# match: int = 1, -# mismatch: int = -1, -# gap_open: int = -1, -# gap_extend: int = 0, -# substitution_matrix: str = "None", -# n_jobs: int = None, -# ): -# pairs = list(combinations(protien_infos, 2)) - -# if n_jobs is None: -# n_jobs = cpu_count() - -# alignments = Parallel(n_jobs=n_jobs, prefer="processes")( -# delayed(pairwise_alignment)( -# reference, -# query, -# mode, -# match, -# mismatch, -# gap_open, -# gap_extend, -# substitution_matrix, -# ) -# for reference, query in tqdm(pairs, desc="⛓️ Aligning sequences") -# ) - -# return alignments +if __name__ == "__main__": + + seq1 = Sequence(sequence="wee") diff --git a/pyeed/containers/abstract_container.py b/pyeed/containers/abstract_container.py index 5614a10a..1e0795e0 100644 --- a/pyeed/containers/abstract_container.py +++ b/pyeed/containers/abstract_container.py @@ -10,8 +10,7 @@ from docker.client import DockerClient from docker.models.containers import Container from docker.models.images import Image - -from pyeed.ncbi import seq_io +from docker.errors import DockerException class ToolImage(Enum): @@ -62,7 +61,15 @@ def __init__(self, **kwargs): BaseModel.__init__(self, **kwargs) super().__init__(**kwargs) self._tempdir_path = tempfile.mkdtemp() - self._client = docker.from_env() + self._client = self._initialize_docker_client() + + def _initialize_docker_client(self) -> DockerClient: + try: + client = docker.from_env() + client.ping() + return client + except DockerException as e: + print(f"Docker is not running. Start the Docker application. {e}") def get_image(self) -> Image: """Gets the image from Docker Hub. If the image is not found, it will be pulled.""" diff --git a/pyeed/core/alignment.py b/pyeed/core/alignment.py index d469b853..99bb4a7f 100644 --- a/pyeed/core/alignment.py +++ b/pyeed/core/alignment.py @@ -1,23 +1,60 @@ -import re +from numpy import short import sdRDM - -from typing import List, Optional, Union +from tqdm import tqdm +from itertools import combinations +from typing import List, Optional, Union, Tuple, TYPE_CHECKING from pydantic import Field, validator from sdRDM.base.listplus import ListPlus from sdRDM.base.utils import forge_signature, IDGenerator +from Bio.Align import Alignment as BioAlignment +from joblib import Parallel, delayed, cpu_count -from pyeed.aligners.pairwise import PairwiseAligner +if TYPE_CHECKING: + from pyeed.core.dnainfo import DNAInfo + from pyeed.core.proteininfo import ProteinInfo + from .abstractsequence import AbstractSequence + from pyeed.containers.abstract_container import AbstractContainer + from pyeed.aligners.pairwise import PairwiseAligner -from .abstractsequence import AbstractSequence -from .sequence import Sequence -from .standardnumbering import StandardNumbering -from pyeed.containers.abstract_container import AbstractContainer +from .standardnumbering import StandardNumbering +from .sequence import Sequence +from .abstractsequence import AbstractSequence @forge_signature class Alignment(sdRDM.DataModel): - """""" + """ + Description of the Alignment class. + + Attributes: + id (Optional[str]): Unique identifier of the given object. + method (Optional[str]): Applied alignment method. + consensus (Optional[str]): Consensus sequence of the alignment. + input_sequences (List[Sequence]): Sequences of the alignment. + aligned_sequences (List[Sequence]): Aligned sequences of the alignment. + standard_numberings (List[StandardNumbering]): Standard numbering of the aligned sequences. + + Methods: + add_to_input_sequences(source_id: Optional[str] = None, sequence: Optional[str] = None, id: Optional[str] = None) -> None: + Adds an object of type 'Sequence' to attribute input_sequences. + + add_to_aligned_sequences(source_id: