diff --git a/docs/examples/networks.md b/docs/examples/networks.md
deleted file mode 100644
index e69de29b..00000000
diff --git a/docs/examples/setup_local_blast.md b/docs/examples/setup_local_blast.md
deleted file mode 100644
index e69de29b..00000000
diff --git a/docs/installation/docker.md b/docs/installation/docker.md
deleted file mode 100644
index 95506131..00000000
--- a/docs/installation/docker.md
+++ /dev/null
@@ -1,5 +0,0 @@
----
-icon: simple/docker
----
-
-# Installation with Docker
\ No newline at end of file
diff --git a/docs/installation/pip.md b/docs/installation/install_pyeed.md
similarity index 88%
rename from docs/installation/pip.md
rename to docs/installation/install_pyeed.md
index f94b3c2c..bfc1317e 100644
--- a/docs/installation/pip.md
+++ b/docs/installation/install_pyeed.md
@@ -1,7 +1,3 @@
----
-icon: simple/python
----
-
# Installation via `pip`
PyEED can be installed from Github via pip.
@@ -13,3 +9,7 @@ Alternatively, you can install the latest stable release from PyPI.
```bash
```
+
+
+# Installation with Docker
+
diff --git a/docs/installation/setup_local_blast.md b/docs/installation/setup_local_blast.md
new file mode 100644
index 00000000..81fbc55c
--- /dev/null
+++ b/docs/installation/setup_local_blast.md
@@ -0,0 +1,6 @@
+# Setup a Local BLAST Database
+
+This tutorial will guide you through the process of setting up a local BLAST database. This is useful if you have a large number of sequences that you need to search against, or if you want to search against a custom database.
+
+1. Hi
+2. Hello
\ No newline at end of file
diff --git a/docs/examples/alignments.md b/docs/quick_start/alignments.md
similarity index 91%
rename from docs/examples/alignments.md
rename to docs/quick_start/alignments.md
index 620b44ac..c62afabd 100644
--- a/docs/examples/alignments.md
+++ b/docs/quick_start/alignments.md
@@ -54,13 +54,20 @@ alignment = Alignment.from_sequences(list_of_sequences)
tem109 = ProteinInfo.from_ncbi("AAT46413.1")
# Create and run alignment
- alignment = PairwiseAlignment([tem1, tem109], aligner=PairwiseAligner)
+ alignment = PairwiseAlignment([tem1, tem109], aligner=PairwiseAligner, mode="local")
```
=== "Global Alignment"
``` py
from pyeed.core import ProteinInfo, PairwiseAlignment
- from pyeed.aligners import NeedlemanWunsch
+ from pyeed.aligners import PairwiseAligner
+
+ # Get two ProteinInfo objects
+ tem1 = ProteinInfo.from_ncbi("QGC48744.1")
+ tem109 = ProteinInfo.from_ncbi("AAT46413.1")
+
+ # Create and run alignment
+ alignment = PairwiseAlignment([tem1, tem109], aligner=PairwiseAligner, mode="global")
```
diff --git a/docs/examples/basics.md b/docs/quick_start/basics.md
similarity index 100%
rename from docs/examples/basics.md
rename to docs/quick_start/basics.md
diff --git a/docs/examples/blast.md b/docs/quick_start/blast.md
similarity index 100%
rename from docs/examples/blast.md
rename to docs/quick_start/blast.md
diff --git a/docs/examples/clustering.md b/docs/quick_start/clustering.md
similarity index 100%
rename from docs/examples/clustering.md
rename to docs/quick_start/clustering.md
diff --git a/docs/quick_start/index.md b/docs/quick_start/index.md
new file mode 100644
index 00000000..621031b8
--- /dev/null
+++ b/docs/quick_start/index.md
@@ -0,0 +1,20 @@
+---
+hide:
+ - navigation
+ - footer
+---
+
+# Quick Start
+
+
+
+- :material-walk: __[Basics]__ β How to work with sequence data
+- :octicons-search-16: __[Search Sequences]__ β How to search for individual sequences or search using BLAST
+- :fontawesome-solid-align-justify: __[Alignments]__ β How to make different alignments
+- :material-dots-grid: __[Networks]__ β How to construct sequence networks
+
+
+ [Basics]: basics.md
+ [Search Sequences]: blast.md
+ [Alignments]: alignments.md
+ [Networks]: networks.md
\ No newline at end of file
diff --git a/docs/quick_start/networks.md b/docs/quick_start/networks.md
new file mode 100644
index 00000000..e73d798f
--- /dev/null
+++ b/docs/quick_start/networks.md
@@ -0,0 +1,83 @@
+# Creating Sequence Networks
+
+A `SequenceNetwork` is created using a list of `PairwiseAlignment` objects, and a list of `AbstractSequences`. Additionally, the way the network is constructed is influenced by the `weight` and `threshold` attributes. The `weight` determines which attribute of the `PairwiseAlignment` object is used to calculate the distance between the sequences of the network. The `threshold` determines the minimum value of the `weight` attribute for an edge to be created. Furthermore, a `color` can be determined based on the attributes of an `AbstractSequence` object in which the nodes of the network will be colored.
+
+## Visualization
+
+=== "2D"
+
+ ```py
+ from pyeed.core import ProteinInfo, Alignment
+ from pyeed.aligners import PairwiseAligner
+ from pyeed.network import SequenceNetwork
+
+ # Accessions from different methionine adenyltransferases
+ mat_accessions = [
+ "MBP1912539.1",
+ "SEV92896.1",
+ "MBO8174569.1",
+ "WP_042680787.1",
+ "NPA47376.1",
+ "WP_167889085.1",
+ "WP_048165429.1",
+ "ACS90033.1",
+ ]
+ mats = ProteinInfo.from_ncbi(mat_accessions)
+
+ # Create pairwise alignments between all sequences
+ alignments = Alignment.from_sequences(mats, aligner=PairwiseAligner)
+
+ # Create a network
+ network = SequenceNetwork(
+ sequences=mats,
+ pairwise_alignments=alignments,
+ weight="identity",
+ threshold=0.9,
+ dimensions=2,
+ color="taxonomy_id",
+ )
+
+ # Visualize the network
+ network.visualize()
+ ```
+
+=== "3D"
+
+ ```py
+ from pyeed.core import ProteinInfo, Alignment
+ from pyeed.aligners import PairwiseAligner
+ from pyeed.network import SequenceNetwork
+
+ # Accessions from different methionine adenyltransferases
+ mat_accessions = [
+ "MBP1912539.1",
+ "SEV92896.1",
+ "MBO8174569.1",
+ "WP_042680787.1",
+ "NPA47376.1",
+ "WP_167889085.1",
+ "WP_048165429.1",
+ "ACS90033.1",
+ ]
+ mats = ProteinInfo.from_ncbi(mat_accessions)
+
+ # Create pairwise alignments between all sequences
+ alignments = Alignment.from_sequences(mats, aligner=PairwiseAligner)
+
+ # Create a network
+ network = SequenceNetwork(
+ sequences=mats,
+ pairwise_alignments=alignments,
+ weight="identity",
+ threshold=0.9,
+ dimensions=3,
+ color="taxonomy_id",
+ )
+
+ # Visualize the network
+ network.visualize()
+ ```
+
+## Network Analysis
+
+Upon the `SequenceNetwork` is instantiated the `graph` property is created. This property is a `networkx` graph object that can be used to perform network analysis. For example, the `degree()` method can be used to calculate the degree of each node in the network.
diff --git a/examples/networks/alignment_network.ipynb b/examples/networks/alignment_network.ipynb
deleted file mode 100644
index ce57995b..00000000
--- a/examples/networks/alignment_network.ipynb
+++ /dev/null
@@ -1,2394 +0,0 @@
-{
- "cells": [
- {
- "cell_type": "code",
- "execution_count": 1,
- "metadata": {},
- "outputs": [],
- "source": [
- "from pyEED.core import ProteinInfo\n",
- "from pyEED.alignment.pairwise import multi_pairwise_alignment\n",
- "from pyEED.network import pairwise_network\n",
- "from pyEED.ncbi.utils import load_accessions"
- ]
- },
- {
- "cell_type": "markdown",
- "metadata": {},
- "source": [
- "# Visualize networks of pairwise sequence alignments\n",
- "\n",
- "In the following example, a protein BLAST search is conducted based on TEM-1 and TEM-109 variant of beta-lactamase. After pairwise alignment of all sequences, a network is constructed based on the alignment scores and then visualized.\n",
- "\n",
- "## PBLAST search for seed sequences\n",
- "\n",
- "Results from the BLAST search are renamed based to the name of query protein variant."
- ]
- },
- {
- "cell_type": "code",
- "execution_count": 2,
- "metadata": {},
- "outputs": [
- {
- "name": "stdout",
- "output_type": "stream",
- "text": [
- "ππΌββοΈ Running PBLAST\n",
- "βββ protein name: TEM family beta-lactamase\n",
- "βββ accession: QGC48744.1\n",
- "βββ organism: Escherichia coli\n",
- "βββ e-value: 0.05\n",
- "β°ββ max hits: 15\n"
- ]
- },
- {
- "name": "stderr",
- "output_type": "stream",
- "text": [
- "β¬οΈ Fetching protein sequences: 100%|ββββββββββ| 15/15 [00:11<00:00, 1.30it/s]\n"
- ]
- },
- {
- "name": "stdout",
- "output_type": "stream",
- "text": [
- "π Done\n",
- "\n",
- "ππΌββοΈ Running PBLAST\n",
- "βββ protein name: beta-lactamase TEM-109\n",
- "βββ accession: AAT46413.1\n",
- "βββ organism: Escherichia coli\n",
- "βββ e-value: 0.05\n",
- "β°ββ max hits: 15\n"
- ]
- },
- {
- "name": "stderr",
- "output_type": "stream",
- "text": [
- "β¬οΈ Fetching protein sequences: 100%|ββββββββββ| 15/15 [00:13<00:00, 1.13it/s]"
- ]
- },
- {
- "name": "stdout",
- "output_type": "stream",
- "text": [
- "π Done\n",
- "\n"
- ]
- },
- {
- "name": "stderr",
- "output_type": "stream",
- "text": [
- "\n"
- ]
- }
- ],
- "source": [
- "tem1 = ProteinInfo.from_ncbi(\"QGC48744.1\")\n",
- "tem109 = ProteinInfo.from_ncbi(\"AAT46413.1\")\n",
- "\n",
- "blast_results = []\n",
- "for tem in [tem1, tem109]:\n",
- " sequences = tem.pblast(\n",
- " e_value=0.05, n_hits=15, api_key=\"161e6eb71dcc94511d2d0e2fc5336c1af709\"\n",
- " )\n",
- "\n",
- " for sequence in sequences:\n",
- " sequence.name = tem.name\n",
- "\n",
- " blast_results.extend(sequences)\n",
- " blast_results.append(tem)"
- ]
- },
- {
- "cell_type": "markdown",
- "metadata": {},
- "source": [
- "## Pairwise alignment of unique sequence pairs"
- ]
- },
- {
- "cell_type": "code",
- "execution_count": 3,
- "metadata": {},
- "outputs": [
- {
- "name": "stderr",
- "output_type": "stream",
- "text": [
- "βοΈ Aligning sequences: 100%|ββββββββββ| 496/496 [00:01<00:00, 342.87it/s]\n"
- ]
- }
- ],
- "source": [
- "alignments = multi_pairwise_alignment(\n",
- " blast_results,\n",
- " mode=\"global\",\n",
- " match=1,\n",
- " mismatch=-1,\n",
- " gap_open=-1,\n",
- " gap_extend=0,\n",
- " n_jobs=8,\n",
- ")"
- ]
- },
- {
- "cell_type": "markdown",
- "metadata": {},
- "source": [
- "## Visualize the alignment network"
- ]
- },
- {
- "cell_type": "code",
- "execution_count": 4,
- "metadata": {},
- "outputs": [
- {
- "name": "stdout",
- "output_type": "stream",
- "text": [
- "{'TEM family beta-lactamase': 'blue', 'beta-lactamase TEM-109': 'red'}\n"
- ]
- },
- {
- "data": {
- "application/vnd.plotly.v1+json": {
- "config": {
- "plotlyServerURL": "https://plot.ly"
- },
- "data": [
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- -0.6914588236656009,
- -0.7475822584708567
- ],
- "y": [
- 0.6937671259213628,
- 0.6618414989828777
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- -0.2448563136899791,
- -0.1203321469905742
- ],
- "y": [
- 0.14734002900774362,
- 0.0763339976053082
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- -0.0811932367392075,
- -0.1203321469905742
- ],
- "y": [
- 0.17382567240497152,
- 0.0763339976053082
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- -0.0811932367392075,
- -0.04940126911688077
- ],
- "y": [
- 0.17382567240497152,
- 0.09651404384278645
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- -0.24901003045346679,
- -0.1203321469905742
- ],
- "y": [
- 0.08803189773933258,
- 0.0763339976053082
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- -0.24901003045346679,
- -0.25034481810980186
- ],
- "y": [
- 0.08803189773933258,
- 0.041927515691288705
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- -0.1203321469905742,
- -0.14872233118607536
- ],
- "y": [
- 0.0763339976053082,
- 0.21452566279960705
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- -0.1203321469905742,
- -0.25034481810980186
- ],
- "y": [
- 0.0763339976053082,
- 0.041927515691288705
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- -0.1203321469905742,
- -0.20297634886068033
- ],
- "y": [
- 0.0763339976053082,
- 0.18693913882560567
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "0.5",
- "type": "scatter",
- "x": [
- -0.1203321469905742,
- -0.04029013809870461
- ],
- "y": [
- 0.0763339976053082,
- 0.02061650287648177
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- -0.1203321469905742,
- -0.04940126911688077
- ],
- "y": [
- 0.0763339976053082,
- 0.09651404384278645
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- -0.1203321469905742,
- 0.08532296081240384
- ],
- "y": [
- 0.0763339976053082,
- -0.012041709630483113
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- -0.1203321469905742,
- -0.03936001583320556
- ],
- "y": [
- 0.0763339976053082,
- -0.09737039857521942
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "0.5",
- "type": "scatter",
- "x": [
- -0.04029013809870461,
- -0.04940126911688077
- ],
- "y": [
- 0.02061650287648177,
- 0.09651404384278645
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "0.5",
- "type": "scatter",
- "x": [
- -0.04029013809870461,
- 0.08532296081240384
- ],
- "y": [
- 0.02061650287648177,
- -0.012041709630483113
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "0.5",
- "type": "scatter",
- "x": [
- -0.04029013809870461,
- -0.03936001583320556
- ],
- "y": [
- 0.02061650287648177,
- -0.09737039857521942
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "0.125",
- "type": "scatter",
- "x": [
- 0.0026449758300490615,
- -0.04940126911688077
- ],
- "y": [
- -0.008140028460294475,
- 0.09651404384278645
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "0.5",
- "type": "scatter",
- "x": [
- 0.0026449758300490615,
- 0.05466675915745448
- ],
- "y": [
- -0.008140028460294475,
- -0.07452750708175072
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "0.16666666666666666",
- "type": "scatter",
- "x": [
- 0.0026449758300490615,
- 0.03719026190426883
- ],
- "y": [
- -0.008140028460294475,
- -0.03440182426628215
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "0.5",
- "type": "scatter",
- "x": [
- 0.0026449758300490615,
- 0.015862547165238553
- ],
- "y": [
- -0.008140028460294475,
- -0.08038463467503207
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "0.125",
- "type": "scatter",
- "x": [
- 0.0026449758300490615,
- 0.08532296081240384
- ],
- "y": [
- -0.008140028460294475,
- -0.012041709630483113
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "0.125",
- "type": "scatter",
- "x": [
- 0.0026449758300490615,
- -0.03936001583320556
- ],
- "y": [
- -0.008140028460294475,
- -0.09737039857521942
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "0.14285714285714285",
- "type": "scatter",
- "x": [
- 0.05466675915745448,
- 0.03719026190426883
- ],
- "y": [
- -0.07452750708175072,
- -0.03440182426628215
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- 0.05466675915745448,
- 0.015862547165238553
- ],
- "y": [
- -0.07452750708175072,
- -0.08038463467503207
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "0.1111111111111111",
- "type": "scatter",
- "x": [
- 0.05466675915745448,
- 0.08532296081240384
- ],
- "y": [
- -0.07452750708175072,
- -0.012041709630483113
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "0.1111111111111111",
- "type": "scatter",
- "x": [
- 0.05466675915745448,
- -0.03936001583320556
- ],
- "y": [
- -0.07452750708175072,
- -0.09737039857521942
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "0.3333333333333333",
- "type": "scatter",
- "x": [
- 0.03719026190426883,
- 0.08532296081240384
- ],
- "y": [
- -0.03440182426628215,
- -0.012041709630483113
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "0.3333333333333333",
- "type": "scatter",
- "x": [
- 0.03719026190426883,
- -0.03936001583320556
- ],
- "y": [
- -0.03440182426628215,
- -0.09737039857521942
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "0.1111111111111111",
- "type": "scatter",
- "x": [
- 0.015862547165238553,
- 0.08532296081240384
- ],
- "y": [
- -0.08038463467503207,
- -0.012041709630483113
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "0.1111111111111111",
- "type": "scatter",
- "x": [
- 0.015862547165238553,
- -0.03936001583320556
- ],
- "y": [
- -0.08038463467503207,
- -0.09737039857521942
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- 0.10869915026731872,
- 0.13935595294492717
- ],
- "y": [
- -0.20339682223411076,
- -0.33393696367943215
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- 0.10869915026731872,
- 0.26039027346222837
- ],
- "y": [
- -0.20339682223411076,
- -0.20052479110151572
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- 0.10869915026731872,
- 0.08532296081240384
- ],
- "y": [
- -0.20339682223411076,
- -0.012041709630483113
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- 0.10869915026731872,
- 0.19830431202433105
- ],
- "y": [
- -0.20339682223411076,
- -0.2973813824634891
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- 0.10869915026731872,
- 0.008570759579562364
- ],
- "y": [
- -0.20339682223411076,
- -0.2105015087825045
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- 0.10869915026731872,
- -0.03936001583320556
- ],
- "y": [
- -0.20339682223411076,
- -0.09737039857521942
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- 0.10869915026731872,
- 0.09091010554453571
- ],
- "y": [
- -0.20339682223411076,
- -0.3346823296174025
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- 0.13935595294492717,
- 0.09091010554453571
- ],
- "y": [
- -0.33393696367943215,
- -0.3346823296174025
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- 0.26039027346222837,
- 0.21563899967860206
- ],
- "y": [
- -0.20052479110151572,
- -0.09392104519463836
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- 0.26039027346222837,
- 0.37605156079029445
- ],
- "y": [
- -0.20052479110151572,
- -0.2538592706809643
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- 0.08532296081240384,
- 0.24756102331286348
- ],
- "y": [
- -0.012041709630483113,
- 0.07640918883750153
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- 0.08532296081240384,
- 0.21563899967860206
- ],
- "y": [
- -0.012041709630483113,
- -0.09392104519463836
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- 0.08532296081240384,
- 0.16541824687796045
- ],
- "y": [
- -0.012041709630483113,
- 0.0824591456151757
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- 0.24756102331286348,
- 0.3583179045125126
- ],
- "y": [
- 0.07640918883750153,
- 0.14097172029107072
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- 0.008570759579562364,
- -0.03936001583320556
- ],
- "y": [
- -0.2105015087825045,
- -0.09737039857521942
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- -0.03936001583320556,
- -0.1173148443114023
- ],
- "y": [
- -0.09737039857521942,
- -0.20833803540467175
- ]
- },
- {
- "hoverinfo": "text",
- "line": {
- "color": "rgba(128, 128, 128, 0.1)",
- "width": 1
- },
- "mode": "lines",
- "text": "1.0",
- "type": "scatter",
- "x": [
- -0.03936001583320556,
- -0.1611856606532563
- ],
- "y": [
- -0.09737039857521942,
- -0.1544174738187897
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "blue",
- "size": 10
- },
- "mode": "markers",
- "text": "Enterobacter hormaechei",
- "type": "scatter",
- "x": [
- -0.6914588236656009
- ],
- "y": [
- 0.6937671259213628
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "blue",
- "size": 10
- },
- "mode": "markers",
- "text": "synthetic construct",
- "type": "scatter",
- "x": [
- -0.2448563136899791
- ],
- "y": [
- 0.14734002900774362
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "blue",
- "size": 10
- },
- "mode": "markers",
- "text": "Shigella sonnei",
- "type": "scatter",
- "x": [
- -0.0811932367392075
- ],
- "y": [
- 0.17382567240497152
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "blue",
- "size": 10
- },
- "mode": "markers",
- "text": "Enterobacteriaceae",
- "type": "scatter",
- "x": [
- -0.24901003045346679
- ],
- "y": [
- 0.08803189773933258
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "blue",
- "size": 10
- },
- "mode": "markers",
- "text": "Bacteria",
- "type": "scatter",
- "x": [
- -0.1203321469905742
- ],
- "y": [
- 0.0763339976053082
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "blue",
- "size": 10
- },
- "mode": "markers",
- "text": "Escherichia coli",
- "type": "scatter",
- "x": [
- -0.14872233118607536
- ],
- "y": [
- 0.21452566279960705
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "blue",
- "size": 10
- },
- "mode": "markers",
- "text": "synthetic construct",
- "type": "scatter",
- "x": [
- -0.25034481810980186
- ],
- "y": [
- 0.041927515691288705
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "blue",
- "size": 10
- },
- "mode": "markers",
- "text": "Salmonella enterica subsp. enterica serovar Ohio",
- "type": "scatter",
- "x": [
- -0.20297634886068033
- ],
- "y": [
- 0.18693913882560567
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "blue",
- "size": 10
- },
- "mode": "markers",
- "text": "Klebsiella pneumoniae",
- "type": "scatter",
- "x": [
- 0.38370160070995796
- ],
- "y": [
- 0.8963225852254685
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "blue",
- "size": 10
- },
- "mode": "markers",
- "text": "Klebsiella pneumoniae",
- "type": "scatter",
- "x": [
- -0.7475822584708567
- ],
- "y": [
- 0.6618414989828777
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "blue",
- "size": 10
- },
- "mode": "markers",
- "text": "Enterobacteriaceae",
- "type": "scatter",
- "x": [
- -0.04029013809870461
- ],
- "y": [
- 0.02061650287648177
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "blue",
- "size": 10
- },
- "mode": "markers",
- "text": "Enterobacterales",
- "type": "scatter",
- "x": [
- 0.0026449758300490615
- ],
- "y": [
- -0.008140028460294475
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "blue",
- "size": 10
- },
- "mode": "markers",
- "text": "Salmonella enterica",
- "type": "scatter",
- "x": [
- -0.04940126911688077
- ],
- "y": [
- 0.09651404384278645
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "blue",
- "size": 10
- },
- "mode": "markers",
- "text": "Escherichia coli",
- "type": "scatter",
- "x": [
- 0.05466675915745448
- ],
- "y": [
- -0.07452750708175072
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "blue",
- "size": 10
- },
- "mode": "markers",
- "text": "Pseudomonadota",
- "type": "scatter",
- "x": [
- 0.03719026190426883
- ],
- "y": [
- -0.03440182426628215
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "blue",
- "size": 10
- },
- "mode": "markers",
- "text": "Escherichia coli",
- "type": "scatter",
- "x": [
- 0.015862547165238553
- ],
- "y": [
- -0.08038463467503207
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "red",
- "size": 10
- },
- "mode": "markers",
- "text": "Escherichia coli",
- "type": "scatter",
- "x": [
- 0.10869915026731872
- ],
- "y": [
- -0.20339682223411076
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "red",
- "size": 10
- },
- "mode": "markers",
- "text": "Escherichia coli",
- "type": "scatter",
- "x": [
- 0.13935595294492717
- ],
- "y": [
- -0.33393696367943215
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "red",
- "size": 10
- },
- "mode": "markers",
- "text": "Klebsiella pneumoniae",
- "type": "scatter",
- "x": [
- 0.26039027346222837
- ],
- "y": [
- -0.20052479110151572
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "red",
- "size": 10
- },
- "mode": "markers",
- "text": "Gammaproteobacteria",
- "type": "scatter",
- "x": [
- 0.08532296081240384
- ],
- "y": [
- -0.012041709630483113
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "red",
- "size": 10
- },
- "mode": "markers",
- "text": "Klebsiella pneumoniae",
- "type": "scatter",
- "x": [
- 0.19830431202433105
- ],
- "y": [
- -0.2973813824634891
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "red",
- "size": 10
- },
- "mode": "markers",
- "text": "Escherichia coli",
- "type": "scatter",
- "x": [
- 0.24756102331286348
- ],
- "y": [
- 0.07640918883750153
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "red",
- "size": 10
- },
- "mode": "markers",
- "text": "Proteus mirabilis",
- "type": "scatter",
- "x": [
- 0.21563899967860206
- ],
- "y": [
- -0.09392104519463836
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "red",
- "size": 10
- },
- "mode": "markers",
- "text": "Gammaproteobacteria",
- "type": "scatter",
- "x": [
- 0.008570759579562364
- ],
- "y": [
- -0.2105015087825045
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "red",
- "size": 10
- },
- "mode": "markers",
- "text": "Capnocytophaga ochracea",
- "type": "scatter",
- "x": [
- -0.03936001583320556
- ],
- "y": [
- -0.09737039857521942
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "red",
- "size": 10
- },
- "mode": "markers",
- "text": "synthetic construct",
- "type": "scatter",
- "x": [
- 0.3954208416051821
- ],
- "y": [
- -0.9999999999999999
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "red",
- "size": 10
- },
- "mode": "markers",
- "text": "Klebsiella pneumoniae",
- "type": "scatter",
- "x": [
- 0.16541824687796045
- ],
- "y": [
- 0.0824591456151757
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "red",
- "size": 10
- },
- "mode": "markers",
- "text": "synthetic construct",
- "type": "scatter",
- "x": [
- -0.1173148443114023
- ],
- "y": [
- -0.20833803540467175
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "red",
- "size": 10
- },
- "mode": "markers",
- "text": "Klebsiella pneumoniae",
- "type": "scatter",
- "x": [
- 0.3583179045125126
- ],
- "y": [
- 0.14097172029107072