Optional[str] = None, sequence: Optional[str] = None, id: Optional[str] = None) -> None: + Adds an object of type 'Sequence' to attribute aligned_sequences. + + add_to_standard_numberings(reference_id: Optional[str] = None, numbered_id: Optional[str] = None, numbering: List[str] = ListPlus(), id: Optional[str] = None) -> None: + Adds an object of type 'StandardNumbering' to attribute standard_numberings. + + align(aligner: Union["AbstractContainer", "PairwiseAligner"], **kwargs): + Aligns the input sequences using the specified aligner. + + apply_standard_numbering(reference: Sequence = None): + Applies standard numbering to the aligned sequences. + + from_sequences(sequences: List[Union["ProteinInfo", "DNAInfo"]], aligner: Union["AbstractContainer", "PairwiseAligner"] = None, **kwargs): + Creates an Alignment object from a list of sequences and optionally aligns them. + + """ id: Optional[str] = Field( description="Unique identifier of the given object.", @@ -133,20 +170,46 @@ def add_to_standard_numberings( self.standard_numberings.append(StandardNumbering(**params)) return self.standard_numberings[-1] - def align(self, aligner: Union[AbstractContainer, PairwiseAligner], **kwargs): + def align(self, aligner: Union["AbstractContainer", "PairwiseAligner"], **kwargs): + """ + Aligns the input sequences using the specified aligner. + + Args: + aligner (Union[AbstractContainer, PairwiseAligner]): The aligner object to use for alignment. + **kwargs: Additional keyword arguments to pass to the aligner. + + Returns: + Alignment or List[PairwiseAlignment]: The aligned sequences. If a Multi sequence aligner is used, an Alignment object will be returned. + If a PairwiseAligner is used, a list of PairwiseAlignment object will be returned. If more than two sequences are provided, + a list of PairwiseAlignment objects will be returned. + + Raises: + ValueError: If the aligner is not an instance of AbstractContainer or PairwiseAligner. + """ + + from pyeed.containers.abstract_container import AbstractContainer + from pyeed.aligners.pairwise import PairwiseAligner if issubclass(aligner, AbstractContainer): - self._container_align(aligner, **kwargs) + return self._container_align(aligner, **kwargs) elif issubclass(aligner, PairwiseAligner): - self._python_align(aligner, **kwargs) + return self._python_align(aligner, **kwargs) else: raise ValueError( "aligner must be an instance of AbstractContainer or PairwiseAligner" ) - def _container_align(self, aligner: AbstractContainer, **kwargs): + def _container_align(self, aligner: "AbstractContainer", **kwargs): + """Runs alignment using a containerized aligner. + + Args: + aligner (AbstractContainer): Containerized aligner to be called. + + Returns: + Any: Alignment result + """ sequences = [seq.fasta_string() for seq in self.input_sequences] alignment = aligner().align(sequences=sequences) @@ -167,38 +230,145 @@ def _container_align(self, aligner: AbstractContainer, **kwargs): self.apply_standard_numbering() - def _python_align(self, aligner: PairwiseAligner, **kwargs): + return self + + def _map_to_pairwisealignment(self): + + from pyeed.core.pairwisealignment import PairwiseAlignment + + return PairwiseAlignment( + input_sequences=self.input_sequences, + method=self.method, + aligned_sequences=self.aligned_sequences, + standard_numberings=self.standard_numberings, + ) + + def _python_align(self, aligner: "PairwiseAligner", **kwargs): + """Runs alignment using a python-based aligner. + + Args: + aligner (PairwiseAligner): Python-based aligner to be called. + + Raises: + ValueError: If the number of sequences is less than 2. + + Returns: + _type_: Alignment result + """ + + # Pairwise alignment if