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "red",
- "size": 10
- },
- "mode": "markers",
- "text": "synthetic construct",
- "type": "scatter",
- "x": [
- -0.1611856606532563
- ],
- "y": [
- -0.1544174738187897
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "red",
- "size": 10
- },
- "mode": "markers",
- "text": "Citrobacter koseri",
- "type": "scatter",
- "x": [
- 0.37605156079029445
- ],
- "y": [
- -0.2538592706809643
- ]
- },
- {
- "hoverinfo": "text",
- "marker": {
- "color": "red",
- "size": 10
- },
- "mode": "markers",
- "text": "Escherichia coli",
- "type": "scatter",
- "x": [
- 0.09091010554453571
- ],
- "y": [
- -0.3346823296174025
- ]
- }
- ],
- "layout": {
- "hovermode": "closest",
- "margin": {
- "b": 0,
- "l": 0,
- "r": 0,
- "t": 0
- },
- "plot_bgcolor": "white",
- "showlegend": false,
- "template": {
- "data": {
- "bar": [
- {
- "error_x": {
- "color": "#2a3f5f"
- },
- "error_y": {
- "color": "#2a3f5f"
- },
- "marker": {
- "line": {
- "color": "#E5ECF6",
- "width": 0.5
- },
- "pattern": {
- "fillmode": "overlay",
- "size": 10,
- "solidity": 0.2
- }
- },
- "type": "bar"
- }
- ],
- "barpolar": [
- {
- "marker": {
- "line": {
- "color": "#E5ECF6",
- "width": 0.5
- },
- "pattern": {
- "fillmode": "overlay",
- "size": 10,
- "solidity": 0.2
- }
- },
- "type": "barpolar"
- }
- ],
- "carpet": [
- {
- "aaxis": {
- "endlinecolor": "#2a3f5f",
- "gridcolor": "white",
- "linecolor": "white",
- "minorgridcolor": "white",
- "startlinecolor": "#2a3f5f"
- },
- "baxis": {
- "endlinecolor": "#2a3f5f",
- "gridcolor": "white",
- "linecolor": "white",
- "minorgridcolor": "white",
- "startlinecolor": "#2a3f5f"
- },
- "type": "carpet"
- }
- ],
- "choropleth": [
- {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- },
- "type": "choropleth"
- }
- ],
- "contour": [
- {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- },
- "colorscale": [
- [
- 0,
- "#0d0887"
- ],
- [
- 0.1111111111111111,
- "#46039f"
- ],
- [
- 0.2222222222222222,
- "#7201a8"
- ],
- [
- 0.3333333333333333,
- "#9c179e"
- ],
- [
- 0.4444444444444444,
- "#bd3786"
- ],
- [
- 0.5555555555555556,
- "#d8576b"
- ],
- [
- 0.6666666666666666,
- "#ed7953"
- ],
- [
- 0.7777777777777778,
- "#fb9f3a"
- ],
- [
- 0.8888888888888888,
- "#fdca26"
- ],
- [
- 1,
- "#f0f921"
- ]
- ],
- "type": "contour"
- }
- ],
- "contourcarpet": [
- {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- },
- "type": "contourcarpet"
- }
- ],
- "heatmap": [
- {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- },
- "colorscale": [
- [
- 0,
- "#0d0887"
- ],
- [
- 0.1111111111111111,
- "#46039f"
- ],
- [
- 0.2222222222222222,
- "#7201a8"
- ],
- [
- 0.3333333333333333,
- "#9c179e"
- ],
- [
- 0.4444444444444444,
- "#bd3786"
- ],
- [
- 0.5555555555555556,
- "#d8576b"
- ],
- [
- 0.6666666666666666,
- "#ed7953"
- ],
- [
- 0.7777777777777778,
- "#fb9f3a"
- ],
- [
- 0.8888888888888888,
- "#fdca26"
- ],
- [
- 1,
- "#f0f921"
- ]
- ],
- "type": "heatmap"
- }
- ],
- "heatmapgl": [
- {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- },
- "colorscale": [
- [
- 0,
- "#0d0887"
- ],
- [
- 0.1111111111111111,
- "#46039f"
- ],
- [
- 0.2222222222222222,
- "#7201a8"
- ],
- [
- 0.3333333333333333,
- "#9c179e"
- ],
- [
- 0.4444444444444444,
- "#bd3786"
- ],
- [
- 0.5555555555555556,
- "#d8576b"
- ],
- [
- 0.6666666666666666,
- "#ed7953"
- ],
- [
- 0.7777777777777778,
- "#fb9f3a"
- ],
- [
- 0.8888888888888888,
- "#fdca26"
- ],
- [
- 1,
- "#f0f921"
- ]
- ],
- "type": "heatmapgl"
- }
- ],
- "histogram": [
- {
- "marker": {
- "pattern": {
- "fillmode": "overlay",
- "size": 10,
- "solidity": 0.2
- }
- },
- "type": "histogram"
- }
- ],
- "histogram2d": [
- {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- },
- "colorscale": [
- [
- 0,
- "#0d0887"
- ],
- [
- 0.1111111111111111,
- "#46039f"
- ],
- [
- 0.2222222222222222,
- "#7201a8"
- ],
- [
- 0.3333333333333333,
- "#9c179e"
- ],
- [
- 0.4444444444444444,
- "#bd3786"
- ],
- [
- 0.5555555555555556,
- "#d8576b"
- ],
- [
- 0.6666666666666666,
- "#ed7953"
- ],
- [
- 0.7777777777777778,
- "#fb9f3a"
- ],
- [
- 0.8888888888888888,
- "#fdca26"
- ],
- [
- 1,
- "#f0f921"
- ]
- ],
- "type": "histogram2d"
- }
- ],
- "histogram2dcontour": [
- {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- },
- "colorscale": [
- [
- 0,
- "#0d0887"
- ],
- [
- 0.1111111111111111,
- "#46039f"
- ],
- [
- 0.2222222222222222,
- "#7201a8"
- ],
- [
- 0.3333333333333333,
- "#9c179e"
- ],
- [
- 0.4444444444444444,
- "#bd3786"
- ],
- [
- 0.5555555555555556,
- "#d8576b"
- ],
- [
- 0.6666666666666666,
- "#ed7953"
- ],
- [
- 0.7777777777777778,
- "#fb9f3a"
- ],
- [
- 0.8888888888888888,
- "#fdca26"
- ],
- [
- 1,
- "#f0f921"
- ]
- ],
- "type": "histogram2dcontour"
- }
- ],
- "mesh3d": [
- {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- },
- "type": "mesh3d"
- }
- ],
- "parcoords": [
- {
- "line": {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- }
- },
- "type": "parcoords"
- }
- ],
- "pie": [
- {
- "automargin": true,
- "type": "pie"
- }
- ],
- "scatter": [
- {
- "fillpattern": {
- "fillmode": "overlay",
- "size": 10,
- "solidity": 0.2
- },
- "type": "scatter"
- }
- ],
- "scatter3d": [
- {
- "line": {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- }
- },
- "marker": {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- }
- },
- "type": "scatter3d"
- }
- ],
- "scattercarpet": [
- {
- "marker": {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- }
- },
- "type": "scattercarpet"
- }
- ],
- "scattergeo": [
- {
- "marker": {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- }
- },
- "type": "scattergeo"
- }
- ],
- "scattergl": [
- {
- "marker": {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- }
- },
- "type": "scattergl"
- }
- ],
- "scattermapbox": [
- {
- "marker": {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- }
- },
- "type": "scattermapbox"
- }
- ],
- "scatterpolar": [
- {
- "marker": {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- }
- },
- "type": "scatterpolar"
- }
- ],
- "scatterpolargl": [
- {
- "marker": {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- }
- },
- "type": "scatterpolargl"
- }
- ],
- "scatterternary": [
- {
- "marker": {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- }
- },
- "type": "scatterternary"
- }
- ],
- "surface": [
- {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- },
- "colorscale": [
- [
- 0,
- "#0d0887"
- ],
- [
- 0.1111111111111111,
- "#46039f"
- ],
- [
- 0.2222222222222222,
- "#7201a8"
- ],
- [
- 0.3333333333333333,
- "#9c179e"
- ],
- [
- 0.4444444444444444,
- "#bd3786"
- ],
- [
- 0.5555555555555556,
- "#d8576b"
- ],
- [
- 0.6666666666666666,
- "#ed7953"
- ],
- [
- 0.7777777777777778,
- "#fb9f3a"
- ],
- [
- 0.8888888888888888,
- "#fdca26"
- ],
- [
- 1,
- "#f0f921"
- ]
- ],
- "type": "surface"
- }
- ],
- "table": [
- {
- "cells": {
- "fill": {
- "color": "#EBF0F8"
- },
- "line": {
- "color": "white"
- }
- },
- "header": {
- "fill": {
- "color": "#C8D4E3"
- },
- "line": {
- "color": "white"
- }
- },
- "type": "table"
- }
- ]
- },
- "layout": {
- "annotationdefaults": {
- "arrowcolor": "#2a3f5f",
- "arrowhead": 0,
- "arrowwidth": 1
- },
- "autotypenumbers": "strict",
- "coloraxis": {
- "colorbar": {
- "outlinewidth": 0,
- "ticks": ""
- }
- },
- "colorscale": {
- "diverging": [
- [
- 0,
- "#8e0152"
- ],
- [
- 0.1,
- "#c51b7d"
- ],
- [
- 0.2,
- "#de77ae"
- ],
- [
- 0.3,
- "#f1b6da"
- ],
- [
- 0.4,
- "#fde0ef"
- ],
- [
- 0.5,
- "#f7f7f7"
- ],
- [
- 0.6,
- "#e6f5d0"
- ],
- [
- 0.7,
- "#b8e186"
- ],
- [
- 0.8,
- "#7fbc41"
- ],
- [
- 0.9,
- "#4d9221"
- ],
- [
- 1,
- "#276419"
- ]
- ],
- "sequential": [
- [
- 0,
- "#0d0887"
- ],
- [
- 0.1111111111111111,
- "#46039f"
- ],
- [
- 0.2222222222222222,
- "#7201a8"
- ],
- [
- 0.3333333333333333,
- "#9c179e"
- ],
- [
- 0.4444444444444444,
- "#bd3786"
- ],
- [
- 0.5555555555555556,
- "#d8576b"
- ],
- [
- 0.6666666666666666,
- "#ed7953"
- ],
- [
- 0.7777777777777778,
- "#fb9f3a"
- ],
- [
- 0.8888888888888888,
- "#fdca26"
- ],
- [
- 1,
- "#f0f921"
- ]
- ],
- "sequentialminus": [
- [
- 0,
- "#0d0887"
- ],
- [
- 0.1111111111111111,
- "#46039f"
- ],
- [
- 0.2222222222222222,
- "#7201a8"
- ],
- [
- 0.3333333333333333,
- "#9c179e"
- ],
- [
- 0.4444444444444444,
- "#bd3786"
- ],
- [
- 0.5555555555555556,
- "#d8576b"
- ],
- [
- 0.6666666666666666,
- "#ed7953"
- ],
- [
- 0.7777777777777778,
- "#fb9f3a"
- ],
- [
- 0.8888888888888888,
- "#fdca26"
- ],
- [
- 1,
- "#f0f921"
- ]
- ]
- },
- "colorway": [
- "#636efa",
- "#EF553B",
- "#00cc96",
- "#ab63fa",
- "#FFA15A",
- "#19d3f3",
- "#FF6692",
- "#B6E880",
- "#FF97FF",
- "#FECB52"
- ],
- "font": {
- "color": "#2a3f5f"
- },
- "geo": {
- "bgcolor": "white",
- "lakecolor": "white",
- "landcolor": "#E5ECF6",
- "showlakes": true,
- "showland": true,
- "subunitcolor": "white"
- },
- "hoverlabel": {
- "align": "left"
- },
- "hovermode": "closest",
- "mapbox": {
- "style": "light"
- },
- "paper_bgcolor": "white",
- "plot_bgcolor": "#E5ECF6",
- "polar": {
- "angularaxis": {
- "gridcolor": "white",
- "linecolor": "white",
- "ticks": ""
- },
- "bgcolor": "#E5ECF6",
- "radialaxis": {
- "gridcolor": "white",
- "linecolor": "white",
- "ticks": ""
- }
- },
- "scene": {
- "xaxis": {
- "backgroundcolor": "#E5ECF6",
- "gridcolor": "white",
- "gridwidth": 2,
- "linecolor": "white",
- "showbackground": true,
- "ticks": "",
- "zerolinecolor": "white"
- },
- "yaxis": {
- "backgroundcolor": "#E5ECF6",
- "gridcolor": "white",
- "gridwidth": 2,
- "linecolor": "white",
- "showbackground": true,
- "ticks": "",
- "zerolinecolor": "white"
- },
- "zaxis": {
- "backgroundcolor": "#E5ECF6",
- "gridcolor": "white",
- "gridwidth": 2,
- "linecolor": "white",
- "showbackground": true,
- "ticks": "",
- "zerolinecolor": "white"
- }
- },
- "shapedefaults": {
- "line": {
- "color": "#2a3f5f"
- }
- },
- "ternary": {
- "aaxis": {
- "gridcolor": "white",
- "linecolor": "white",
- "ticks": ""
- },
- "baxis": {
- "gridcolor": "white",
- "linecolor": "white",
- "ticks": ""
- },
- "bgcolor": "#E5ECF6",
- "caxis": {
- "gridcolor": "white",
- "linecolor": "white",
- "ticks": ""
- }
- },
- "title": {
- "x": 0.05
- },
- "xaxis": {
- "automargin": true,
- "gridcolor": "white",
- "linecolor": "white",
- "ticks": "",
- "title": {
- "standoff": 15
- },
- "zerolinecolor": "white",
- "zerolinewidth": 2
- },
- "yaxis": {
- "automargin": true,
- "gridcolor": "white",
- "linecolor": "white",
- "ticks": "",
- "title": {
- "standoff": 15
- },
- "zerolinecolor": "white",
- "zerolinewidth": 2
- }
- }
- },
- "xaxis": {
- "visible": false
- },
- "yaxis": {
- "visible": false
- }
- }
- }
- },
- "metadata": {},
- "output_type": "display_data"
- }
- ],
- "source": [
- "pairwise_network(\n",
- " alignments=alignments,\n",
- " weight=\"identity\",\n",
- " color=\"name\",\n",
- " label=\"organism\",\n",
- " cutoff=0.996,\n",
- ")"
- ]
- }
- ],
- "metadata": {
- "kernelspec": {
- "display_name": "pye",
- "language": "python",
- "name": "python3"
- },
- "language_info": {
- "codemirror_mode": {
- "name": "ipython",
- "version": 3
- },
- "file_extension": ".py",
- "mimetype": "text/x-python",
- "name": "python",
- "nbconvert_exporter": "python",
- "pygments_lexer": "ipython3",
- "version": "3.10.13"
- }
- },
- "nbformat": 4,
- "nbformat_minor": 2
-}
diff --git a/examples/networks/tem109_accession.toml b/examples/networks/tem109_accession.toml
deleted file mode 100644
index 2f1eee6e..00000000
--- a/examples/networks/tem109_accession.toml
+++ /dev/null
@@ -1,102 +0,0 @@
-tem109_ids = [
- "WP_063864949.1",
- "WP_063864799.1",
- "WP_063864870.1",
- "WP_032490103.1",
- "WP_063864912.1",
- "WP_063864909.1",
- "WP_063864800.1",
- "WP_047028173.1",
- "WP_063864877.1",
- "ANG18301.1",
- "WP_063864805.1",
- "ARF39029.1",
- "WP_032490956.1",
- "ARF31230.1",
- "HBQ2613975.1",
- "WP_063864852.1",
- "WP_063864859.1",
- "WP_063864865.1",
- "AMM70781.1",
- "HCF8861892.1",
- "WP_013279314.1",
- "EKW4005960.1",
- "EJG7116187.1",
- "ARF31817.1",
- "HAI5030310.1",
- "HBX5023813.1",
- "WP_042065300.1",
- "WP_000027057.1",
- "WP_063864833.1",
- "WP_063864797.1",
- "HCO3480053.1",
- "WP_032072208.1",
- "ARF38043.1",
- "ARF26548.1",
- "HBX5023809.1",
- "ARF39336.1",
- "WP_063864851.1",
- "WP_188240090.1",
- "WP_063865030.1",
- "ANG32478.1",
- "ANG13631.1",
- "ANG17132.1",
- "ARF28164.1",
- "WP_015379489.1",
- "ARF29524.1",
- "HBW1251876.1",
- "ARF30334.1",
- "ANG31477.1",
- "ANG23480.1",
- "ANG31365.1",
- "HDN1137928.1",
- "WP_021526512.1",
- "HCH7488344.1",
- "WP_148044473.1",
- "ANG10160.1",
- "ANG11443.1",
- "HEA0912696.1",
- "ECJ9431290.1",
- "ARF30434.1",
- "ARF37114.1",
- "WP_261627585.1",
- "ANG09566.1",
- "ANG14490.1",
- "WP_240078874.1",
- "WP_032492108.1",
- "ANG25686.1",
- "ANG10517.1",
- "ANG09900.1",
- "ARF31156.1",
- "ANG10619.1",
- "EGO7072685.1",
- "ANG10571.1",
- "ANG10941.1",
- "ANG14225.1",
- "ANG10332.1",
- "ANG18929.1",
- "ANG23932.1",
- "ANG09482.1",
- "ARF44464.1",
- "ANG09950.1",
- "ANG11187.1",
- "ANG16208.1",
- "ANG17092.1",
- "WP_063864863.1",
- "WP_215748091.1",
- "ANG11172.1",
- "ANG14661.1",
- "ANG23677.1",
- "ANG30415.1",
- "ANG29235.1",
- "ANG24073.1",
- "ANG18696.1",
- "ANG10864.1",
- "WP_063864796.1",
- "ANG22868.1",
- "EBP5465763.1",
- "ANG11672.1",
- "ANG31159.1",
- "ARF47333.1",
- "WP_161654968.1"
-]
diff --git a/examples/networks/tem1_accessions.toml b/examples/networks/tem1_accessions.toml
deleted file mode 100644
index 2579cb42..00000000
--- a/examples/networks/tem1_accessions.toml
+++ /dev/null
@@ -1,102 +0,0 @@
-tem1_ids = [
- "EKW4005960.1",
- "EJG7116187.1",
- "AMM70781.1",
- "HBQ2613975.1",
- "WP_000311242.1",
- "EHY2097385.1",
- "HAI5030310.1",
- "WP_000027057.1",
- "HEC0884360.1",
- "HCO3480053.1",
- "WP_215748091.1",
- "ANG14661.1",
- "ANG10160.1",
- "ANG11443.1",
- "ANG18696.1",
- "ANG10864.1",
- "ANG11672.1",
- "WP_161654968.1",
- "WP_261627585.1",
- "ANG09566.1",
- "WP_240078874.1",
- "ANG27598.1",
- "ANG13700.1",
- "ANG10517.1",
- "ANG09900.1",
- "ANG12641.1",
- "ANG10619.1",
- "ANG10571.1",
- "ANG10941.1",
- "ANG14225.1",
- "ANG10332.1",
- "ANG10321.1",
- "WP_117043934.1",
- "ANG09482.1",
- "WP_094320566.1",
- "ANG09950.1",
- "ANG11187.1",
- "ANG16208.1",
- "ANG14159.1",
- "ANG15082.1",
- "WP_223234097.1",
- "ANG09696.1",
- "ANG13191.1",
- "HDN1137928.1",
- "ANG11172.1",
- "WP_015058867.1",
- "HCH7488344.1",
- "ANG29235.1",
- "HEA0912696.1",
- "ANG24073.1",
- "EBP5465763.1",
- "HCQ0586696.1",
- "ANG26441.1",
- "ARF47333.1",
- "ANG32962.1",
- "EHC9934517.1",
- "ANG12753.1",
- "ANG14490.1",
- "ELK1047634.1",
- "ANG09477.1",
- "HBC1239896.1",
- "ANG32427.1",
- "ANG10038.1",
- "ANG15290.1",
- "ANG31811.1",
- "ANG18929.1",
- "ANG24592.1",
- "ANG19121.1",
- "ANG22186.1",
- "ANG17092.1",
- "HAI6872260.1",
- "HAS9376541.1",
- "ANG23677.1",
- "ANG30415.1",
- "ANG12696.1",
- "ANG24706.1",
- "ANG31363.1",
- "ANG25919.1",
- "ANG17861.1",
- "ANG18665.1",
- "ANG31159.1",
- "WP_241312872.1",
- "ANG17982.1",
- "ANG23579.1",
- "EDC4633317.1",
- "ANG23305.1",
- "ANG19419.1",
- "HAW5807676.1",
- "ANG22525.1",
- "WP_249866686.1",
- "ANG24558.1",
- "ANG20310.1",
- "ANG29078.1",
- "ANG24407.1",
- "ANG14724.1",
- "ANG17944.1",
- "MDV1392406.1",
- "ANG25733.1",
- "WP_109791210.1",
- "ANG09890.1",
-]
diff --git a/examples/networks/test.ipynb b/examples/networks/test.ipynb
new file mode 100644
index 00000000..dfdaca10
--- /dev/null
+++ b/examples/networks/test.ipynb
@@ -0,0 +1,14988 @@
+{
+ "cells": [
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "# Network Visualization"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 1,
+ "metadata": {},
+ "outputs": [],
+ "source": [
+ "%reload_ext autoreload\n",
+ "%autoreload 2\n",
+ "from pyeed.core import ProteinInfo, Alignment\n",
+ "from pyeed.aligners import ClustalOmega, PairwiseAligner\n",
+ "from pyeed.network import SequenceNetwork"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 2,
+ "metadata": {},
+ "outputs": [],
+ "source": [
+ "# Get a query sequence from NCBI\n",
+ "metTK = ProteinInfo.from_ncbi(\"WP_011249500.1\")"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 3,
+ "metadata": {},
+ "outputs": [
+ {
+ "name": "stdout",
+ "output_type": "stream",
+ "text": [
+ "π Running BLAST\n"
+ ]
+ },
+ {
+ "name": "stderr",
+ "output_type": "stream",
+ "text": [
+ "β¬οΈ Fetching protein sequences: 100%|ββββββββββ| 499/500 [00:53<00:00, 9.38it/s]\n"
+ ]
+ }
+ ],
+ "source": [
+ "# Run local blastp search\n",
+ "blast_results = metTK.blastp(\n",
+ " db_path=\"/Users/max/Documents/GitHub/blast-db/data/source\",\n",
+ " n_hits=500,\n",
+ " ncbi_key=\"fc08205c4aad544871863f0eb134f5524707\",\n",
+ ")"
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "## MSA with Clustal Omega"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 4,
+ "metadata": {},
+ "outputs": [
+ {
+ "name": "stdout",
+ "output_type": "stream",
+ "text": [
+ "π Running CLUSTALO\n",
+ "\u001b[4mStandardNumbering\u001b[0m\n",
+ "βββ \u001b[94mid\u001b[0m = standardnumbering456\n",
+ "βββ \u001b[94mreference_id\u001b[0m = MBP1912539.1\n",
+ "βββ \u001b[94mnumbered_id\u001b[0m = WP_254809959.1\n",
+ "βββ \u001b[94mnumbering\u001b[0m = [0.1, 0.2, 0.3, 0.4, 0.5, ...]\n",
+ "\n"
+ ]
+ }
+ ],
+ "source": [
+ "alignment = Alignment.from_sequences(blast_results, aligner=ClustalOmega)\n",
+ "print(alignment.standard_numberings[456])"
+ ]
+ },
+ {
+ "cell_type": "markdown",
+ "metadata": {},
+ "source": [
+ "## Multi Pairwise Alignment"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 5,
+ "metadata": {},
+ "outputs": [
+ {
+ "name": "stderr",
+ "output_type": "stream",
+ "text": [
+ "βοΈ Running pairwise alignments: 100%|ββββββββββ| 124251/124251 [00:31<00:00, 3922.61it/s]\n"
+ ]
+ }
+ ],
+ "source": [
+ "# Create and run alignment\n",
+ "multi_parwise_alignments = Alignment.from_sequences(\n",
+ " blast_results, aligner=PairwiseAligner)"
+ ]
+ },
+ {
+ "cell_type": "code",
+ "execution_count": 21,
+ "metadata": {},
+ "outputs": [
+ {
+ "data": {
+ "application/vnd.plotly.v1+json": {
+ "config": {
+ "plotlyServerURL": "https://plot.ly"
+ },
+ "data": [
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Thermococcus stetteri",
+ "Euryarchaeota",
+ "Thermococcales",
+ "MBP1912539.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(56, 87, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.028675575339694632
+ ],
+ "y": [
+ -0.05914303983996185
+ ],
+ "z": [
+ 0.035138402930357054
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermococcus thioreducens",
+ "Euryarchaeota",
+ "Thermococcales",
+ "SEV92896.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(218, 227, 40)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.031616695097073634
+ ],
+ "y": [
+ -0.049983867562733174
+ ],
+ "z": [
+ 0.03479305031478188
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermococcus sp.",
+ "Euryarchaeota",
+ "Thermococcales",
+ "MBO8174569.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(187, 223, 43)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.049424926856601645
+ ],
+ "y": [
+ -0.04400606477685095
+ ],
+ "z": [
+ 0.017100117184334525
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermococcus paralvinellae",
+ "Euryarchaeota",
+ "Thermococcales",
+ "WP_042680787.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(54, 92, 140)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.044851386532041425
+ ],
+ "y": [
+ -0.0312957547386347
+ ],
+ "z": [
+ 0.003476282301678805
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermococci archaeon",
+ "Euryarchaeota",
+ null,
+ "NPA47376.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(37, 135, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.0799945093933448
+ ],
+ "y": [
+ -0.03137989754200982
+ ],
+ "z": [
+ 0.039980577968213575
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermococcus sp. MV5",
+ "Euryarchaeota",
+ "Thermococcales",
+ "WP_167889085.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(56, 88, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.030288387015158083
+ ],
+ "y": [
+ -0.02059042323356212
+ ],
+ "z": [
+ 0.03333762743571547
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Palaeococcus pacificus",
+ "Euryarchaeota",
+ "Thermococcales",
+ "WP_048165429.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(62, 73, 137)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.03832358661127394
+ ],
+ "y": [
+ -0.02555257945087879
+ ],
+ "z": [
+ 0.03198043495880474
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Thermococcus sibiricus MM 739",
+ "Euryarchaeota",
+ "Thermococcales",
+ "ACS90033.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(45, 113, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.044764506206828106
+ ],
+ "y": [
+ -0.041360329676408424
+ ],
+ "z": [
+ 0.0398077313905213
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Palaeococcus ferrophilus",
+ "Euryarchaeota",
+ "Thermococcales",
+ "WP_048148317.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(168, 219, 51)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.04883716039647858
+ ],
+ "y": [
+ -0.05134837792638096
+ ],
+ "z": [
+ 0.052350402137325676
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Palaeococcus sp. (in: euryarchaeotes)",
+ "Euryarchaeota",
+ "Thermococcales",
+ "MCD6559773.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(46, 111, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.039367353296982974
+ ],
+ "y": [
+ -0.0335234905362738
+ ],
+ "z": [
+ 0.025014982055787477
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Pyrococcus yayanosii",
+ "Euryarchaeota",
+ "Thermococcales",
+ "WP_013904864.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(37, 134, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.04188541034518397
+ ],
+ "y": [
+ -0.0491229572124836
+ ],
+ "z": [
+ 0.0740839237776107
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase (EC 2.5.1.6)",
+ "Pyrococcus abyssi GE5",
+ "Euryarchaeota",
+ "Thermococcales",
+ "CAB49302.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 46, 123)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase (EC 2.5.1.6)",
+ "type": "scatter3d",
+ "x": [
+ 0.06866289397638518
+ ],
+ "y": [
+ -0.02978800846263075
+ ],
+ "z": [
+ 0.038812415096958756
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "404aa long hypothetical protein",
+ "Pyrococcus horikoshii OT3",
+ "Euryarchaeota",
+ "Thermococcales",
+ "BAA30943.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(66, 60, 130)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "404aa long hypothetical protein",
+ "type": "scatter3d",
+ "x": [
+ 0.08366271055485379
+ ],
+ "y": [
+ -0.02068551686293689
+ ],
+ "z": [
+ 0.040606221253392596
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "NOZ59931.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.010701535178269064
+ ],
+ "y": [
+ -0.04144038652594561
+ ],
+ "z": [
+ 0.0014901504148083487
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Desulfocapsa sp.",
+ "Thermodesulfobacteriota",
+ "Desulfobulbales",
+ "RUM44621.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(36, 137, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.07437635104807512
+ ],
+ "y": [
+ -0.019643238224396363
+ ],
+ "z": [
+ -0.012139829023534648
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanocaldococcus villosus",
+ "Euryarchaeota",
+ "Methanococci",
+ "WP_004590981.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(91, 198, 99)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.013417036391145899
+ ],
+ "y": [
+ -0.06832459069420671
+ ],
+ "z": [
+ 0.027695836449154045
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanocaldococcus infernus",
+ "Euryarchaeota",
+ "Methanococci",
+ "WP_013100562.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(239, 229, 38)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.006485300214870387
+ ],
+ "y": [
+ -0.03872127523294707
+ ],
+ "z": [
+ 0.03418189432493001
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Diapherotrites archaeon",
+ "Candidatus Diapherotrites",
+ null,
+ "NPA76954.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(156, 216, 59)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.08609401571230285
+ ],
+ "y": [
+ -0.044319143703572
+ ],
+ "z": [
+ 0.07535351638238537
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Archaeoglobales archaeon",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "RLI88365.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(42, 120, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.10893543004628325
+ ],
+ "y": [
+ -0.019302088378659037
+ ],
+ "z": [
+ -0.030897221084917496
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Archaeoglobus veneficus",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "WP_013683710.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(68, 4, 87)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.10052871914543009
+ ],
+ "y": [
+ -0.015908654151138082
+ ],
+ "z": [
+ -0.016804775626263774
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Hadesarchaea archaeon CG08_land_8_20_14_0_20_51_8",
+ "Candidatus Hadarchaeota",
+ null,
+ "PIU13897.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 19, 101)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.14747741286042912
+ ],
+ "y": [
+ 0.10134272869553156
+ ],
+ "z": [
+ 0.2874758230590554
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Archaeoglobus profundus",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "HIP58397.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(68, 3, 86)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.09359286417257973
+ ],
+ "y": [
+ -0.027453189181744185
+ ],
+ "z": [
+ -0.008170245515089467
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Geoglobus acetivorans",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "MBE8539338.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 190, 110)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.0854582222349352
+ ],
+ "y": [
+ -0.022866568726110734
+ ],
+ "z": [
+ -0.00537414522264022
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "NPA75857.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.1638554696839962
+ ],
+ "y": [
+ -0.15461559685326173
+ ],
+ "z": [
+ 0.0747309378619657
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Geoglobus ahangari",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "WP_048096291.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(61, 74, 137)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.0761899675558273
+ ],
+ "y": [
+ -0.016743539837154743
+ ],
+ "z": [
+ -0.003429534380549993
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "HIQ10138.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.0850099337833169
+ ],
+ "y": [
+ -0.04645980949776353
+ ],
+ "z": [
+ 0.11210190719355945
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Archaeoglobales archaeon",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "RLI75855.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(42, 120, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.10311250389629902
+ ],
+ "y": [
+ -0.04221364341931126
+ ],
+ "z": [
+ 0.0025840150802398493
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Archaeoglobales archaeon",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "RLI80102.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(42, 120, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.08042483963614347
+ ],
+ "y": [
+ -0.03223963497457793
+ ],
+ "z": [
+ -0.0011959680922410778
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "Methionine adenosyltransferase",
+ "Methanotorris formicicus Mc-S-70",
+ "Euryarchaeota",
+ "Methanococci",
+ "EHP84035.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(71, 35, 115)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "Methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.021371171215151454
+ ],
+ "y": [
+ -0.04238749287292927
+ ],
+ "z": [
+ 0.020246127404231852
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "Chain A, S-adenosylmethionine synthase",
+ "Methanocaldococcus jannaschii DSM 2661",
+ "Euryarchaeota",
+ "Methanococci",
+ "7P82_A"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 20, 102)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "Chain A, S-adenosylmethionine synthase",
+ "type": "scatter3d",
+ "x": [
+ 0.006232108147667765
+ ],
+ "y": [
+ -0.06084446473004582
+ ],
+ "z": [
+ 0.03804770210232047
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Archaeoglobales archaeon",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "NHW22645.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(42, 120, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.08450861422367133
+ ],
+ "y": [
+ -0.0010986100262206356
+ ],
+ "z": [
+ 0.03210138613497796
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Archaeoglobus sulfaticallidus",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "WP_015589840.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(65, 63, 132)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.12346471072296446
+ ],
+ "y": [
+ -0.023186608198186093
+ ],
+ "z": [
+ -0.03417498644708647
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Archaeoglobus neptunius",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "WP_202319859.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(232, 228, 39)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.11074014002737599
+ ],
+ "y": [
+ -0.02534085838243956
+ ],
+ "z": [
+ 0.009452864988432006
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Archaeoglobus sp.",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "MBO8182227.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(199, 224, 41)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.06546585754654233
+ ],
+ "y": [
+ -0.03129373312803644
+ ],
+ "z": [
+ 0.0006469344275514806
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Archaeoglobaceae archaeon",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "MCS7144229.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(51, 180, 123)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.08115418433601117
+ ],
+ "y": [
+ -0.043223014361073876
+ ],
+ "z": [
+ 0.025050330439572832
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Mnemosynella bozhongmuii",
+ "Euryarchaeota",
+ "Candidatus Mnemosynellales",
+ "MBC7114233.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(43, 119, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.06464359093197061
+ ],
+ "y": [
+ -0.03920990260852762
+ ],
+ "z": [
+ 0.015670282645506864
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "RLG20733.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 21, 103)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1122325250135049
+ ],
+ "y": [
+ -0.003236333773074673
+ ],
+ "z": [
+ -0.025616219187483733
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "archaeon BMS3Bbin15",
+ null,
+ null,
+ "GBE54704.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(68, 53, 126)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.03421803446283126
+ ],
+ "y": [
+ -0.05380906128109972
+ ],
+ "z": [
+ -0.0232153770399014
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanothrix sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MBK7386953.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(164, 218, 54)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.19716415196308
+ ],
+ "y": [
+ 0.030923929750481836
+ ],
+ "z": [
+ -0.01699499503640588
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoprotei archaeon",
+ "Thermoproteota",
+ null,
+ "RLF18434.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(183, 222, 43)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.17426691656091914
+ ],
+ "y": [
+ 0.0771392621728698
+ ],
+ "z": [
+ 0.013426606977589916
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Methanoperedens nitroreducens",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_048092961.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(64, 68, 134)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.13410614854259986
+ ],
+ "y": [
+ 0.0021264229406386483
+ ],
+ "z": [
+ -0.05814944227260199
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "UZE92607.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 21, 103)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.12445425249463167
+ ],
+ "y": [
+ -0.027618930059259094
+ ],
+ "z": [
+ -0.048865594832052765
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Aciduliprofundum boonei T469",
+ "Candidatus Thermoplasmatota",
+ "Aciduliprofundum",
+ "EDY36469.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(33, 152, 138)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.2135283421354843
+ ],
+ "y": [
+ -0.2059801408401477
+ ],
+ "z": [
+ 0.08740196081599269
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthase",
+ "Methanosaeta sp. PtaB.Bin039",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "OPX77490.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(71, 28, 109)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthase",
+ "type": "scatter3d",
+ "x": [
+ -0.21385735090411642
+ ],
+ "y": [
+ 0.03286049488384262
+ ],
+ "z": [
+ -0.015409281932549484
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methermicoccus shengliensis",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_042687265.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(44, 172, 128)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.11782783374265722
+ ],
+ "y": [
+ -0.02276075055290794
+ ],
+ "z": [
+ -0.017199873100469325
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Archaeoglobus sp.",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "RUM35208.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(199, 224, 41)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.11950214689321906
+ ],
+ "y": [
+ -0.030122015976170778
+ ],
+ "z": [
+ 0.023540797616974734
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "MBU4491309.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1423740123120926
+ ],
+ "y": [
+ -0.009037198344798172
+ ],
+ "z": [
+ -0.042382731396733146
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanothrix",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_011695912.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(38, 130, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1744467217653833
+ ],
+ "y": [
+ 0.010747020028385089
+ ],
+ "z": [
+ 0.0021129471278614714
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Archaeoglobus veneficus",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "HDD36689.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(68, 4, 87)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.12824734631872375
+ ],
+ "y": [
+ -0.01841016246026658
+ ],
+ "z": [
+ -0.007912137218673858
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanothermus fervidus",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_013414187.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(166, 219, 52)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.06626250530399498
+ ],
+ "y": [
+ -0.01663244526525872
+ ],
+ "z": [
+ -0.08980170125996155
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Archaeoglobales archaeon",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "RLI84851.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(42, 120, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.11973321136064793
+ ],
+ "y": [
+ -0.024732809160443715
+ ],
+ "z": [
+ 0.03603371161823332
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanohalophilus sp. RSK",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_123137136.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(152, 215, 61)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.14841558927220785
+ ],
+ "y": [
+ -0.01968769434312013
+ ],
+ "z": [
+ -0.056928525252301826
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Methanoperedens sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCE8423993.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(45, 114, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.13484870962314233
+ ],
+ "y": [
+ -0.011412024482289507
+ ],
+ "z": [
+ -0.04268061496931407
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Archaeoglobales archaeon ex4484_92",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "OYT33403.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(69, 13, 95)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.12018451421367363
+ ],
+ "y": [
+ -0.04707262747968173
+ ],
+ "z": [
+ 0.026579785748234563
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "MBI5252857.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.0017836843574728885
+ ],
+ "y": [
+ -0.04834356455977197
+ ],
+ "z": [
+ 0.04764362132134663
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanocellales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCD5409487.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(68, 5, 88)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.14749152171913743
+ ],
+ "y": [
+ -0.0020403905497471163
+ ],
+ "z": [
+ 0.005270125360743181
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcina sp. DH2",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_229389494.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(69, 16, 97)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.17051480397426466
+ ],
+ "y": [
+ -0.02800669086439097
+ ],
+ "z": [
+ -0.051943767564206905
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthase",
+ "uncultured archaeon",
+ "environmental samples",
+ null,
+ "VVB88143.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(35, 162, 134)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthase",
+ "type": "scatter3d",
+ "x": [
+ -0.14429453575373655
+ ],
+ "y": [
+ 0.009815298200922137
+ ],
+ "z": [
+ -0.05272984912892373
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcina sp. MTP4",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_048181864.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(59, 81, 138)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.15021405908524704
+ ],
+ "y": [
+ -0.002311546925185018
+ ],
+ "z": [
+ -0.06693221326758166
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "NYT01285.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 21, 103)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.19191091347116368
+ ],
+ "y": [
+ 0.04110931631589917
+ ],
+ "z": [
+ -0.04708814236890892
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCI4364258.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.11949200622959372
+ ],
+ "y": [
+ -0.11568945856796145
+ ],
+ "z": [
+ 0.10387897672137622
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Archaeoglobales archaeon",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "NHW89294.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(42, 120, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.12867821719087305
+ ],
+ "y": [
+ -0.03066065753120214
+ ],
+ "z": [
+ 0.018974548095716283
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthase",
+ "Methanosaeta sp. PtaU1.Bin060",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "OPY54184.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(109, 206, 88)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthase",
+ "type": "scatter3d",
+ "x": [
+ -0.19242928593640776
+ ],
+ "y": [
+ 0.020290961750487523
+ ],
+ "z": [
+ -0.05390568887558912
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanococcus vannielii",
+ "Euryarchaeota",
+ "Methanococci",
+ "WP_012065777.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(32, 155, 138)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.007839449757103626
+ ],
+ "y": [
+ -0.05511328573131355
+ ],
+ "z": [
+ -0.0199217673628612
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoprotei archaeon",
+ "Thermoproteota",
+ null,
+ "RLF24428.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(183, 222, 43)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.18614181688288073
+ ],
+ "y": [
+ 0.08886743329872115
+ ],
+ "z": [
+ 0.025008057827424816
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCI4360054.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.1370417223420742
+ ],
+ "y": [
+ -0.14281762425853023
+ ],
+ "z": [
+ 0.10776345738340747
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanothrix sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCK9441463.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(164, 218, 54)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.20183946684930779
+ ],
+ "y": [
+ 0.026809425149816532
+ ],
+ "z": [
+ -0.042832751064901045
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MBW6470267.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(38, 131, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1771389624518166
+ ],
+ "y": [
+ -0.006791088821448662
+ ],
+ "z": [
+ -0.04798190191607273
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Archaeoglobaceae archaeon",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "MCS7122278.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(51, 180, 123)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.11363644615098606
+ ],
+ "y": [
+ -0.04398401640267559
+ ],
+ "z": [
+ 0.04070403304985813
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthase",
+ "uncultured archaeon",
+ "environmental samples",
+ null,
+ "VVB92588.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(35, 162, 134)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthase",
+ "type": "scatter3d",
+ "x": [
+ -0.12561592963316726
+ ],
+ "y": [
+ -0.016628109702191966
+ ],
+ "z": [
+ -0.048465556132277154
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobacterium alcaliphilum",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_248611105.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(130, 210, 76)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.11722773893633405
+ ],
+ "y": [
+ 0.009754358535794755
+ ],
+ "z": [
+ -0.1196332539460114
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosalsum zhilinae",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_048815409.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(123, 209, 80)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.17002002050107184
+ ],
+ "y": [
+ -0.0007660712936008951
+ ],
+ "z": [
+ -0.029798309163708736
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Archaeoglobaceae archaeon",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "HID43215.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(51, 180, 123)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1080161242981231
+ ],
+ "y": [
+ -0.014348138128589928
+ ],
+ "z": [
+ -0.017916765344304746
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanotrichaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "NPV61856.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(33, 160, 136)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.16687516514604725
+ ],
+ "y": [
+ 0.01656728885951054
+ ],
+ "z": [
+ -0.020152944008661754
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "MBU4077635.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.14861527753309517
+ ],
+ "y": [
+ 0.005745997515156888
+ ],
+ "z": [
+ -0.03638828251634966
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanotrichaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MBN1323584.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(33, 160, 136)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.19583837121851752
+ ],
+ "y": [
+ 0.020083071092354434
+ ],
+ "z": [
+ -0.019284611787619216
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthase",
+ "uncultured archaeon",
+ "environmental samples",
+ null,
+ "VVB62794.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(35, 162, 134)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthase",
+ "type": "scatter3d",
+ "x": [
+ -0.1837613406423114
+ ],
+ "y": [
+ 0.036010481776322954
+ ],
+ "z": [
+ -0.05383791981449384
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Bathyarchaeota archaeon",
+ "Candidatus Bathyarchaeota",
+ null,
+ "RLG99681.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(55, 184, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.13182240628498057
+ ],
+ "y": [
+ -0.02134845504475399
+ ],
+ "z": [
+ -0.006677244190201808
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanothrix sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "NMC09821.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(164, 218, 54)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.16150055121821183
+ ],
+ "y": [
+ 0.002332852549033516
+ ],
+ "z": [
+ -0.020878293099882813
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "conserved protein",
+ "Methanothermobacter thermautotrophicus str. Delta H",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "AAB85853.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(136, 212, 72)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "conserved protein",
+ "type": "scatter3d",
+ "x": [
+ -0.10165207356589565
+ ],
+ "y": [
+ 0.00021835944657785084
+ ],
+ "z": [
+ -0.09437256131666757
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "uncultured organism",
+ "environmental samples",
+ null,
+ "AGF93535.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(113, 207, 86)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.30509697577372197
+ ],
+ "y": [
+ 0.33464319162465295
+ ],
+ "z": [
+ 0.5949240523997081
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Methanosarcinales archaeon ex4572_44",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "PHP46028.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 36, 116)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.15997127354002005
+ ],
+ "y": [
+ -0.024596356211131917
+ ],
+ "z": [
+ -0.041056068784639306
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanotrichaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCJ7444871.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(33, 160, 136)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.15735233625831171
+ ],
+ "y": [
+ 0.01867967076510215
+ ],
+ "z": [
+ -0.015521500647484901
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanolobus profundi",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_091935294.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(95, 200, 97)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.16434881828749384
+ ],
+ "y": [
+ -0.008167803642008408
+ ],
+ "z": [
+ -0.05936833886044737
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanothrix sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MBP7070042.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(164, 218, 54)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.19857172539619822
+ ],
+ "y": [
+ 0.003731225716596555
+ ],
+ "z": [
+ -0.024004092866657268
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCI4324893.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.11396322305145991
+ ],
+ "y": [
+ -0.11517508383825341
+ ],
+ "z": [
+ 0.08952590077397163
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobacteriaceae archaeon",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "NYB27336.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(150, 215, 63)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1159464445874244
+ ],
+ "y": [
+ 0.004900997490069885
+ ],
+ "z": [
+ -0.10948620830254878
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "RLF67685.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.0887914279556507
+ ],
+ "y": [
+ -0.12689910812340505
+ ],
+ "z": [
+ 0.1131605690485117
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Methanolobus sp. T82-4",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "KXS44515.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(35, 141, 140)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.16613466162273277
+ ],
+ "y": [
+ -0.004088962522939051
+ ],
+ "z": [
+ -0.063906470782751
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCD4704385.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(38, 131, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.16184436689568765
+ ],
+ "y": [
+ 0.008117639273246116
+ ],
+ "z": [
+ -0.06666634426916421
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthase",
+ "Methanomethylovorans sp. PtaU1.Bin093",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "OPY20232.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(71, 32, 113)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthase",
+ "type": "scatter3d",
+ "x": [
+ -0.1868463273073264
+ ],
+ "y": [
+ -0.005369740436586959
+ ],
+ "z": [
+ -0.055410736477271225
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Methanococcus maripaludis",
+ "Euryarchaeota",
+ "Methanococci",
+ "AVB76578.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(71, 30, 111)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.005880938941084088
+ ],
+ "y": [
+ -0.08945405170001257
+ ],
+ "z": [
+ -0.018406948209041887
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "HJH29718.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(38, 131, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1642125892558234
+ ],
+ "y": [
+ -0.017303786416171134
+ ],
+ "z": [
+ -0.054735635470718066
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Archaeoglobaceae archaeon",
+ "Euryarchaeota",
+ "Archaeoglobales",
+ "MCS7143645.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(51, 180, 123)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.08515725058210763
+ ],
+ "y": [
+ -0.03134424558367831
+ ],
+ "z": [
+ 0.03639065725014678
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanothrix sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MBP8624531.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(164, 218, 54)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.16982214784854088
+ ],
+ "y": [
+ 0.008742630911699778
+ ],
+ "z": [
+ -0.03863867837875655
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobacterium alkalithermotolerans",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_211532318.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(189, 223, 42)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.0959118146511117
+ ],
+ "y": [
+ -0.014011358874037197
+ ],
+ "z": [
+ -0.09912847183937619