len(self.input_sequences) == 2: - alignment_reuslt = aligner( + + pairwise_aligner = aligner( sequences=[ self.input_sequences[0].sequence, self.input_sequences[1].sequence, ], **kwargs, - ).align() + ) + alignment_result = pairwise_aligner.align() + self.method = pairwise_aligner.mode + + return self._map_pairwise_alignment_results( + alignment_result, + pair=( + self.input_sequences[0], + self.input_sequences[1], + ), + mode=pairwise_aligner.mode, + ) + + # Multi pairwise alignment + elif len(self.input_sequences) > 2: + pairs = list(combinations(self.input_sequences, 2)) + + aligners = [ + aligner(sequences=[s.sequence for s in pair], **kwargs) + for pair in pairs + ] + + alignments = Parallel(n_jobs=cpu_count(), prefer="processes")( + delayed(a.align)() + for a in tqdm(aligners, desc="⛓️ Running pairwise alignments") + ) + + return [ + self._map_pairwise_alignment_results( + alignment, pair, mode=aligners[0].mode + ) + for alignment, pair in zip(alignments, pairs) + ] - # self.aligned_sequences = [ - # Sequence(source_id=seq.id, sequence=str(seq.seq)) - # for seq in alignment_reuslt - # ] + else: + raise ValueError( + f"Alignment Error. Recieved {len(self.input_sequences)} sequences. Expected 2." + ) - # TODO: Alignment has no ID attriburte - # TODO: Map to data model - return alignment_reuslt + def _map_pairwise_alignment_results( + self, alignment_result: BioAlignment, pair: Tuple[Sequence, Sequence], mode: str + ) -> "PairwiseAlignment": + """Maps the results of a pairwise alignment to a PairwiseAlignment object. + + Args: + alignment_result (BioAlignment): The result of the pairwise alignment. + pair (Tuple[Sequence, Sequence]): The pair of sequences that were aligned. + mode (str): The alignment mode used. + + Returns: + PairwiseAlignment: PairwiseAlignment object + """ + from pyeed.core.pairwisealignment import PairwiseAlignment + + self.aligned_sequences = [ + Sequence(source_id=pair[0].source_id, sequence=alignment_result[0]), + Sequence(source_id=pair[1].source_id, sequence=alignment_result[1]), + ] + + shorter_seq = min(self.input_sequences, key=lambda x: len(x.sequence)) + + identities = alignment_result.counts().identities + identity = identities / len(shorter_seq.sequence) + + pairwise_alignment = PairwiseAlignment( + input_sequences=list(pair), + method=mode, + aligned_sequences=self.aligned_sequences, + score=alignment_result.score, + gaps=alignment_result.counts().gaps, + identity=identity, + mismatches=alignment_result.counts().mismatches, + ) + + return pairwise_alignment @classmethod def from_sequences( cls, - sequences: List[AbstractSequence], - aligner: Union[AbstractContainer, PairwiseAligner] = None, + sequences: List[Union["ProteinInfo", "DNAInfo"]], + aligner: Union["AbstractContainer", "PairwiseAligner"] = None, **kwargs, ): + """ + Creates an instance of the Alignment class from a list of sequences. + If an aligner is provided, it also aligns the sequences. + + Args: + sequences (List[Union["ProteinInfo", "DNAInfo"]]): A list of sequences to be aligned. + aligner (Union["AbstractContainer", "PairwiseAligner"], optional): The aligner object to use for alignment. + If not provided, the sequences will not be aligned. + **kwargs: Additional keyword arguments to pass to the aligner. + + Returns: + Alignment: An instance of the Alignment class with the provided sequences. + If an aligner was provided, the sequences will be aligned. + """ + alignment = cls( input_sequences=sequences, ) if aligner is not None: - alignment.align(aligner, **kwargs) + return alignment.align(aligner, **kwargs) return alignment @@ -213,7 +383,6 @@ def _get_numbering_string(reference: str, query: str) -> List[str]: Returns: List[str]: A list of pairwise