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MBN2110251.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(38, 131, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1584213817518695
+ ],
+ "y": [
+ -0.009903630884124943
+ ],
+ "z": [
+ -0.06717662788970788
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanohalophilus levihalophilus",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_245312871.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(39, 167, 131)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.14854391357346586
+ ],
+ "y": [
+ -0.009021596349734352
+ ],
+ "z": [
+ -0.06961859058289133
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Methanoperedens sp. BLZ2",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_097297927.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(63, 71, 136)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.14659150867117618
+ ],
+ "y": [
+ 0.004836302314429766
+ ],
+ "z": [
+ -0.06506936809066578
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "MBU2617480.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.10547233514527216
+ ],
+ "y": [
+ -0.03073759047990853
+ ],
+ "z": [
+ -0.0017148090959857008
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "HID28100.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 21, 103)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.15147732304593262
+ ],
+ "y": [
+ -0.024770516614231842
+ ],
+ "z": [
+ -0.025926865673923893
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobacterium sp.",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "MCE5214126.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(44, 115, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.10545276416123912
+ ],
+ "y": [
+ 0.00008921738132678636
+ ],
+ "z": [
+ -0.12234741833333147
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Altiarchaeota archaeon",
+ "Candidatus Altarchaeota",
+ null,
+ "MBN2014929.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(80, 194, 106)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.015176482590192953
+ ],
+ "y": [
+ -0.04358666295745576
+ ],
+ "z": [
+ 0.167127941764437
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoprotei archaeon",
+ "Thermoproteota",
+ null,
+ "MCD6510857.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(183, 222, 43)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.22710393719211208
+ ],
+ "y": [
+ 0.14073759702008687
+ ],
+ "z": [
+ -0.004065861167016623
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "HJH31947.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(38, 131, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1675291086001379
+ ],
+ "y": [
+ -0.007132970970393257
+ ],
+ "z": [
+ -0.05577323022595608
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanolobus chelungpuianus",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_256622243.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(251, 231, 37)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.13991920319601744
+ ],
+ "y": [
+ -0.01668525849872159
+ ],
+ "z": [
+ -0.07185803468160545
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Methanoperedenaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "HIH44319.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(205, 225, 41)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1664310260551494
+ ],
+ "y": [
+ -0.004399332077353898
+ ],
+ "z": [
+ -0.024377617358988315
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Nanopusillus sp.",
+ "Nanoarchaeota",
+ "Nanoarchaeales",
+ "HIP90423.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(66, 58, 129)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.03221144407756771
+ ],
+ "y": [
+ -0.0786075146470378
+ ],
+ "z": [
+ 0.045022077058054354
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "NLI62906.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(38, 131, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.12065827687904654
+ ],
+ "y": [
+ -0.02300825487376208
+ ],
+ "z": [
+ -0.032031886314911696
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MBO4302570.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(38, 131, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1477972275378231
+ ],
+ "y": [
+ 0.007635487523777142
+ ],
+ "z": [
+ -0.042746219738975536
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "MCD6502674.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.13871422048958143
+ ],
+ "y": [
+ -0.15425990327470115
+ ],
+ "z": [
+ 0.054875666540619684
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Aenigmarchaeota archaeon",
+ "Candidatus Aenigmarchaeota",
+ null,
+ "MBI2971037.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(85, 196, 103)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.7316955890335949
+ ],
+ "y": [
+ -0.7689958377265071
+ ],
+ "z": [
+ -0.8273934355894998
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanococcus voltae",
+ "Euryarchaeota",
+ "Methanococci",
+ "WP_209631652.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(69, 8, 90)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.00874669865468458
+ ],
+ "y": [
+ -0.10507514090102442
+ ],
+ "z": [
+ 0.006676919192234695
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Candidatus Syntrophoarchaeum caldarius",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "OFV67108.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(50, 102, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.15825679109009405
+ ],
+ "y": [
+ -0.04236557131649251
+ ],
+ "z": [
+ -0.011714545277134386
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthase",
+ "Candidatus Methanoperedenaceae archaeon GB37",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "CAD7775635.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(86, 196, 102)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthase",
+ "type": "scatter3d",
+ "x": [
+ -0.15824828608861205
+ ],
+ "y": [
+ -0.014512671889932908
+ ],
+ "z": [
+ -0.03233405283973844
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoprotei archaeon",
+ "Thermoproteota",
+ null,
+ "MCD6095735.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(183, 222, 43)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.1722635611235355
+ ],
+ "y": [
+ 0.07388366594362433
+ ],
+ "z": [
+ 0.01363687033721926
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Alkanophagales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "RLG39174.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(224, 227, 39)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.19897929480815174
+ ],
+ "y": [
+ -0.07526862113283189
+ ],
+ "z": [
+ 0.05047200099717791
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobacterium aggregans",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_209583443.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(68, 1, 84)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.090546688048149
+ ],
+ "y": [
+ -0.002345913351296194
+ ],
+ "z": [
+ -0.09821734828080012
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCI4352892.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.11282271796842143
+ ],
+ "y": [
+ -0.13265378986814852
+ ],
+ "z": [
+ 0.11695899263280493
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Methanobacterium sp. BRmetb2",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "AXV37642.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(37, 132, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.10909500645011525
+ ],
+ "y": [
+ -0.0025347125375425853
+ ],
+ "z": [
+ -0.12975075751345108
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanothermococcus okinawensis",
+ "Euryarchaeota",
+ "Methanococci",
+ "HIQ32451.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(42, 170, 129)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.041981302373887176
+ ],
+ "y": [
+ -0.07877453739594639
+ ],
+ "z": [
+ 0.03497136165569438
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Euryarchaeota archaeon RBG_19FT_COMBO_69_17",
+ "Euryarchaeota",
+ null,
+ "OGS64371.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(174, 221, 47)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.1952593099636586
+ ],
+ "y": [
+ -0.19607031668252936
+ ],
+ "z": [
+ 0.11765428471979096
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoprotei archaeon",
+ "Thermoproteota",
+ null,
+ "RLE54635.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(183, 222, 43)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.23680129399496494
+ ],
+ "y": [
+ 0.11360200717857691
+ ],
+ "z": [
+ -0.0023823784888495044
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanothermobacter tenebrarum",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_112094483.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(127, 210, 77)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.05302314873314141
+ ],
+ "y": [
+ -0.015086048983142905
+ ],
+ "z": [
+ -0.10128257729916113
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Methanoperedenaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MBE0521418.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(205, 225, 41)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1563359968086937
+ ],
+ "y": [
+ 0.011659989790767433
+ ],
+ "z": [
+ -0.05074945680060356
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobrevibacter sp.",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "MCL2114715.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(35, 142, 140)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.07792100382142753
+ ],
+ "y": [
+ -0.00042151854522804567
+ ],
+ "z": [
+ -0.10475879492549077
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanolobus",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_023845034.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(207, 225, 41)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.16968943103797068
+ ],
+ "y": [
+ -0.00212801409496949
+ ],
+ "z": [
+ -0.0723000126855892
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCI4340171.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.14797778966311698
+ ],
+ "y": [
+ -0.1611366076707721
+ ],
+ "z": [
+ 0.14252477835754554
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanimicrococcus blatticola",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_133517937.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(142, 213, 68)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.16927977211387488
+ ],
+ "y": [
+ -0.01980568179165152
+ ],
+ "z": [
+ -0.04897236525965892
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCI4332674.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.11055203727224927
+ ],
+ "y": [
+ -0.12685751828316616
+ ],
+ "z": [
+ 0.09833673122073619
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthase",
+ "Methanonatronarchaeales archaeon",
+ "Euryarchaeota",
+ "Methanonatronarchaeales",
+ "MBS1263960.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(67, 189, 113)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthase",
+ "type": "scatter3d",
+ "x": [
+ -0.05360200533865334
+ ],
+ "y": [
+ 0.04952331414660547
+ ],
+ "z": [
+ -0.016303149360144847
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanonatronarchaeum thermophilum",
+ "Euryarchaeota",
+ "Methanonatronarchaeales",
+ "WP_086636802.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(65, 188, 114)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.35462602461557335
+ ],
+ "y": [
+ -0.1779233339572418
+ ],
+ "z": [
+ -0.019033175032879684
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthase",
+ "Candidatus Methanobinarius endosymbioticus",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "RBQ22678.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(69, 7, 89)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthase",
+ "type": "scatter3d",
+ "x": [
+ -0.0631714425370439
+ ],
+ "y": [
+ -0.002574357466363141
+ ],
+ "z": [
+ -0.10837153549467482
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCI4350047.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.14249035122442957
+ ],
+ "y": [
+ -0.11954524773950408
+ ],
+ "z": [
+ 0.12847824388089069
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanothermococcus okinawensis",
+ "Euryarchaeota",
+ "Methanococci",
+ "WP_013866510.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(42, 170, 129)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.024197519941884665
+ ],
+ "y": [
+ -0.09486445309007328
+ ],
+ "z": [
+ 0.04273130829091148
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Desulfurococcales archaeon",
+ "Thermoproteota",
+ "Desulfurococcales",
+ "HIQ03509.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(52, 97, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.24557690103183105
+ ],
+ "y": [
+ 0.1433013535746454
+ ],
+ "z": [
+ -0.003157537113872325
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCL5678960.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.21479560342095114
+ ],
+ "y": [
+ -0.17121845486626572
+ ],
+ "z": [
+ 0.06265472727334104
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobacterium",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_069583781.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 48, 124)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.09316648869301598
+ ],
+ "y": [
+ -0.007153199677038329
+ ],
+ "z": [
+ -0.1392122963882012
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Ignisphaera sp.",
+ "Thermoproteota",
+ "Desulfurococcales",
+ "HID80336.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(55, 89, 140)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.21536575401618768
+ ],
+ "y": [
+ 0.10381000364249961
+ ],
+ "z": [
+ 0.015488352937796686
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Methanobacteriales archaeon HGW-Methanobacteriales-1",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "PKL67098.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(31, 156, 137)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.09291948475891493
+ ],
+ "y": [
+ 0.0038402431462824503
+ ],
+ "z": [
+ -0.11200331225539714
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanothermococcus",
+ "Euryarchaeota",
+ "Methanococci",
+ "WP_018154351.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(63, 187, 115)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.02746290158782535
+ ],
+ "y": [
+ -0.06665136816761695
+ ],
+ "z": [
+ -0.004125252437532542
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanothermococcus okinawensis",
+ "Euryarchaeota",
+ "Methanococci",
+ "HIP16080.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(42, 170, 129)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.034806549167802556
+ ],
+ "y": [
+ -0.09154837519569771
+ ],
+ "z": [
+ 0.031077759124105556
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanimicrococcus sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCL2863353.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(32, 159, 136)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.14800215161679592
+ ],
+ "y": [
+ -0.01651891754285943
+ ],
+ "z": [
+ -0.06958985867207028
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCI4331890.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.12021460168151984
+ ],
+ "y": [
+ -0.12403006197482656
+ ],
+ "z": [
+ 0.12767053957184404
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "HDJ38237.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 21, 103)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.14696129494109383
+ ],
+ "y": [
+ 0.012464343226967635
+ ],
+ "z": [
+ -0.048785393297839486
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCD6146309.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 21, 103)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.12601980803034105
+ ],
+ "y": [
+ 0.03049306394032127
+ ],
+ "z": [
+ -0.0401931151709949
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "MBI5000778.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.1678499163443128
+ ],
+ "y": [
+ -0.1881889199169077
+ ],
+ "z": [
+ 0.12650897399621402
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MBN2488116.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(38, 131, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1779702304045189
+ ],
+ "y": [
+ -0.00980450336606035
+ ],
+ "z": [
+ -0.06993890018197632
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCI4365484.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.14565001629409113
+ ],
+ "y": [
+ -0.1411017608416584
+ ],
+ "z": [
+ 0.15623123388944077
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobrevibacter cuticularis",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_067260239.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(61, 76, 137)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.10400832098558453
+ ],
+ "y": [
+ 0.008489362210027768
+ ],
+ "z": [
+ -0.1405962383239295
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "NYT19736.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 21, 103)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.16879792703088775
+ ],
+ "y": [
+ -0.015936907401244964
+ ],
+ "z": [
+ -0.03698034449498897
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanogenium sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCK4269415.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(71, 31, 112)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.18756218501893857
+ ],
+ "y": [
+ -0.046470333538457566
+ ],
+ "z": [
+ -0.08779583663169724
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanotrichaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "HII06378.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(33, 160, 136)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.2017922078139833
+ ],
+ "y": [
+ 0.026866272783150385
+ ],
+ "z": [
+ -0.03248397785742827
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Altiarchaeales archaeon",
+ "Candidatus Altarchaeota",
+ null,
+ "HIE33825.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(195, 224, 42)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.06969477814210154
+ ],
+ "y": [
+ -0.06856256048959092
+ ],
+ "z": [
+ 0.2416421564104299
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCD5425932.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(38, 131, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.14477250406200107
+ ],
+ "y": [
+ -0.0118725881270079
+ ],
+ "z": [
+ -0.06562145295236818
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCL4338039.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.24764875642402912
+ ],
+ "y": [
+ -0.212492666152551
+ ],
+ "z": [
+ 0.07800911505345234
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobacterium paludis",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_013826834.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(75, 192, 108)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.10462061173114819
+ ],
+ "y": [
+ -0.0033843621258078447
+ ],
+ "z": [
+ -0.14302609729740245
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Ignisphaera aggregans DSM 17230",
+ "Thermoproteota",
+ "Desulfurococcales",
+ "ADM28331.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(158, 217, 58)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.21795741142848096
+ ],
+ "y": [
+ 0.10649453582891345
+ ],
+ "z": [
+ -0.0018537640193095862
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobacterium sp.",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "MBI5679298.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(44, 115, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.0865347291667926
+ ],
+ "y": [
+ 0.018801582446306014
+ ],
+ "z": [
+ -0.1288545989124389
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoprotei archaeon",
+ "Thermoproteota",
+ null,
+ "RLG86775.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(183, 222, 43)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.23129944403255356
+ ],
+ "y": [
+ 0.12775897583647183
+ ],
+ "z": [
+ -0.010672118593177302
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanospirillum sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "NLX49570.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(47, 176, 125)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.2069493325845314
+ ],
+ "y": [
+ -0.029850735690129918
+ ],
+ "z": [
+ -0.06644650496592647
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanocalculus chunghsingensis",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_211530438.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(68, 189, 112)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.19483003210561553
+ ],
+ "y": [
+ -0.04364077326561369
+ ],
+ "z": [
+ -0.08984687065939558
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanolinea sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCQ8894229.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(48, 107, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.20365030454484867
+ ],
+ "y": [
+ -0.018768456800657547
+ ],
+ "z": [
+ -0.06905448826957801
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanothermococcus sp. SCGC AD-155-N22",
+ "Euryarchaeota",
+ "Methanococci",
+ "MBW9220344.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(226, 228, 39)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.00697542498036542
+ ],
+ "y": [
+ -0.08552038801379758
+ ],
+ "z": [
+ 0.036852856025140136
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthase",
+ "Candidatus Argoarchaeum ethanivorans",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "CAD6493058.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 18, 100)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthase",
+ "type": "scatter3d",
+ "x": [
+ -0.17562512714342143
+ ],
+ "y": [
+ 0.01917198761724613
+ ],
+ "z": [
+ -0.04551034113936281
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "HDN65233.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 21, 103)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.12885558645881293
+ ],
+ "y": [
+ 0.034168223181985584
+ ],
+ "z": [
+ -0.044606368111615245
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoprotei archaeon",
+ "Thermoproteota",
+ null,
+ "RLF08155.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(183, 222, 43)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.3411242229172502
+ ],
+ "y": [
+ 0.1955827556735402
+ ],
+ "z": [
+ 0.010596214477701892
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanococcoides sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "NOQ48507.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(31, 157, 137)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.16574362413803
+ ],
+ "y": [
+ 0.012552987805514235
+ ],
+ "z": [
+ -0.06290226599891066
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoprotei archaeon",
+ "Thermoproteota",
+ null,
+ "RLE93954.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(183, 222, 43)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.23085157663469544
+ ],
+ "y": [
+ 0.10495776041391242
+ ],
+ "z": [
+ -0.0048471106380660045
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCK4652251.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 21, 103)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.12563671987426422
+ ],
+ "y": [
+ 0.012779291842688436
+ ],
+ "z": [
+ -0.0427602506039745
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Verstraetearchaeota archaeon",
+ "Candidatus Verstraetearchaeota",
+ null,
+ "RLE48238.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(49, 179, 124)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.24770902893094301
+ ],
+ "y": [
+ 0.13896877957401957
+ ],
+ "z": [
+ -0.024268978155830654
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "archaeon SCG-AAA382B04",
+ null,
+ null,
+ "PTD93741.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(247, 230, 38)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.2457052738687439
+ ],
+ "y": [
+ -0.10787161800370966
+ ],
+ "z": [
+ -0.016732905404876847
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanoregulaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCU0630815.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(36, 136, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.18124066353105675
+ ],
+ "y": [
+ -0.024990582221361718
+ ],
+ "z": [
+ -0.07506853080681558
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Thermofilum sp. ex4484_79",
+ "Thermoproteota",
+ "Thermofilales",
+ "OYT30676.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(117, 208, 83)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.28685566374194166
+ ],
+ "y": [
+ 0.15885768908874445
+ ],
+ "z": [
+ 0.010087926507622899
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanopyrus sp. KOL6",
+ "Euryarchaeota",
+ "Methanopyri",
+ "WP_088334627.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(34, 145, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.008059218496446316
+ ],
+ "y": [
+ 0.0279403753956204
+ ],
+ "z": [
+ 0.05887586717639593
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanomassiliicoccales archaeon",
+ "Candidatus Thermoplasmatota",
+ "Methanomassiliicoccales",
+ "NYT15305.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(33, 148, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.19407322438777438
+ ],
+ "y": [
+ -0.25116884635645503
+ ],
+ "z": [
+ 0.11355853731085083
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanonatronarchaeum sp. AMET6-2",
+ "Euryarchaeota",
+ "Methanonatronarchaeales",
+ "WP_247139346.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(67, 57, 129)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.36437971345757975
+ ],
+ "y": [
+ -0.16564214362494467
+ ],
+ "z": [
+ -0.010711333041154342
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Euryarchaeota archaeon RBG_16_67_27",
+ "Euryarchaeota",
+ null,
+ "OGS47575.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(121, 209, 81)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.19032886923685238
+ ],
+ "y": [
+ -0.192111578020866
+ ],
+ "z": [
+ 0.12324181594315371
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCU0852918.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.19216941142931396
+ ],
+ "y": [
+ -0.22385173693294635
+ ],
+ "z": [
+ 0.11506117655792947
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanomicrobiales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "NLV26673.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(58, 83, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.22403235695824872
+ ],
+ "y": [
+ -0.05538947978079897
+ ],
+ "z": [
+ -0.10622228585361415
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halanaeroarchaeum sulfurireducens",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_050048754.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(55, 89, 140)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.02429343285158319
+ ],
+ "y": [
+ 0.1081669857102651
+ ],
+ "z": [
+ 0.00628429098397937
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Methanosphaera sp. rholeuAM74",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "RAP48284.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(71, 27, 108)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.07957278174148531
+ ],
+ "y": [
+ 0.015340672363790032
+ ],
+ "z": [
+ -0.16297012266534813
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCD6462054.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.13295796512517621
+ ],
+ "y": [
+ -0.18218893338498002
+ ],
+ "z": [
+ 0.0894071465244476
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Altiarchaeales archaeon",
+ "Candidatus Altarchaeota",
+ null,
+ "RLI92042.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(195, 224, 42)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.04948230577928174
+ ],
+ "y": [
+ -0.06107199453400009
+ ],
+ "z": [
+ 0.16228798748617804
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmatales archaeon",
+ "Candidatus Thermoplasmatota",
+ "Thermoplasmatales",
+ "MCG2826556.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(162, 218, 55)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.17869440476341683
+ ],
+ "y": [
+ -0.2386021064193096
+ ],
+ "z": [
+ 0.11238184441351842
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "Archaeal S-adenosylmethionine synthetase",
+ "Candidatus Methanohalarchaeum thermophilum",
+ "Euryarchaeota",
+ "Methanonatronarchaeales",
+ "OKY79041.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(53, 95, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "Archaeal S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.2336597158158538
+ ],
+ "y": [
+ -0.0891174554820183
+ ],
+ "z": [
+ -0.02499880553363204
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobacterium",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_048072774.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 48, 124)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.09410591572499323
+ ],
+ "y": [
+ 0.017804928223093718
+ ],
+ "z": [
+ -0.15539907532975245
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobacterium",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_100905321.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 48, 124)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.0758790210357579
+ ],
+ "y": [
+ 0.011243636006566865
+ ],
+ "z": [
+ -0.1479552654165619
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Picrophilus oshimae DSM 9789",
+ "Candidatus Thermoplasmatota",
+ "Thermoplasmatales",
+ "AAT43329.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(68, 54, 127)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.22253608905877492
+ ],
+ "y": [
+ -0.20766536501841856
+ ],
+ "z": [
+ 0.06163195439623853
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "archaeon",
+ null,
+ null,
+ "MCQ2972576.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(34, 147, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.08892090616772735
+ ],
+ "y": [
+ 0.014913588127451267
+ ],
+ "z": [
+ -0.1730756308978188
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "candidate division MSBL1 archaeon SCGC-AAA259B11",
+ "Euryarchaeota",
+ null,
+ "KXA90431.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(41, 122, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.29099684021725636
+ ],
+ "y": [
+ 0.3246292356995954
+ ],
+ "z": [
+ 0.5978617826769219
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halapricum salinum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_049992581.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(54, 183, 121)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.01714175050004612
+ ],
+ "y": [
+ 0.14654606722994007
+ ],
+ "z": [
+ 0.010338094070339246
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosalsum natronophilum",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_259135288.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(33, 151, 138)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1823842851340802
+ ],
+ "y": [
+ 0.007389022026663876
+ ],
+ "z": [
+ -0.06304771212923665
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobacterium sp. SMA-27",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_048191960.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 23, 105)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.10315432889045272
+ ],
+ "y": [
+ 0.014648012427053497
+ ],
+ "z": [
+ -0.12744191891900908
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Altiarchaeales archaeon",
+ "Candidatus Altarchaeota",
+ null,
+ "RLI88430.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(195, 224, 42)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.06953070201914466
+ ],
+ "y": [
+ -0.07617276616336964
+ ],
+ "z": [
+ 0.1718870278060451
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCL4330426.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.23701984743471635
+ ],
+ "y": [
+ -0.18951519256842844
+ ],
+ "z": [
+ 0.08250687881840552
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCU0859210.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.18484475008717932
+ ],
+ "y": [
+ -0.20642002869830187
+ ],
+ "z": [
+ 0.13166776985840936
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MBE0519066.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.16836650212791548
+ ],
+ "y": [
+ -0.21222050058098213
+ ],
+ "z": [
+ 0.12131076989437146
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanothrix sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCR3884112.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(164, 218, 54)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.18684689890855508
+ ],
+ "y": [
+ 0.01639512507397615
+ ],
+ "z": [
+ -0.023855574631132342
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobrevibacter arboriphilus",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_054834771.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(39, 127, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.08488085862807515
+ ],
+ "y": [
+ -0.009369397150949355
+ ],
+ "z": [
+ -0.115310510197178
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCL5731097.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.20904740932378235
+ ],
+ "y": [
+ -0.18399391364882794
+ ],
+ "z": [
+ 0.07127672575631301
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Aciduliprofundum sp.",
+ "Candidatus Thermoplasmatota",
+ "Aciduliprofundum",
+ "PMP73360.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(62, 72, 137)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.18235982200115802
+ ],
+ "y": [
+ -0.17191099156516731
+ ],
+ "z": [
+ 0.07883346705267746
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "HII39977.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.1777562975803727
+ ],
+ "y": [
+ -0.19902232164359626
+ ],
+ "z": [
+ 0.09375381811241569
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobacterium petrolearium",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_209624290.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(37, 133, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.10679574045649633
+ ],
+ "y": [
+ 0.018250267155412832
+ ],
+ "z": [
+ -0.1474906880282934
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCL4328217.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.24494309423539093
+ ],
+ "y": [
+ -0.20316769176096122
+ ],
+ "z": [
+ 0.08120894479781908
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanocalculus sp. MSAO_Arc2",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "RQD85122.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(39, 167, 131)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.21523769846607446
+ ],
+ "y": [
+ -0.01782503441862869
+ ],
+ "z": [
+ -0.10934897257645215
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosphaera stadtmanae",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "MBE6493246.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(69, 9, 91)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.08088682408744123
+ ],
+ "y": [
+ -0.009458862540939198
+ ],
+ "z": [
+ -0.1650347691988043
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Altiarchaeota archaeon",
+ "Candidatus Altarchaeota",
+ null,
+ "MBU0761834.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(80, 194, 106)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.11332742503636067
+ ],
+ "y": [
+ -0.05331006784671043
+ ],
+ "z": [
+ 0.1678265838728497
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanolinea mesophila",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_209675974.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(64, 65, 133)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.21026931449716788
+ ],
+ "y": [
+ -0.013321187554352708
+ ],
+ "z": [
+ -0.07654572131199307
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanococcus aeolicus",
+ "Euryarchaeota",
+ "Methanococci",
+ "WP_011973179.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(32, 156, 137)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.00510196285798241
+ ],
+ "y": [
+ -0.07134983716701272
+ ],
+ "z": [
+ -0.01611679148741486
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halobacterium zhouii",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_232685737.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 37, 117)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.017162747555887304
+ ],
+ "y": [
+ 0.1350515009712641
+ ],
+ "z": [
+ 0.02782966167934065
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Altiarchaeota archaeon",
+ "Candidatus Altarchaeota",
+ null,
+ "MBN2251254.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(80, 194, 106)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.0950750962923393
+ ],
+ "y": [
+ -0.07321600384014099
+ ],
+ "z": [
+ 0.23304014041150656
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCL4343227.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.24251544545733
+ ],
+ "y": [
+ -0.19113169915442277
+ ],
+ "z": [
+ 0.0717869933288511
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanimicrococcus sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCL2142194.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(32, 159, 136)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.15862896847075028
+ ],
+ "y": [
+ -0.029993169071903532
+ ],
+ "z": [
+ -0.04939759919091712
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosphaera sp. BMS",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_112123877.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(68, 53, 127)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.08866785199804664
+ ],
+ "y": [
+ 0.02855832193950032
+ ],
+ "z": [
+ -0.13945011174836328
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanophagales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCD6203804.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(63, 70, 135)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.25318376983863766
+ ],
+ "y": [
+ -0.08594194569466573
+ ],
+ "z": [
+ 0.07412004405604884
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Aenigmarchaeota archaeon",
+ "Candidatus Aenigmarchaeota",
+ null,
+ "MBI5355160.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(85, 196, 103)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.6235854916316999
+ ],
+ "y": [
+ 0.052979547354738456
+ ],
+ "z": [
+ -1
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanoregula boonei",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_012106609.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 45, 123)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.18956024103706004
+ ],
+ "y": [
+ -0.026277002241698984
+ ],
+ "z": [
+ -0.09914426677946774
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobacterium sp.",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "TMS42793.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(44, 115, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.07152757356539298
+ ],
+ "y": [
+ -0.008593226094988764
+ ],
+ "z": [
+ -0.11954565720333386
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCI4339003.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.12701480435833404
+ ],
+ "y": [
+ -0.1115458322330519
+ ],
+ "z": [
+ 0.11720277749814689
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Candidatus Altiarchaeales archaeon ex4484_2",
+ "Candidatus Altarchaeota",
+ null,
+ "OYT54135.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 190, 111)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.05907508954051159
+ ],
+ "y": [
+ -0.06148508745345584
+ ],
+ "z": [
+ 0.20697897108058555
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Bathyarchaeota archaeon",
+ "Candidatus Bathyarchaeota",
+ null,
+ "HID91237.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(55, 184, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.2936359775614522
+ ],
+ "y": [
+ 0.15926301954730052
+ ],
+ "z": [
+ -0.014637521744538164
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthase",
+ "Candidatus Odinarchaeum yellowstonii",
+ "Asgard group",
+ "Candidatus Odinarchaeum",
+ "OLS17286.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(69, 11, 93)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthase",
+ "type": "scatter3d",
+ "x": [
+ 0.19106480279780325
+ ],
+ "y": [
+ 0.05502731920605156
+ ],
+ "z": [
+ -0.02472997545776927
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Candidatus Altiarchaeales archaeon ex4484_43",
+ "Candidatus Altarchaeota",
+ null,
+ "OYT42366.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(71, 42, 121)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.07162426540681063
+ ],
+ "y": [
+ -0.050558111184112436
+ ],
+ "z": [
+ 0.11149105519128472
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MBU0685844.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.18128525146785282
+ ],
+ "y": [
+ -0.21912741297442814
+ ],
+ "z": [
+ 0.13134638416484948
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCL5988943.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.2571489537711813
+ ],
+ "y": [
+ -0.20725060859848954
+ ],
+ "z": [
+ 0.0494392203188269
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Methanophagales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "PXF52344.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(63, 70, 135)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.24347788114436134
+ ],
+ "y": [
+ -0.0869478360896956
+ ],
+ "z": [
+ 0.061023162143018686
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halanaeroarchaeum sp. HSR-CO",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_259517606.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(69, 10, 92)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.009436113980865787
+ ],
+ "y": [
+ 0.11270588433842152
+ ],
+ "z": [
+ -0.0019463473917633901
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanoregula sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WAC05702.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(41, 169, 130)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.20651320877613308
+ ],
+ "y": [
+ -0.03615130911138148
+ ],
+ "z": [
+ -0.06929522927342138
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanocorpusculum sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCQ2376414.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(36, 164, 133)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.22352767019573802
+ ],
+ "y": [
+ -0.03129631782304481
+ ],
+ "z": [
+ -0.10853013890568607
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCL4412140.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.19642124399985803
+ ],
+ "y": [
+ -0.18670402382519488
+ ],
+ "z": [
+ 0.07459843392697157
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasma acidophilum",
+ "Candidatus Thermoplasmatota",
+ "Thermoplasmatales",
+ "WP_010900487.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(119, 208, 82)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.17512694623999506
+ ],
+ "y": [
+ -0.15721774699227076
+ ],
+ "z": [
+ 0.0609763800021421
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanolinea sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MBP7119977.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(48, 107, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.19457074307841174
+ ],
+ "y": [
+ -0.03686962353900894
+ ],
+ "z": [
+ -0.08092345670117096
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCL4307262.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.2511828945611908
+ ],
+ "y": [
+ -0.18737691987552937
+ ],
+ "z": [
+ 0.0761508363972082
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanoregulaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "HIH26777.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(36, 136, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.21981754692654554
+ ],
+ "y": [
+ -0.0273208202768999
+ ],
+ "z": [
+ -0.0746476808786789
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthase",
+ "Methanoregula sp. PtaU1.Bin051",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "OPY37925.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(230, 228, 39)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthase",
+ "type": "scatter3d",
+ "x": [
+ -0.1971828159053864
+ ],
+ "y": [
+ -0.017583336619942578
+ ],
+ "z": [
+ -0.0916374962093725
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halorubrum sp. CSM-61",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_123620683.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(43, 118, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.026921113391955617
+ ],
+ "y": [
+ 0.1575564414291553
+ ],
+ "z": [
+ 0.011468410795795492
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoprotei archaeon",
+ "Thermoproteota",
+ null,
+ "RLE83126.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(183, 222, 43)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.2447010250540391
+ ],
+ "y": [
+ 0.11853798683937572
+ ],
+ "z": [
+ -0.01770448095919252
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanomicrobiales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "NYT05008.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(58, 83, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.18804006224412229
+ ],
+ "y": [
+ -0.012591215620160155
+ ],
+ "z": [
+ -0.09275825400013356
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Candidatus Proteinoplasmatales archaeon SG8-5",
+ "Euryarchaeota",
+ null,
+ "KYK27320.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(69, 12, 94)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.14635023317290818
+ ],
+ "y": [
+ -0.16902588825201703
+ ],
+ "z": [
+ 0.10074177834368857
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanomicrobiales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "NYT16651.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(58, 83, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.19458622895692024
+ ],
+ "y": [
+ -0.021397407363011052
+ ],
+ "z": [
+ -0.07232616565406294
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Pyrolobus fumarii",
+ "Thermoproteota",
+ "Desulfurococcales",
+ "WP_014025700.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(49, 178, 124)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.19504706201772198
+ ],
+ "y": [
+ 0.08936953424312488
+ ],
+ "z": [
+ 0.012244792357749461
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobacteriaceae archaeon",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "MBX7076341.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(150, 215, 63)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.06601236190873577
+ ],
+ "y": [
+ -0.002604193131185231
+ ],
+ "z": [
+ -0.1256202043569615
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCL5803311.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.22058599985660715
+ ],
+ "y": [
+ -0.17502386486014987
+ ],
+ "z": [
+ 0.0442190150871675
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "bacterium",
+ null,
+ null,
+ "MBC7329287.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(49, 104, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.7071385571692924
+ ],
+ "y": [
+ 0.2160521535260765
+ ],
+ "z": [
+ -0.663136253676513
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanolinea sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCA9702766.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(48, 107, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.18663491863137144
+ ],
+ "y": [
+ -0.027689214567445244
+ ],
+ "z": [
+ -0.08969036064012298
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobacterium lacus",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_013643758.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(33, 149, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.09277943659666349
+ ],
+ "y": [
+ -0.004339679141932813
+ ],
+ "z": [
+ -0.1412802538636221
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthase",
+ "uncultured archaeon",
+ "environmental samples",
+ null,
+ "VVB53498.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(35, 162, 134)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthase",
+ "type": "scatter3d",
+ "x": [
+ -0.08790712948375057
+ ],
+ "y": [
+ -0.08305000467061205
+ ],
+ "z": [
+ 0.2412675426309672
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanomicrobiaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MBN1193910.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(52, 182, 122)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1851147972864281
+ ],
+ "y": [
+ -0.025247267108734813
+ ],
+ "z": [
+ -0.10311961245228399
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "MBA3045157.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.17235797008712808
+ ],
+ "y": [
+ -0.1961594117046314
+ ],
+ "z": [
+ 0.12312006269547106
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCL4438150.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.23947836940322348
+ ],
+ "y": [
+ -0.21164923194665622
+ ],
+ "z": [
+ 0.07102073945425771
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobrevibacter sp. TMH8",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_224424997.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(78, 193, 106)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.0640797713679513
+ ],
+ "y": [
+ -0.011455869750117035
+ ],
+ "z": [
+ -0.10335933307002368
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "uncultured archaeon",
+ "environmental samples",
+ null,
+ "AKA48505.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(35, 162, 134)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.21264528675227992
+ ],
+ "y": [
+ -0.17227712186579547
+ ],
+ "z": [
+ 0.07187758927713898
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanoplanus limicola",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_004079284.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(243, 230, 38)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.17716667735009164
+ ],