numbering. - """ numbering = [] diff --git a/pyeed/core/dnainfo.py b/pyeed/core/dnainfo.py index 089f770b..b6d34065 100644 --- a/pyeed/core/dnainfo.py +++ b/pyeed/core/dnainfo.py @@ -7,7 +7,6 @@ from .span import Span from .dnaregiontype import DNARegionType from .dnaregion import DNARegion -from ..ncbi.seq_io import get_ncbi_entry, _seqio_to_dna_info @forge_signature @@ -63,6 +62,8 @@ def add_to_regions( @classmethod def from_ncbi(cls, accession_id: str) -> "DNAInfo": + from pyeed.ncbi.seq_io import get_ncbi_entry, _seqio_to_dna_info + seq_record = get_ncbi_entry(accession_id=accession_id, database="nucleotide") return _seqio_to_dna_info(cls, seq_record) diff --git a/pyeed/core/proteininfo.py b/pyeed/core/proteininfo.py index d367b39f..4173892d 100644 --- a/pyeed/core/proteininfo.py +++ b/pyeed/core/proteininfo.py @@ -14,8 +14,6 @@ from .substrate import Substrate from .dnaregion import DNARegion from .proteinsitetype import ProteinSiteType -from ..ncbi.seq_io import _seqio_to_nucleotide_info, get_ncbi_entry, get_ncbi_entrys - from pyeed.containers.abstract_container import Blastp @@ -162,6 +160,8 @@ def add_to_substrates( @classmethod def from_ncbi(cls, accession_id: str) -> "ProteinInfo": + from ..ncbi.seq_io import _seqio_to_nucleotide_info, get_ncbi_entry + """ This method creates a 'ProteinInfo' object from a given NCBI ID. @@ -182,12 +182,16 @@ def from_ncbi(cls, accession_id: str) -> "ProteinInfo": @classmethod def _from_seq_record(cls, seq_record) -> "ProteinInfo": + from ..ncbi.seq_io import _seqio_to_nucleotide_info + return _seqio_to_nucleotide_info(cls, seq_record) @classmethod def from_accessions( cls, accession_ids: List[str], email: str = None, api_key: str = None ) -> List["ProteinInfo"]: + from ..ncbi.seq_io import get_ncbi_entrys + seq_entries = get_ncbi_entrys( accession_ids=accession_ids, database="protein", @@ -216,6 +220,7 @@ def ncbi_blastp( Returns: List[ProteinInfo]: List of 'ProteinInfo' objects that are the result of the blast search. """ + from ..ncbi.seq_io import get_ncbi_entrys print(f"πŸƒπŸΌβ€β™€οΈ Running PBLAST") print(f"╭── protein name: {self.name}") diff --git a/pyeed/ncbi/seq_io.py b/pyeed/ncbi/seq_io.py index a8ee324f..5a869431 100644 --- a/pyeed/ncbi/seq_io.py +++ b/pyeed/ncbi/seq_io.py @@ -1,14 +1,11 @@ import re import secrets -from datetime import datetime from tqdm import tqdm from typing import List from Bio import SeqIO, Entrez -from pyeed.core.citation import Citation from pyeed.core.dnaregion import DNARegion from pyeed.core.dnaregiontype import DNARegionType from pyeed.core.proteinregion import ProteinRegion -from pyeed.core.proteinregiontype import ProteinRegionType from pyeed.core.proteinsitetype import ProteinSiteType from pyeed.core.site import Site diff --git a/pyeed/network/__init__.py b/pyeed/network/__init__.py index 7343b301..f0e0d1ca 100644 --- a/pyeed/network/__init__.py +++ b/pyeed/network/__init__.py @@ -1 +1 @@ -from .network import pairwise_network +from .network import SequenceNetwork diff --git a/pyeed/network/network.py b/pyeed/network/network.py index 2b9ba4d9..e5067fa9 100644 --- a/pyeed/network/network.py +++ b/pyeed/network/network.py @@ -1,204 +1,344 @@ -from typing import List +from typing import List, Optional import networkx as nx import plotly.graph_objects as go +import plotly.express as px +from pydantic import BaseModel, Field -from pyeed.core.proteininfo import ProteinInfo -from pyeed.core.alignment import Alignment - - -def pairwise_network( - alignments: List[Alignment], - weight: str = "identity", - cutoff: float = None, - label: str = "accession_id", - color: str = "name", -) -> None: - """Takes a list of `Alignment`, constructs a network graph, - whereas the