+ "y": [
+ -0.003878058767072416
+ ],
+ "z": [
+ -0.08753514884775981
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanocalculus alkaliphilus",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_253487760.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(36, 140, 140)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1859951748964471
+ ],
+ "y": [
+ -0.03613506364866549
+ ],
+ "z": [
+ -0.09760111389304556
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Pyrodictium sp.",
+ "Thermoproteota",
+ "Desulfurococcales",
+ "HIQ11171.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(181, 222, 43)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.2246290743214313
+ ],
+ "y": [
+ 0.13021567197028439
+ ],
+ "z": [
+ 0.015710803356584153
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Ignisphaera sp.",
+ "Thermoproteota",
+ "Desulfurococcales",
+ "MCS7111770.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(55, 89, 140)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.25057545933579606
+ ],
+ "y": [
+ 0.12946207670159435
+ ],
+ "z": [
+ 0.03017599256708988
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "Methionine adenosyltransferase",
+ "Methanocalculus sp. 52_23",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "KUK69770.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(201, 225, 41)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "Methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.19302765587016743
+ ],
+ "y": [
+ -0.04162418291090389
+ ],
+ "z": [
+ -0.10501271717313246
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobrevibacter filiformis",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_066971865.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(42, 122, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.059050649855080205
+ ],
+ "y": [
+ -0.0009091745847492555
+ ],
+ "z": [
+ -0.14681257276024265
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Thermocladium sp. ECH_B",
+ "Thermoproteota",
+ "Thermoproteales",
+ "KUO92138.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(68, 52, 126)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.23597406649976144
+ ],
+ "y": [
+ 0.15009299529936543
+ ],
+ "z": [
+ 0.025572323765492858
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halorubrum salipaludis",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_095635812.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(57, 185, 119)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.0016153835248518878
+ ],
+ "y": [
+ 0.1374234214878863
+ ],
+ "z": [
+ -0.006589733002159062
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natronorubrum aibiense",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_152942600.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(60, 186, 117)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.04355971834325176
+ ],
+ "y": [
+ 0.12055887817437104
+ ],
+ "z": [
+ -0.014760113262669813
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCJ2532667.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.18404111393917288
+ ],
+ "y": [
+ -0.22791946990818981
+ ],
+ "z": [
+ 0.10931181255100704
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCI4337281.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.1433229216911012
+ ],
+ "y": [
+ -0.13581013410164763
+ ],
+ "z": [
+ 0.13331702809633095
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanocorpusculum sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MBR4987432.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(36, 164, 133)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.21505089348524645
+ ],
+ "y": [
+ -0.047234709126332826
+ ],
+ "z": [
+ -0.11587112345723136
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCI4323287.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.13702457462036952
+ ],
+ "y": [
+ -0.15294673412533458
+ ],
+ "z": [
+ 0.1550065918326405
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthase",
+ "Methanoregulaceae archaeon PtaU1.Bin222",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "OPY40252.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(40, 125, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthase",
+ "type": "scatter3d",
+ "x": [
+ -0.21051584941211368
+ ],
+ "y": [
+ -0.013044950737158063
+ ],
+ "z": [
+ -0.08799847522962784
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "candidate division MSBL1 archaeon SCGC-AAA382C18",
+ "Euryarchaeota",
+ null,
+ "KXB06412.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(101, 202, 93)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.2919208752613412
+ ],
+ "y": [
+ 0.34504097464085426
+ ],
+ "z": [
+ 0.572195785398516
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobacteriaceae archaeon",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "MCC7553004.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(150, 215, 63)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.09220562553694155
+ ],
+ "y": [
+ 0.006305984807289603
+ ],
+ "z": [
+ -0.14262052181460932
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanospirillum",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_214418350.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(35, 144, 140)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.2344012355205545
+ ],
+ "y": [
+ -0.04293660017513558
+ ],
+ "z": [
+ -0.09841370000032025
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobrevibacter boviskoreani",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_040682159.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(38, 132, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.07154828160527867
+ ],
+ "y": [
+ 0.012396338000659524
+ ],
+ "z": [
+ -0.16312199457423407
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanomicrobiaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCC7566513.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(52, 182, 122)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1445910706070935
+ ],
+ "y": [
+ 0.022000914041237832
+ ],
+ "z": [
+ -0.06463400053940001
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Altiarchaeales archaeon",
+ "Candidatus Altarchaeota",
+ null,
+ "HHQ45179.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(195, 224, 42)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.09250569504503349
+ ],
+ "y": [
+ -0.0789720828907959
+ ],
+ "z": [
+ 0.2774835053544436
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "TLZ82776.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.19311050620011394
+ ],
+ "y": [
+ -0.22619345502265562
+ ],
+ "z": [
+ 0.10021809820526452
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoproteota archaeon",
+ "Thermoproteota",
+ null,
+ "NOZ89357.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(179, 221, 45)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.23908570400937118
+ ],
+ "y": [
+ 0.13608207234366548
+ ],
+ "z": [
+ -0.0026412902424689105
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natrinema marinum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_254763865.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(37, 136, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.03671082882538628
+ ],
+ "y": [
+ 0.1256160349745486
+ ],
+ "z": [
+ 0.022334335330691388
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Burkholderiaceae bacterium",
+ "Pseudomonadota",
+ "Burkholderiales",
+ "MCC7467724.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(46, 112, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.21315259656429034
+ ],
+ "y": [
+ -0.019246059142890536
+ ],
+ "z": [
+ -0.07091249166384661
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Vulcanisaeta moutnovskia",
+ "Thermoproteota",
+ "Thermoproteales",
+ "WP_013604332.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(65, 62, 131)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.2471368672402526
+ ],
+ "y": [
+ 0.12772176096637783
+ ],
+ "z": [
+ 0.002421328954253542
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanoregula sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCJ7741397.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(41, 169, 130)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.20906346177500182
+ ],
+ "y": [
+ -0.025200443522557514
+ ],
+ "z": [
+ -0.07118891493707327
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanomassiliicoccales archaeon",
+ "Candidatus Thermoplasmatota",
+ "Methanomassiliicoccales",
+ "MCU0861666.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(33, 148, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.18433089106034548
+ ],
+ "y": [
+ -0.2399849776627994
+ ],
+ "z": [
+ 0.130546076463459
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCJ7464787.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.19415909085899535
+ ],
+ "y": [
+ -0.2100110467980553
+ ],
+ "z": [
+ 0.11452384117689518
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halocalculus aciditolerans",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_188976441.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(58, 82, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.0017822279646746955
+ ],
+ "y": [
+ 0.14158020244484235
+ ],
+ "z": [
+ 0.01261380003653953
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanocalculus sp. MSAO_Arc2",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "RQD81054.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(39, 167, 131)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1984431718856601
+ ],
+ "y": [
+ -0.02761559319374038
+ ],
+ "z": [
+ -0.11303025353427078
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "UCE91495.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.17192874184039386
+ ],
+ "y": [
+ -0.20491456396549587
+ ],
+ "z": [
+ 0.13597932167168977
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Methanomicrobiales archaeon HGW-Methanomicrobiales-4",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "PKL59643.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(37, 165, 133)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.2280750539172968
+ ],
+ "y": [
+ -0.02196920837921728
+ ],
+ "z": [
+ -0.10200912923937079
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanospirillaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MBN1167899.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(83, 195, 104)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.2323378863947649
+ ],
+ "y": [
+ -0.0513216311625746
+ ],
+ "z": [
+ -0.10166511459522713
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Actinobacteria bacterium QS_8_72_14",
+ "Actinomycetota",
+ null,
+ "PSO49145.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(57, 85, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.02509638879773659
+ ],
+ "y": [
+ 0.13082453833313357
+ ],
+ "z": [
+ 0.017548453959443343
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobrevibacter oralis",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_042693727.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(50, 180, 123)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.08949973924848917
+ ],
+ "y": [
+ 0.010542560318468461
+ ],
+ "z": [
+ -0.15730909395549592
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Acidiplasma",
+ "Candidatus Thermoplasmatota",
+ "Thermoplasmatales",
+ "WP_156150271.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(49, 103, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.22874281691166054
+ ],
+ "y": [
+ -0.19559242679618857
+ ],
+ "z": [
+ 0.06249821678967724
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosphaera",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_011407039.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(55, 90, 140)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.08442776192883028
+ ],
+ "y": [
+ 0.004023281036958951
+ ],
+ "z": [
+ -0.1682640481372782
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halobium salinum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_267619874.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(47, 108, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.04458268694011415
+ ],
+ "y": [
+ 0.11906386441107594
+ ],
+ "z": [
+ -0.00909411273605495
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanoculleus sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MBP7299847.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(148, 215, 64)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.19735764028550737
+ ],
+ "y": [
+ -0.05203755409517787
+ ],
+ "z": [
+ -0.07806082813864902
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halorubrum sp. JWXQ-INN 858",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_159485710.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(228, 228, 39)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.021335957689039054
+ ],
+ "y": [
+ 0.13863288338577262
+ ],
+ "z": [
+ -0.011621157651127843
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanoregula sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCK9631260.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(41, 169, 130)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.215584005407427
+ ],
+ "y": [
+ -0.043584336914292185
+ ],
+ "z": [
+ -0.1036394422916107
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosphaerula palustris",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_012618370.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(36, 139, 140)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.18969605376749507
+ ],
+ "y": [
+ -0.012751609283787303
+ ],
+ "z": [
+ -0.07439043138296278
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Verstraetearchaeota archaeon",
+ "Candidatus Verstraetearchaeota",
+ null,
+ "MCD6409343.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(49, 179, 124)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.2590497322624897
+ ],
+ "y": [
+ 0.10513342899698173
+ ],
+ "z": [
+ -0.008508098522573585
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natrinema altunense",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_007108352.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(98, 201, 95)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.010836514945927758
+ ],
+ "y": [
+ 0.12447956339824298
+ ],
+ "z": [
+ -0.00674727974853593
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanoregulaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCJ7794343.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(36, 136, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.20784251879205412
+ ],
+ "y": [
+ -0.02730052981915896
+ ],
+ "z": [
+ -0.08358644525051447
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Natrinema thermotolerans DSM 11552",
+ "Euryarchaeota",
+ "Halobacteria",
+ "ELZ15084.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(191, 223, 42)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.002920750611726575
+ ],
+ "y": [
+ 0.14912882287287846
+ ],
+ "z": [
+ -0.0019218342136527874
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Salinarchaeum sp. IM2453",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_221170772.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(47, 109, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.02698829389519927
+ ],
+ "y": [
+ 0.15537788974457864
+ ],
+ "z": [
+ 0.00031098363248356013
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCK4366801.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.20389579055048654
+ ],
+ "y": [
+ -0.21148691458240304
+ ],
+ "z": [
+ 0.10677375345657494
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Hyperthermus butylicus",
+ "Thermoproteota",
+ "Desulfurococcales",
+ "WP_011821276.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(93, 199, 98)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.24492937817577937
+ ],
+ "y": [
+ 0.14978247534747707
+ ],
+ "z": [
+ 0.009626303114696292
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanospirillum lacunae",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_109967398.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(32, 154, 138)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.23144605817351457
+ ],
+ "y": [
+ -0.029552861593877613
+ ],
+ "z": [
+ -0.10133854086294557
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Desulfurococcales archaeon",
+ "Thermoproteota",
+ "Desulfurococcales",
+ "NAZ14258.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(52, 97, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.2524281497908487
+ ],
+ "y": [
+ 0.11302835796617833
+ ],
+ "z": [
+ 0.015901355997173818
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Desulfurococcaceae archaeon",
+ "Thermoproteota",
+ "Desulfurococcales",
+ "MCC6041979.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(69, 50, 125)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.21855588509398766
+ ],
+ "y": [
+ 0.11840600715310148
+ ],
+ "z": [
+ 0.022778791098299108
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobrevibacter olleyae",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_067148153.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(103, 203, 92)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.08315634283130924
+ ],
+ "y": [
+ 0.020658539438183778
+ ],
+ "z": [
+ -0.15385014969077287
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halobaculum halophilum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_179168523.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(34, 161, 135)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.03131214559557772
+ ],
+ "y": [
+ 0.13557026316820478
+ ],
+ "z": [
+ 0.010209724095000344
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natrinema salaciae",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_090615699.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(51, 181, 122)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.0020871805264206004
+ ],
+ "y": [
+ 0.13649791129981356
+ ],
+ "z": [
+ 0.017237409460087012
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCK5292032.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.21029204495363646
+ ],
+ "y": [
+ -0.22471295236874342
+ ],
+ "z": [
+ 0.11029570238940942
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Methanosuratincola sp.",
+ "Candidatus Verstraetearchaeota",
+ "Candidatus Methanomethylicales",
+ "MCQ8891888.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(47, 110, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.2796506682851862
+ ],
+ "y": [
+ 0.11359583915430978
+ ],
+ "z": [
+ -0.002205251451799101
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halorubrum sp. LN27",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_200531784.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 17, 98)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.008192382002917477
+ ],
+ "y": [
+ 0.14194234001626435
+ ],
+ "z": [
+ -0.0013133438150029946
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthase",
+ "ANME-1 cluster archaeon GoMg2",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "NQE45598.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(64, 66, 133)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthase",
+ "type": "scatter3d",
+ "x": [
+ -0.27506119513589866
+ ],
+ "y": [
+ -0.12752629740045432
+ ],
+ "z": [
+ 0.08767981498177181
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halobacterium jilantaiense",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_089667219.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(214, 226, 40)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.011148782237263585
+ ],
+ "y": [
+ 0.1295199688767365
+ ],
+ "z": [
+ 0.027529431158220187
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Candidatus Altiarchaeales archaeon IMC4",
+ "Candidatus Altarchaeota",
+ null,
+ "ODS42513.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(41, 124, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.05751504491160505
+ ],
+ "y": [
+ -0.08208157580635494
+ ],
+ "z": [
+ 0.19113432605160366
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanofollis ethanolicus",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_067051365.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(40, 125, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1786920395930022
+ ],
+ "y": [
+ -0.03188944815172614
+ ],
+ "z": [
+ -0.07357608571357259
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "TMA01594.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.19829917266602254
+ ],
+ "y": [
+ -0.22156704864230176
+ ],
+ "z": [
+ 0.0931384133798453
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halodesulfurarchaeum formicicum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_071932752.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(185, 222, 43)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.03511085616204511
+ ],
+ "y": [
+ 0.1269179082198851
+ ],
+ "z": [
+ 0.006486421223250759
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Salinirubrum litoreum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_227227828.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(71, 44, 122)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.00158950047681884
+ ],
+ "y": [
+ 0.1402221439805097
+ ],
+ "z": [
+ 0.004981604669013064
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobrevibacter wolinii",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_042707184.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(42, 121, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.0883786705322645
+ ],
+ "y": [
+ -0.007518387328183022
+ ],
+ "z": [
+ -0.15200665083120282
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "unclassified Halorubrum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_121564496.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(61, 75, 137)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.004917103940044601
+ ],
+ "y": [
+ 0.14754571247924197
+ ],
+ "z": [
+ 0.016910412456192136
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Ignicoccus pacificus DSM 13166",
+ "Thermoproteota",
+ "Desulfurococcales",
+ "UXD21236.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(32, 152, 138)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.26389230831551336
+ ],
+ "y": [
+ 0.13734193775081374
+ ],
+ "z": [
+ 0.04211739061124446
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Ferroplasma",
+ "Candidatus Thermoplasmatota",
+ "Thermoplasmatales",
+ "WP_019841393.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(58, 185, 118)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.23266889410904595
+ ],
+ "y": [
+ -0.21692713642193306
+ ],
+ "z": [
+ 0.06762645642285159
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halostella salina",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_121821496.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(193, 223, 42)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.01688232665410156
+ ],
+ "y": [
+ 0.1249996185811868
+ ],
+ "z": [
+ -0.013252839825855563
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Pyrodictium delaneyi",
+ "Thermoproteota",
+ "Desulfurococcales",
+ "ALL00670.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(54, 91, 140)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.21039124634029727
+ ],
+ "y": [
+ 0.10771507113984585
+ ],
+ "z": [
+ 0.009109128376514121
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "TLZ91571.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.20111202091460995
+ ],
+ "y": [
+ -0.2194663456788976
+ ],
+ "z": [
+ 0.10329280890536963
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Nanohaloarchaeota archaeon QJJ-7",
+ "Candidatus Nanohaloarchaeota",
+ null,
+ "MCJ7479214.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(46, 175, 126)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.8354967420677185
+ ],
+ "y": [
+ -0.23233585922736574
+ ],
+ "z": [
+ -0.610105712206613
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCL4340689.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.2415134738964735
+ ],
+ "y": [
+ -0.21515539847996437
+ ],
+ "z": [
+ 0.05860370509594605
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halobaculum roseum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_222922726.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 38, 118)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.04089267317606598
+ ],
+ "y": [
+ 0.12232980668802072
+ ],
+ "z": [
+ 0.01397206308997429
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobrevibacter curvatus",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_067091875.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(108, 205, 89)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.0875419797512272
+ ],
+ "y": [
+ -0.001856846364493402
+ ],
+ "z": [
+ -0.16136945132143007
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natronorubrum bangense",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_006065566.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(125, 209, 78)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.025449767527523284
+ ],
+ "y": [
+ 0.1310905162388022
+ ],
+ "z": [
+ -0.004732643498580205
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MBK5191098.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 21, 103)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.24287436245254204
+ ],
+ "y": [
+ -0.10281284041853817
+ ],
+ "z": [
+ 0.03726184166139288
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Ignisphaera sp.",
+ "Thermoproteota",
+ "Desulfurococcales",
+ "MCC6045576.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(55, 89, 140)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.2661502213123969
+ ],
+ "y": [
+ 0.12811908620610749
+ ],
+ "z": [
+ 0.022011128087407586
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natrinema gelatinilyticum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_254529741.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(234, 229, 39)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.006476939032700374
+ ],
+ "y": [
+ 0.13104992572181345
+ ],
+ "z": [
+ 0.015149441240389968
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Bathyarchaeota archaeon",
+ "Candidatus Bathyarchaeota",
+ null,
+ "MBS7643067.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(55, 184, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.26222564142876986
+ ],
+ "y": [
+ 0.14429763562581538
+ ],
+ "z": [
+ -0.0130034227600226
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Theionarchaea archaeon",
+ "Euryarchaeota",
+ null,
+ "MBU7017391.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(37, 165, 132)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.8404903523840673
+ ],
+ "y": [
+ 0.44997456733673574
+ ],
+ "z": [
+ -0.13600728655825642
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCL4308458.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.1494616429850754
+ ],
+ "y": [
+ -0.14772033142681604
+ ],
+ "z": [
+ 0.11970038663666181
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanoculleus sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MBP7144579.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(148, 215, 64)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.2199469874045306
+ ],
+ "y": [
+ -0.024102640105134472
+ ],
+ "z": [
+ -0.09665980056938421
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Halobacteriales archaeon SW_8_68_21",
+ "Euryarchaeota",
+ "Halobacteria",
+ "PSQ57047.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(71, 29, 110)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.02595353271862438
+ ],
+ "y": [
+ 0.1419099760097893
+ ],
+ "z": [
+ -0.008331800789335249
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoproteota archaeon",
+ "Thermoproteota",
+ null,
+ "NPA04564.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(179, 221, 45)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.2151488334960307
+ ],
+ "y": [
+ 0.11731195568501332
+ ],
+ "z": [
+ 0.00666833870584466
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanocorpusculum sp. MG",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_268925586.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(45, 174, 127)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.2064894803269648
+ ],
+ "y": [
+ -0.036159214270721565
+ ],
+ "z": [
+ -0.11341622528106822
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halostella litorea",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_135822644.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(38, 166, 132)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.03109006926706555
+ ],
+ "y": [
+ 0.13341459176918186
+ ],
+ "z": [
+ 0.023260092820008033
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Thermoplasmata archaeon HGW-Thermoplasmata-2",
+ "Candidatus Thermoplasmatota",
+ null,
+ "PKK81476.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(44, 173, 127)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.8795465188598599
+ ],
+ "y": [
+ 0.9238025782779682
+ ],
+ "z": [
+ -0.07535948122689631
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natronorubrum sediminis",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_090503710.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(50, 101, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.010665251161221611
+ ],
+ "y": [
+ 0.14667240262212436
+ ],
+ "z": [
+ 0.004171025195262097
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanoregulaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "NTU99704.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(36, 136, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.18156424310278593
+ ],
+ "y": [
+ -0.029120067640530354
+ ],
+ "z": [
+ -0.08086607236793819
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Haloterrigena sp. H1",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_138779374.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(160, 217, 56)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.030376830398643362
+ ],
+ "y": [
+ 0.13499668893005948
+ ],
+ "z": [
+ -0.016858796459060747
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanomicrobia archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "HDN68217.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(44, 116, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.2863697627124746
+ ],
+ "y": [
+ -0.11185652207102174
+ ],
+ "z": [
+ 0.0794725617591561
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natronococcus sp. CG52",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_252489995.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(36, 138, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.03968246107713969
+ ],
+ "y": [
+ 0.12596750843644117
+ ],
+ "z": [
+ -0.014015519565156781
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natrinema amylolyticum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_226481852.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 25, 106)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.02293235497743287
+ ],
+ "y": [
+ 0.14870073220770827
+ ],
+ "z": [
+ -0.004092793572785439
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobacterium sp.",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "HHT18794.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(44, 115, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.09747526427077302
+ ],
+ "y": [
+ 0.016510291708940805
+ ],
+ "z": [
+ -0.1380603277617469
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Bathyarchaeota archaeon",
+ "Candidatus Bathyarchaeota",
+ null,
+ "MCK5403199.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(55, 184, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.3295818869717208
+ ],
+ "y": [
+ 0.19312286285449395
+ ],
+ "z": [
+ -0.05688325777018101
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanomassiliicoccales archaeon",
+ "Candidatus Thermoplasmatota",
+ "Methanomassiliicoccales",
+ "MBC7107492.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(33, 148, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.20882042368206385
+ ],
+ "y": [
+ -0.22864225105722283
+ ],
+ "z": [
+ 0.13098871055878997
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobrevibacter ruminantium",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_012954933.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(34, 144, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.06656301171987734
+ ],
+ "y": [
+ -0.00878008380349537
+ ],
+ "z": [
+ -0.13399792795818533
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanomassiliicoccales archaeon",
+ "Candidatus Thermoplasmatota",
+ "Methanomassiliicoccales",
+ "MCG7840871.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(33, 148, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.19955615508898453
+ ],
+ "y": [
+ -0.2702544657763882
+ ],
+ "z": [
+ 0.13168337982668657
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halobaculum sp. CBA1158",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_234297091.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(57, 84, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.009941732100075864
+ ],
+ "y": [
+ 0.11795811161818667
+ ],
+ "z": [
+ 0.008237943621135288
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halobaculum salinum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_179268991.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(51, 100, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.015181188989301203
+ ],
+ "y": [
+ 0.14817773574256124
+ ],
+ "z": [
+ 0.023982886428069197
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Thermogymnomonas acidicola",
+ "Candidatus Thermoplasmatota",
+ "Thermoplasmatales",
+ "GGM66958.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(170, 220, 50)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.2093000742800714
+ ],
+ "y": [
+ -0.1994160606193212
+ ],
+ "z": [
+ 0.07312136530714594
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Haladaptatus pallidirubidus",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_227776945.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(99, 202, 94)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.043133337545818315
+ ],
+ "y": [
+ 0.10756729379250873
+ ],
+ "z": [
+ -0.004541205644506598
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "archaeon",
+ null,
+ null,
+ "MCQ2976762.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(34, 147, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.07634672920652916
+ ],
+ "y": [
+ -0.011651468343820633
+ ],
+ "z": [
+ -0.13558456842992989
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natronorubrum thiooxidans",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_076608624.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(46, 175, 126)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.008721838616144036
+ ],
+ "y": [
+ 0.13561238680082324
+ ],
+ "z": [
+ 0.024785723540626213
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halobacterium litoreum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_232572234.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(40, 126, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.007522374027153546
+ ],
+ "y": [
+ 0.13714484838427177
+ ],
+ "z": [
+ 0.02355434044758499
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanofollis liminatans",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_004038703.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(54, 93, 140)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.19011193566605877
+ ],
+ "y": [
+ -0.01524068131252966
+ ],
+ "z": [
+ -0.08454738589269788
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "candidate division MSBL1 archaeon SCGC-AAA259E19",
+ "Euryarchaeota",
+ null,
+ "KXA95705.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(203, 225, 41)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.2527399999462861
+ ],
+ "y": [
+ 0.2666482752686523
+ ],
+ "z": [
+ 0.49454203283883424
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanoculleus taiwanensis",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_128693716.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(33, 150, 138)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.20875411424283474
+ ],
+ "y": [
+ -0.039867662421471314
+ ],
+ "z": [
+ -0.08207407539373947
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "unclassified Methanocalculus",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_253460769.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(42, 119, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1996848881628408
+ ],
+ "y": [
+ -0.014980795930751906
+ ],
+ "z": [
+ -0.10515360726640922
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halovivax gelatinilyticus",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_254862883.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(132, 211, 74)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.00423655530356418
+ ],
+ "y": [
+ 0.15266076651784743
+ ],
+ "z": [
+ 0.005153213291293703
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Haloterrigena alkaliphila",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_207288301.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(138, 212, 70)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.0022785617921897254
+ ],
+ "y": [
+ 0.1348567231118803
+ ],
+ "z": [
+ 0.009800145087666755
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natrinema sp. SYSU A 869",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_222919302.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(140, 213, 69)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.00952329387735438
+ ],
+ "y": [
+ 0.12429763185232484
+ ],
+ "z": [
+ -0.010064906435748047
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCL5783052.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.2478646772128745
+ ],
+ "y": [
+ -0.206319541034505
+ ],
+ "z": [
+ 0.06741118974934109
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natronorubrum texcoconense",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_090306871.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(67, 56, 128)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.013225491450482896
+ ],
+ "y": [
+ 0.12076368235041952
+ ],
+ "z": [
+ 0.008439902584578983
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanophagales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCK4475473.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(63, 70, 135)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.22222588885319575
+ ],
+ "y": [
+ -0.10166874324526044
+ ],
+ "z": [
+ 0.06858416961538932
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halorubrum sodomense",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_092922917.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(40, 168, 131)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.036955927341223785
+ ],
+ "y": [
+ 0.12575030081826316
+ ],
+ "z": [
+ -0.007449651493581068
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Altiarchaeota archaeon",
+ "Candidatus Altarchaeota",
+ null,
+ "MBU4201840.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(80, 194, 106)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.08684873753905041
+ ],
+ "y": [
+ -0.06398223460358134
+ ],
+ "z": [
+ 0.23851138014043397
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobrevibacter",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_004032572.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(48, 105, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.06736343693664831
+ ],
+ "y": [
+ -0.006390182651174576
+ ],
+ "z": [
+ -0.1440849403226333
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halorubrum aethiopicum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_066415702.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(51, 99, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.010868232776175702
+ ],
+ "y": [
+ 0.14822403228579023
+ ],
+ "z": [
+ -0.00975633967308866
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanoregulaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "NTW92131.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(36, 136, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.19447167243119215
+ ],
+ "y": [
+ -0.028013211665926963
+ ],
+ "z": [
+ -0.06889291267558442
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Methanophagales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "RCV65299.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(63, 70, 135)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.21265423392533045
+ ],
+ "y": [
+ -0.06625988648036359
+ ],
+ "z": [
+ 0.029530136374160056
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "hypothetical protein",
+ "Thermoplasmatales archaeon E-plasma",
+ "Candidatus Thermoplasmatota",
+ "Thermoplasmatales",
+ "EQB66510.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(71, 34, 114)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "hypothetical protein",
+ "type": "scatter3d",
+ "x": [
+ 0.2404055237692557
+ ],
+ "y": [
+ -0.19987417828162463
+ ],
+ "z": [
+ 0.0484520083683924
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoproteales archaeon",
+ "Thermoproteota",
+ "Thermoproteales",
+ "MCD6562447.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(60, 78, 138)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.311806725993685
+ ],
+ "y": [
+ 0.19820194918361164
+ ],
+ "z": [
+ -0.00017965555269211232
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthase",
+ "Methanomassiliicoccales archaeon PtaB.Bin134",
+ "Candidatus Thermoplasmatota",
+ "Methanomassiliicoccales",
+ "OPX62442.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(48, 177, 125)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthase",
+ "type": "scatter3d",
+ "x": [
+ 0.19319411984940854
+ ],
+ "y": [
+ -0.2601557190865877
+ ],
+ "z": [
+ 0.14539179041938982
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoprotei archaeon",
+ "Thermoproteota",
+ null,
+ "RLF06785.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(183, 222, 43)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.26364601616351696
+ ],
+ "y": [
+ 0.12564103334895216
+ ],
+ "z": [
+ -0.00029621067098682604
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "candidate division MSBL1 archaeon SCGC-AAA261D19",
+ "Euryarchaeota",
+ null,
+ "KXB02156.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(62, 72, 136)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.22809726588321114
+ ],
+ "y": [
+ 0.21710808915820884
+ ],
+ "z": [
+ 0.45517685241097045
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halorubrum sp. BV1",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_049982863.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(146, 214, 65)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.02198074956359971
+ ],
+ "y": [
+ 0.11377962118869349
+ ],
+ "z": [
+ -0.004508705365583252
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Hyperthermus sp.",
+ "Thermoproteota",
+ "Desulfurococcales",
+ "RUM46922.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(35, 140, 140)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.24551842840937457
+ ],
+ "y": [
+ 0.11922613107917529
+ ],
+ "z": [
+ 0.021020405734407475
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Altiarchaeales archaeon",
+ "Candidatus Altarchaeota",
+ null,
+ "MBD3262709.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(195, 224, 42)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.10722228132782374
+ ],
+ "y": [
+ -0.07136980773372971
+ ],
+ "z": [
+ 0.2758519659400672
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Vulcanisaeta sp. SCGC AB-777_J10",
+ "Thermoproteota",
+ "Thermoproteales",
+ "PVU71895.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(53, 183, 121)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.24108502502916188
+ ],
+ "y": [
+ 0.14397572358340355
+ ],
+ "z": [
+ 0.01430923810823657
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Bathyarchaeota archaeon",
+ "Candidatus Bathyarchaeota",
+ null,
+ "RLI05182.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(55, 184, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.2810241886318335
+ ],
+ "y": [
+ 0.15898962897551963
+ ],
+ "z": [
+ -0.0179091711541553
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanocorpusculum sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCK9313491.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(36, 164, 133)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.21121721129990018
+ ],
+ "y": [
+ -0.024903647098589984
+ ],
+ "z": [
+ -0.11190143871834157
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanoculleus",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_066955078.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(38, 129, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.19933086811770545
+ ],
+ "y": [
+ -0.03947614051460931
+ ],
+ "z": [
+ -0.10287964286092799
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halobacterium",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_010902940.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(216, 226, 40)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.024785334811464808
+ ],
+ "y": [
+ 0.1505756297446573
+ ],
+ "z": [
+ 0.020659165036436552
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCL4451275.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.2553390539728161
+ ],
+ "y": [
+ -0.19173921194273313
+ ],
+ "z": [
+ 0.04889201900617062
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halorubrum sp. CBA1125",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_156588411.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(62, 187, 116)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.021471694186241792
+ ],
+ "y": [
+ 0.11558699248732365
+ ],
+ "z": [
+ -0.013110620577937474
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halorubrum alkaliphilum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_209482594.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(32, 153, 138)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.022575736486019536
+ ],
+ "y": [
+ 0.11010317340123665
+ ],
+ "z": [
+ 0.0025149095415081626
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halopenitus persicus",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_021073705.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(212, 226, 40)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.0023566464068876334
+ ],
+ "y": [
+ 0.1298729745584225
+ ],
+ "z": [
+ 0.0019052078198111284
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "candidate division MSBL1 archaeon SCGC-AAA259A05",
+ "Euryarchaeota",
+ null,
+ "KXA90742.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(57, 86, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.28015729342277385
+ ],
+ "y": [
+ 0.3020531522983963
+ ],
+ "z": [
+ 0.5519371660181488
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCL6003386.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.23312447648239867
+ ],
+ "y": [
+ -0.21627015029971608
+ ],
+ "z": [
+ 0.04497509215680752
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanomicrobiaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MBN1431402.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(52, 182, 122)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.20098535326452174
+ ],
+ "y": [
+ -0.027375474087732873
+ ],
+ "z": [
+ -0.09767671403629512
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Vulcanisaeta sp. JCM 14467",
+ "Thermoproteota",
+ "Thermoproteales",
+ "WP_054849467.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(31, 158, 137)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.24007601049971558
+ ],
+ "y": [
+ 0.1424003214446442
+ ],
+ "z": [
+ 0.005590189916030738
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Euryarchaeota archaeon RBG_16_62_10",
+ "Euryarchaeota",
+ null,
+ "OGS42269.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(43, 117, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.18759346136280008
+ ],
+ "y": [
+ -0.23536536674527728
+ ],
+ "z": [
+ 0.1402880468545622
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Candidatus Terraquivivens tikiterensis",
+ "Nitrososphaerota",
+ "Candidatus Terraquivivens",
+ "PUA32000.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(197, 224, 42)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.32724431488178496
+ ],
+ "y": [
+ 0.24846170006292032
+ ],
+ "z": [
+ 0.0226103152335068
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanomassiliicoccales archaeon",
+ "Candidatus Thermoplasmatota",
+ "Methanomassiliicoccales",
+ "MBN1110266.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(33, 148, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.1965882734997979
+ ],
+ "y": [
+ -0.27850202367865434
+ ],
+ "z": [
+ 0.15402414826776312
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Methanomicrobiales archaeon HGW-Methanomicrobiales-1",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "PKL68256.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(59, 80, 138)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.1982743153701908
+ ],
+ "y": [
+ -0.01957787976886865
+ ],
+ "z": [
+ -0.08362219882671493
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Vulcanisaeta sp.",
+ "Thermoproteota",
+ "Thermoproteales",
+ "MCG2863631.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(69, 49, 125)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.24068523947082546
+ ],
+ "y": [
+ 0.14237723652596113
+ ],
+ "z": [
+ -0.009562763631460436
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Verstraetearchaeota archaeon",
+ "Candidatus Verstraetearchaeota",
+ null,
+ "RLE49468.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(49, 179, 124)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.24457186151840685
+ ],
+ "y": [
+ 0.13133670255587257
+ ],
+ "z": [
+ -0.01590979135721608