edges of the graph are weighted with an attribute of the - `Alignment` object. Visualizes the network graph. - - Args: - alignments (List[Alignment]): List of pairwise alignments. - weight (str, optional): Attribute of `Alignment` to weight the edges. - Defaults to "identity". - cutoff (float, optional): Sequences with a weight higher than the cutoff are connected - in the network. Defaults to None. - label (str, optional): Node labe in the graph. Defaults to "accession_id". - color (str, optional): Attribute of `ProteinInfo` co colorize nodes. Defaults to "name". - - Raises: - ValueError: If 'weights' is not one of "identity", "score", "gaps", or "mismatches". - ValueError: If 'label' is not one of "name", "organism", "ec_number", - "mol_weight", or "accession_id". - """ +from pyeed.core.abstractsequence import AbstractSequence +from pyeed.core.pairwisealignment import PairwiseAlignment - # Validate weights - weights = ["identity", "score", "gaps", "mismatches"] - if weight not in weights: - raise ValueError( - f"'weight' to parameterize network must be an alignment property ({weights})" - ) - # Validate labels - labels = ["name", "organism", "ec_number", "mol_weight", "accession_id"] - if label not in labels: - raise ValueError( - f"'label' to parameterize network must be an alignment property ({labels})" - ) +class SequenceNetwork(BaseModel): + """ + A class representing a sequence network. + + The SequenceNetwork class is used to create and visualize a network of sequences. It takes a list of AbstractSequence objects and a list of PairwiseAlignment objects as input. The network can be visualized in 2D or 3D, with nodes representing sequences and edges representing alignments between sequences. + + Attributes: + sequences (Optional[List[AbstractSequence]]): A list of AbstractSequence objects to be compared in the network. Default is an empty list. + pairwise_alignments (Optional[List[PairwiseAlignment]]): A list of PairwiseAlignment objects representing the pairwise alignments between sequences. Default is an empty list. + weight (Optional[str]): The attribute of the Alignment object to weight the edges in the network. Default is "identity". + color (Optional[str]): The attribute of the ProteinInfo object to colorize the nodes in the network. Default is "name". + threshold (Optional[float]): Sequences with a weight higher than the threshold are connected in the network. Default is None. + label (Optional[str]): The node label in the graph. Default is "name". + dimensions (Optional[int]): The dimension of the network graph. Default is 3. + + Methods: + graph() -> nx.Graph: Maps properties of alignments to a network graph. + visualize(): Visualizes the network graph. + """ - graph = construct_network(alignments, cutoff=cutoff) + sequences: Optional[List[AbstractSequence]] = Field( + default=[], + description="List of sequences to be compared", + ) + + pairwise_alignments: Optional[List[PairwiseAlignment]] = Field( + default=[], + description="List of pairwise alignments", + ) - graph = position_nodes_and_edges(graph, weight=weight) + weight: Optional[str] = Field( + default="identity", + description="Attribute of Alignment to weight the edges", + ) - visualize_network(graph, label=label, color=color) + color: Optional[str] = Field( + default="name", + description="Attribute of ProteinInfo to colorize nodes", + ) + threshold: Optional[float] = Field( + default=None, + description="Sequences with a weight higher than the threshold are connected in the network", + ) -def construct_network(alignments: List[Alignment], cutoff: float) -> nx.Graph: - """Maps properties of alignments to a network graph.""" - graph = nx.Graph() + label: Optional[str] = Field( + default="name", + description="Node label in the graph", + ) - sequences = _get_unique_sequences(alignments) + dimensions: Optional[int] = Field( + default=3, + description="Dimension of the network graph", + ) - # Add nodes and assign node attributes - for sequence in sequences: - graph.add_node( - node_for_adding=sequence.source_id, - name=sequence.name, - accession_id=sequence.source_id, - organism=sequence.organism.name, - ec_number=sequence.ec_number, - mol_weight=sequence.mol_weight, - ) + @property + def graph(self) -> nx.Graph: + """ + Maps properties of alignments to a network graph. + + Returns: + nx.Graph: The network graph representing the sequence network. + + Raises: + ValueError: If the dimensions of the network graph are greater than 3. + + Notes: + - The graph is created using the NetworkX library. + - Nodes in the graph represent sequences, and edges represent alignments between sequences. + - Node attributes include the sequence name, organism, and taxonomy ID. + - Edge attributes include the alignment identity, gaps, mismatches, and score. + - The graph can be visualized in 2D or 3D using the visualize() method. + """ + graph = nx.Graph() + + # Add nodes and assign node attributes + for sequence in self.sequences: + graph.add_node( + sequence.source_id, + name=sequence.name, + organism=sequence.organism, + taxonomy_id=sequence.organism.taxonomy_id, + ) - # Add edges and assign edge attributes - if cutoff != None: - for alignment in alignments: - if alignment.identity >= cutoff: + # Add edges and assign edge attributes + if self.threshold != None: + for alignment in self.pairwise_alignments: + if alignment.identity >= self.threshold: + graph.add_edge( + alignment.input_sequences[0].source_id, + alignment.input_sequences[1].source_id, + identity=alignment.identity, + gaps=1 / (alignment.gaps + 1), + mismatches=1 / (alignment.mismatches + 1), + score=alignment.score, + ) + else: + for alignment in self.pairwise_alignments: graph.add_edge( - alignment.reference_seq.source_id, - alignment.query_seq.source_id, + alignment.input_sequences[0].source_id, + alignment.input_sequences[1].source_id, identity=alignment.identity, gaps=1 / (alignment.gaps + 1), mismatches=1 / (alignment.mismatches + 1), score=alignment.score, ) - else: - for alignment in alignments: - graph.add_edge( - alignment.reference_seq.source_id, - alignment.query_seq.source_id, - identity=alignment.identity, - gaps=1 / (alignment.gaps + 1), - mismatches=1 / (alignment.mismatches + 1), - score=alignment.score, - ) - - return graph - - -def visualize_network(graph: nx.Graph, label: str, color: str): - """Visualizes a network graph.""" - # TODO: Refactor coloration of nodes - # TODO: Add ability to colorize edges - - colors = ["blue", "red", "green", "orange", "purple", "pink", "brown", "yellow"] - traces = [] - # Add edges - for edge in graph.edges: - traces.append( - go.Scatter( - x=graph.edges[edge]["x_pos"], - y=graph.edges[edge]["y_pos"], - mode="lines", - line=dict( - width=1, - # colorscale="YlGnBu", - # colorbar=dict(title='Heatmap Colorscale') - color="rgba(128, 128, 128, 0.1)", - ), - hoverinfo="text", - text=graph.edges[edge]["gaps"], - ) - ) - # Add nodes - color_dict = {} - for _, data in graph.nodes(data=True): - if data[color] not in color_dict: - color_dict[data[color]] = colors[len(color_dict)] - - traces.append( - go.Scatter( - x=[data["x_pos"]], - y=[data["y_pos"]], - mode="markers", - hoverinfo="text", - marker=dict( - # showscale=True, - # colorscale="Viridis", - size=10, - # colorbar=dict(thickness=15, title=""), - color=color_dict[data[color]], - ), - text=data[label], - ) - ) - - # Plot figure - fig = go.Figure( - data=traces, - layout=go.Layout( - plot_bgcolor="white", - showlegend=False, - hovermode="closest", - margin=dict(b=0, l=0, r=0, t=0), - ), - ) - fig.update_xaxes(visible=False) - fig.update_yaxes(visible=False) - print(color_dict) + if self.dimensions == 2: + return self._2d_position_nodes_and_edges(graph) + elif self.dimensions == 3: + return self._3d_position_nodes_and_edges(graph) + else: + if self.dimensions > 3: + raise ValueError( + f"Bruuuhh chill, u visiting from {self.dimensions}D cyberspace? Dimensions must be 2 or 3" + ) - fig.show() + return graph + + def visualize(self): + """ + Visualizes the network graph. + + This method visualizes the network graph created by the SequenceNetwork class. + It checks the value of the 'dimensions' attribute and calls either the 'visualize_2d_network' or 'visualize_3d_network' method accordingly. + If the 'dimensions' attribute is not 2 or 3, it raises a ValueError. + + Returns: + None + + Raises: + ValueError: If the 'dimensions' attribute is greater than 3. + + Notes: + - The visualization is done using the Plotly library. + - If the 'dimensions' attribute is 2, the network graph is visualized in 2D. + - If the 'dimensions' attribute is 3, the network graph is visualized in 3D. + - The visualization includes nodes representing sequences and edges representing alignments between sequences. + - The color of the nodes is determined by the 'color' attribute of the SequenceNetwork class. + - The hover information for each node includes the sequence name, organism, kingdom, phylum, and source ID. + - The visualization is displayed using the Plotly library. + """ + + if self.dimensions == 2: + self.visualize_2d_network() + elif self.dimensions == 3: + self.visusalize_3d_network() + else: + if self.dimensions > 3: + raise ValueError( + f"Dimensions must be 2 or 3 for visualization, not {self.dimensions}" + ) + def _2d_position_nodes_and_edges(self, graph: nx.Graph): + """Calculates node positions based on weight metric and + adds position information of nodes and edges to the respective + entry in the graph.""" + + positions = nx.spring_layout(graph, weight=self.weight, dim=2, seed=42) + + # Add node position as coordinates + for node in graph.nodes(): + graph.nodes[node]["x_pos"] = positions[node][0] + graph.nodes[node]["y_pos"] = positions[node][1] + + # Add edge positions as coordinates + for edge in graph.edges(): + graph.edges[edge]["x_pos"] = [ + graph.nodes[edge[0]]["x_pos"], + graph.nodes[edge[1]]["x_pos"], + ] + graph.edges[edge]["y_pos"] = [ + graph.nodes[edge[0]]["y_pos"], + graph.nodes[edge[1]]["y_pos"], + ] + + return graph + + def _3d_position_nodes_and_edges(self, graph: nx.Graph): + """Calculates node positions based on weight metric and + adds position information of nodes and edges to the respective + entry in the graph.""" + + positions = nx.spring_layout( + graph, iterations=25, weight=self.weight, dim=3, seed=42 + ) -def position_nodes_and_edges(graph: nx.Graph, weight: str) -> nx.Graph: - """Calculates node positions based on weight metric and - adds position information of nodes and edges to the respective - entry in the graph.""" + # Add node position as coordinates + for node in graph.nodes(): + graph.nodes[node]["x_pos"] = positions[node][0] + graph.nodes[node]["y_pos"] = positions[node][1] + graph.nodes[node]["z_pos"] = positions[node][2] + + # Add edge positions as coordinates + for edge in graph.edges(): + graph.edges[edge]["x_pos"] = [ + graph.nodes[edge[0]]["x_pos"], + graph.nodes[edge[1]]["x_pos"], + ] + graph.edges[edge]["y_pos"] = [ + graph.nodes[edge[0]]["y_pos"], + graph.nodes[edge[1]]["y_pos"], + ] + graph.edges[edge]["z_pos"] = [ + graph.nodes[edge[0]]["z_pos"], + graph.nodes[edge[1]]["z_pos"], + ] + + return graph + + def visusalize_3d_network(self): + """Visualizes a 3D network graph.""" + + traces = [] + # Add edges + # for edge in self.graph.edges: + # traces.append( + # go.Scatter3d( + # x=self.graph.edges[edge]["x_pos"], + # y=self.graph.edges[edge]["y_pos"], + # z=self.graph.edges[edge]["z_pos"], + # mode="lines", + # line=dict( + # width=1, + # color="rgba(128, 128, 128, 0.1)", + # ), + # hoverinfo="text", + # text=self.graph.edges[edge]["gaps"], + # ) + # ) + + color_conditions = set([node[self.color] for node in self.graph.nodes.values()]) + color_dict = dict( + zip(color_conditions, self._sample_colorscale(len(color_conditions))) + ) - positions = nx.spring_layout(graph, weight=weight) + # Add nodes + for key, node in self.graph.nodes.items(): + info = [ + ( + node["name"], + node["organism"].name, + node["organism"].kingdom, + node["organism"].phylum, + key, + ) + ] + + traces.append( + go.Scatter3d( + x=[node["x_pos"]], + y=[node["y_pos"]], + z=[node["z_pos"]], + mode="markers", + marker=dict( + size=7, + color=color_dict[node[self.color]], + ), + text=node["name"], + hovertemplate="%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + customdata=list((info)), + ) + ) - # Add node position as coordinates - for node in graph.nodes(): - graph.nodes[node]["x_pos"] = positions[node][0] - graph.nodes[node]["y_pos"] = positions[node][1] + # Plot figure + fig = go.Figure( + data=traces, + layout=go.Layout( + plot_bgcolor="white", + showlegend=False, + hovermode="closest", + margin=dict(b=0, l=0, r=0, t=0), + ), + ) + fig.update_xaxes(visible=False) + fig.update_yaxes(visible=False) + fig.update_scenes(xaxis_visible=False, yaxis_visible=False, zaxis_visible=False) - # Add edge positions as coordinates - for edge in graph.edges(): - graph.edges[edge]["x_pos"] = [ - graph.nodes[edge[0]]["x_pos"], - graph.nodes[edge[1]]["x_pos"], - ] - graph.edges[edge]["y_pos"] = [ - graph.nodes[edge[0]]["y_pos"], - graph.nodes[edge[1]]["y_pos"], - ] + fig.show() - return graph + def visualize_2d_network(self): + """Visualizes a 2D network graph.""" + traces = [] + # Add nodes + color_conditions = set([node[self.color] for node in self.graph.nodes.values()]) + color_dict = dict( + zip(color_conditions, self._sample_colorscale(len(color_conditions))) + ) -def _get_unique_sequences(alignments: List[Alignment]) -> List[ProteinInfo]: - """Gets unique sequences from a list of alignments.""" + for key, node in self.graph.nodes.items(): + info = [ + ( + node["name"], + node["organism"].name, + node["organism"].kingdom, + node["organism"].phylum, + key, + ) + ] + + traces.append( + go.Scatter( + x=[node["x_pos"]], + y=[node["y_pos"]], + mode="markers", + marker=dict( + size=10, + color=color_dict[node[self.color]], + ), + text=node["name"], + hovertemplate="%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}", + customdata=list((info)), + ) + ) - sequence_infos = [] - added_ids = set() - for alignment in alignments: - if alignment.reference_seq.source_id not in added_ids: - sequence_infos.append(alignment.reference_seq) - added_ids.add(alignment.reference_seq.source_id) + # Plot figure + fig = go.Figure( + data=traces, + layout=go.Layout( + plot_bgcolor="white", + showlegend=False, + hovermode="closest", + margin=dict(b=0, l=0, r=0, t=0), + ), + ) + fig.update_xaxes(visible=False) + fig.update_yaxes(visible=False) - if alignment.query_seq.source_id not in added_ids: - sequence_infos.append(alignment.query_seq) - added_ids.add(alignment.query_seq.source_id) + fig.show() - return sequence_infos + @staticmethod + def _sample_colorscale(size: int) -> List[str]: + return px.colors.sample_colorscale("viridis", [i / size for i in range(size)])