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natronococcus pandeyae",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_148860060.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(45, 113, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.029938932967846915
+ ],
+ "y": [
+ 0.1128135905882924
+ ],
+ "z": [
+ -0.0037686656787571772
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoprotei archaeon",
+ "Thermoproteota",
+ null,
+ "RLF12032.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(183, 222, 43)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.33082241924534284
+ ],
+ "y": [
+ 0.19234679479327335
+ ],
+ "z": [
+ 0.0025797170379804417
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natronocalculus amylovorans",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_174653571.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(111, 206, 87)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.036493640219321555
+ ],
+ "y": [
+ 0.14804212060498192
+ ],
+ "z": [
+ -0.0008744524388105921
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Haloglomus salinum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_254831124.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(34, 146, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.030081263627016866
+ ],
+ "y": [
+ 0.1549391041502578
+ ],
+ "z": [
+ 0.011575937411518885
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCL5804246.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.25955141907326695
+ ],
+ "y": [
+ -0.18790291331197626
+ ],
+ "z": [
+ 0.0618793081715557
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanophagales archaeon ANME-1-THS",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "RZN38061.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(69, 14, 96)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.2790491540059707
+ ],
+ "y": [
+ -0.1126509148863387
+ ],
+ "z": [
+ 0.0914230945650647
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "MCL2460374.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.23166887131176214
+ ],
+ "y": [
+ -0.04180139447764477
+ ],
+ "z": [
+ -0.08713874860771266
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Vulcanisaeta souniana",
+ "Thermoproteota",
+ "Thermoproteales",
+ "WP_188602731.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(96, 200, 96)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.24114614536233883
+ ],
+ "y": [
+ 0.13785024282891178
+ ],
+ "z": [
+ 0.010275809138646968
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Sulfolobales archaeon HS-7",
+ "Thermoproteota",
+ "Sulfolobales",
+ "BCU68573.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(67, 55, 128)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.23747709593925317
+ ],
+ "y": [
+ 0.13281896109465288
+ ],
+ "z": [
+ 0.03504359852438719
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanomassiliicoccales archaeon",
+ "Candidatus Thermoplasmatota",
+ "Methanomassiliicoccales",
+ "TET91527.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(33, 148, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.20724236609512603
+ ],
+ "y": [
+ -0.21045026050588767
+ ],
+ "z": [
+ 0.09897658705733509
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Desulfurococcales archaeon",
+ "Thermoproteota",
+ "Desulfurococcales",
+ "MCE4612379.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(52, 97, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.2615094373054151
+ ],
+ "y": [
+ 0.14346604050266842
+ ],
+ "z": [
+ 0.02082913978980306
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Vulcanisaeta distributa",
+ "Thermoproteota",
+ "Thermoproteales",
+ "WP_054841976.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(134, 211, 73)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.25683161632973117
+ ],
+ "y": [
+ 0.13426146455874327
+ ],
+ "z": [
+ 0.008385510763646844
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "Methionine adenosyltransferase",
+ "Methanoculleus marisnigri",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "KUK61883.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(66, 59, 130)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "Methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.20099152747059593
+ ],
+ "y": [
+ -0.05095694637061202
+ ],
+ "z": [
+ -0.10177575897551469
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Halobacteriales archaeon QS_3_64_16",
+ "Euryarchaeota",
+ "Halobacteria",
+ "PSP72731.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 22, 104)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.013846346089186367
+ ],
+ "y": [
+ 0.1523178627564625
+ ],
+ "z": [
+ 0.016274528393487673
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halorubrum vacuolatum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_089384817.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(39, 128, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.026955137588239815
+ ],
+ "y": [
+ 0.11339199904347713
+ ],
+ "z": [
+ 0.015922485558131513
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanolinea sp.",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "HII75663.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(48, 107, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.17936430356221894
+ ],
+ "y": [
+ -0.018612810182866753
+ ],
+ "z": [
+ -0.06663600166605288
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "UCD92258.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.21077686914282975
+ ],
+ "y": [
+ -0.21410149177609444
+ ],
+ "z": [
+ 0.12491811965675109
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natronobeatus ordinarius",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_255194224.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(41, 170, 130)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.047539979589132315
+ ],
+ "y": [
+ 0.11672554319201688
+ ],
+ "z": [
+ 0.006684380924040092
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natronococcus amylolyticus",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_005555509.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(44, 116, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.0221948388024104
+ ],
+ "y": [
+ 0.1323391475778323
+ ],
+ "z": [
+ -0.009944165058204606
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "archaeal S-adenosylmethionine synthetase",
+ "halophilic archaeon J07HX5",
+ "Euryarchaeota",
+ "Halobacteria",
+ "ERG88479.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(172, 220, 48)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "archaeal S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.0006660802050822259
+ ],
+ "y": [
+ 0.14865499347304778
+ ],
+ "z": [
+ 0.01052353272792443
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanobrevibacter sp.",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "MCF0226734.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(35, 142, 140)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.06939774138206524
+ ],
+ "y": [
+ 0.01669805634842956
+ ],
+ "z": [
+ -0.14816570565004086
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanomicrobiales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "NMC89124.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(58, 83, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.20106776220398567
+ ],
+ "y": [
+ -0.054157230281760255
+ ],
+ "z": [
+ -0.08997349725398182
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halopiger goleimassiliensis",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_049928531.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(46, 110, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.016130110913211825
+ ],
+ "y": [
+ 0.13096867760161046
+ ],
+ "z": [
+ -0.018125779332681058
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natrononativus amylolyticus",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_255167024.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(60, 79, 138)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.0022170771107512576
+ ],
+ "y": [
+ 0.131170015233419
+ ],
+ "z": [
+ 0.005009566635108049
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halopelagius inordinatus",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_092893338.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(64, 67, 134)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.04795601685594687
+ ],
+ "y": [
+ 0.11036412300076522
+ ],
+ "z": [
+ -0.0020000547616237027
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natronoarchaeum rubrum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_256392138.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(60, 77, 138)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.030940971610893764
+ ],
+ "y": [
+ 0.11296924483450725
+ ],
+ "z": [
+ 0.008297744036620975
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halomarina rubra",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_250875294.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(81, 194, 105)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.04187942647447064
+ ],
+ "y": [
+ 0.12265279877391165
+ ],
+ "z": [
+ 0.002171612146383973
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanoregulaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "RPI39353.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(36, 136, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.2077776195099853
+ ],
+ "y": [
+ -0.05578354671180043
+ ],
+ "z": [
+ -0.09648376075666949
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Pyrodictium occultum",
+ "Thermoproteota",
+ "Desulfurococcales",
+ "WP_058370489.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(32, 160, 136)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.22387730828962962
+ ],
+ "y": [
+ 0.11326633556740157
+ ],
+ "z": [
+ 0.019050339548874338
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MBS3782639.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.222732215454674
+ ],
+ "y": [
+ -0.23072656727618934
+ ],
+ "z": [
+ 0.1382408654198321
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Verstraetearchaeota archaeon",
+ "Candidatus Verstraetearchaeota",
+ null,
+ "NHW44568.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(49, 179, 124)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.42834882177713723
+ ],
+ "y": [
+ 0.2543724776887983
+ ],
+ "z": [
+ 0.007975996506161896
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Thermoplasmatales archaeon ex4484_30",
+ "Candidatus Thermoplasmatota",
+ "Thermoplasmatales",
+ "OYT60719.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(220, 227, 40)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.29563786017361715
+ ],
+ "y": [
+ -0.3283790371944876
+ ],
+ "z": [
+ 0.24513708796251107
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Salinadaptatus halalkaliphilus",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_141464562.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(249, 230, 37)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.005211299154455561
+ ],
+ "y": [
+ 0.13706408166449155
+ ],
+ "z": [
+ -0.009811114867519587
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halolamina salifodinae",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_209490980.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(71, 43, 122)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.032460147525716035
+ ],
+ "y": [
+ 0.14803340563554662
+ ],
+ "z": [
+ -0.0008625486716904369
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "HID73726.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.23077294214220972
+ ],
+ "y": [
+ -0.28440966665496376
+ ],
+ "z": [
+ 0.11096429369427224
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Halobacteriales archaeon SW_6_65_15",
+ "Euryarchaeota",
+ "Halobacteria",
+ "PSQ49033.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(236, 229, 38)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.034934247386590074
+ ],
+ "y": [
+ 0.113419241601778
+ ],
+ "z": [
+ -0.01222066469781257
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Bathyarchaeota archaeon",
+ "Candidatus Bathyarchaeota",
+ null,
+ "MCJ7609030.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(55, 184, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.4124345684970245
+ ],
+ "y": [
+ -0.7874742367233859
+ ],
+ "z": [
+ -0.8902188644525144
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Candidatus Altiarchaeales archaeon WOR_SM1_79",
+ "Candidatus Altarchaeota",
+ null,
+ "ODS37233.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(53, 94, 140)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.049775320547777877
+ ],
+ "y": [
+ -0.07474977640055631
+ ],
+ "z": [
+ 0.21547665709222102
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Bathyarchaeota archaeon",
+ "Candidatus Bathyarchaeota",
+ null,
+ "MCK4243364.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(55, 184, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.32306262978665345
+ ],
+ "y": [
+ 0.1547691456629923
+ ],
+ "z": [
+ -0.0737427926780059
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanomicrobiales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "NLA30213.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(58, 83, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.21742973017498787
+ ],
+ "y": [
+ -0.04862078370224918
+ ],
+ "z": [
+ -0.09596896861271657
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Euryarchaeota archaeon RBG_13_57_23",
+ "Euryarchaeota",
+ null,
+ "OGS43622.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(34, 148, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.16760334124749243
+ ],
+ "y": [
+ -0.20090046088971775
+ ],
+ "z": [
+ 0.10783094382308064
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halobaculum rubrum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_222914261.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 47, 124)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.01792331357883712
+ ],
+ "y": [
+ 0.14122696485090833
+ ],
+ "z": [
+ -0.017460809022098626
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Bathyarchaeota archaeon",
+ "Candidatus Bathyarchaeota",
+ null,
+ "UCH01986.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(55, 184, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.30802606698031354
+ ],
+ "y": [
+ 0.19778908155381536
+ ],
+ "z": [
+ -0.053681498464740234
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanophagales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MBE0517364.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(63, 70, 135)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.2049231101470829
+ ],
+ "y": [
+ -0.07323061023271853
+ ],
+ "z": [
+ 0.03716441991705909
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natronomonas marina",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_254841269.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(52, 97, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.0036201228901662093
+ ],
+ "y": [
+ 0.1469862696965148
+ ],
+ "z": [
+ -0.009802396275584496
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "MBM4237193.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.19336432605076165
+ ],
+ "y": [
+ -0.23606177325494052
+ ],
+ "z": [
+ 0.12628677961535928
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halosolutus amylolyticus",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_250142161.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(106, 204, 90)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.027590738286474358
+ ],
+ "y": [
+ 0.13243506387013326
+ ],
+ "z": [
+ 0.02650745400768922
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halogranum gelatinilyticum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_089698184.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(88, 197, 101)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.01939233426087702
+ ],
+ "y": [
+ 0.15533398819439387
+ ],
+ "z": [
+ 0.007966354980102463
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "MCE5296380.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.2066504956574826
+ ],
+ "y": [
+ -0.24582515491949808
+ ],
+ "z": [
+ 0.1264407559386889
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halapricum desulfuricans",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_229110273.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(210, 226, 41)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.03418985748130383
+ ],
+ "y": [
+ 0.13699307951988277
+ ],
+ "z": [
+ -0.006674025299040467
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosphaera sp. Vir-13MRS",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_274870358.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 41, 121)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.07631711870190798
+ ],
+ "y": [
+ -0.0011682815883943534
+ ],
+ "z": [
+ -0.16135285182309628
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halostella pelagica",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_135534433.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(48, 177, 125)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.030683985996229245
+ ],
+ "y": [
+ 0.1251237614902678
+ ],
+ "z": [
+ -0.01902825159975578
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Altiarchaeota archaeon",
+ "Candidatus Altarchaeota",
+ null,
+ "MBN2518333.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(80, 194, 106)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.8128475356863178
+ ],
+ "y": [
+ 0.4695984617702563
+ ],
+ "z": [
+ 0.8362077023569224
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "MBM4240268.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.11356522621220301
+ ],
+ "y": [
+ 0.0028100615712115568
+ ],
+ "z": [
+ -0.1323689928707888
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natronosalvus amylolyticus",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_254809959.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(39, 128, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.0380750441941392
+ ],
+ "y": [
+ 0.1133797451146904
+ ],
+ "z": [
+ 0.005571837854429271
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Desulfurococcaceae archaeon",
+ "Thermoproteota",
+ "Desulfurococcales",
+ "MCC6022082.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(69, 50, 125)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.22953833262401804
+ ],
+ "y": [
+ 0.10945269094588773
+ ],
+ "z": [
+ 0.009499220493039771
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanoculleus horonobensis",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_067075402.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 39, 119)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.22612383580280218
+ ],
+ "y": [
+ -0.04021697754627432
+ ],
+ "z": [
+ -0.09076542037598563
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halogeometricum pallidum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_008383527.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(241, 229, 38)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.011372426184766828
+ ],
+ "y": [
+ 0.15307798099362313
+ ],
+ "z": [
+ -0.0013433591489672224
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoplasmata archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "HIH01356.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(176, 221, 46)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.20609604583786859
+ ],
+ "y": [
+ -0.23663445902931035
+ ],
+ "z": [
+ 0.142067299373228
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "candidate division MSBL1 archaeon SCGC-AAA259J03",
+ "Euryarchaeota",
+ null,
+ "KXA98460.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(73, 191, 109)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ 0.31201788077651876
+ ],
+ "y": [
+ 0.33102750320824537
+ ],
+ "z": [
+ 0.5791711663874501
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanomicrobiaceae archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "MCC7566529.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(52, 182, 122)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.19678577088406451
+ ],
+ "y": [
+ -0.0448296414623408
+ ],
+ "z": [
+ -0.07095414300343318
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natronobiforma cellulositropha",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_263020555.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(154, 216, 60)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.037193849388562246
+ ],
+ "y": [
+ 0.13726424413238983
+ ],
+ "z": [
+ 0.015455508860767976
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermosphaera sp.",
+ "Thermoproteota",
+ "Desulfurococcales",
+ "MCC6054709.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(222, 227, 40)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.2050964269245425
+ ],
+ "y": [
+ 0.10013884191429695
+ ],
+ "z": [
+ 0.009836252978547334
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanofollis sp. W23",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_209628966.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(69, 51, 125)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1965339399696559
+ ],
+ "y": [
+ -0.03290184433292095
+ ],
+ "z": [
+ -0.06369669058784387
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Haladaptatus salinisoli",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_227354255.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(58, 81, 138)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.04802285842832433
+ ],
+ "y": [
+ 0.12365852898430832
+ ],
+ "z": [
+ 0.00848943137713002
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoprotei archaeon",
+ "Thermoproteota",
+ null,
+ "RLG86825.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(183, 222, 43)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.25490647979098263
+ ],
+ "y": [
+ 0.12746312902850804
+ ],
+ "z": [
+ 0.002250961065709231
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Desulfurococcaceae archaeon",
+ "Thermoproteota",
+ "Desulfurococcales",
+ "PWV37647.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(69, 50, 125)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.22812517987034497
+ ],
+ "y": [
+ 0.1460115681286942
+ ],
+ "z": [
+ 0.013267020551854481
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Salinilacihabitans rarus",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_254768129.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(43, 172, 128)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.000565747779672603
+ ],
+ "y": [
+ 0.13910412755816623
+ ],
+ "z": [
+ -0.004821599059519937
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halohasta litchfieldiae",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_089670865.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(49, 104, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.03452960571301807
+ ],
+ "y": [
+ 0.1431426844338317
+ ],
+ "z": [
+ 0.011473610276587288
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Nanohaloarchaeota archaeon QJJ-5",
+ "Candidatus Nanohaloarchaeota",
+ null,
+ "MCJ7428959.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(35, 143, 140)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.8585169810732752
+ ],
+ "y": [
+ -0.2586737101856149
+ ],
+ "z": [
+ -0.5963398335589324
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natribaculum luteum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_246968680.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(144, 214, 67)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.04190379516872054
+ ],
+ "y": [
+ 0.13121602947670002
+ ],
+ "z": [
+ 0.0003873855573717473
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosarcinales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "RLG37179.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(70, 21, 103)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.2887985734609542
+ ],
+ "y": [
+ -0.1262065567184775
+ ],
+ "z": [
+ 0.08188492193816922
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanosphaera cuniculi",
+ "Euryarchaeota",
+ "Methanobacteria",
+ "WP_095607844.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(35, 163, 134)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.07456470281088737
+ ],
+ "y": [
+ 0.0031703047570862983
+ ],
+ "z": [
+ -0.158874913632797
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halegenticoccus soli",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_101297280.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(48, 107, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.011644923308157848
+ ],
+ "y": [
+ 0.11870722025145078
+ ],
+ "z": [
+ 0.02014292574441181
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "unclassified Methanocalculus",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_253458115.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(42, 119, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.21175431531178912
+ ],
+ "y": [
+ -0.01794025021647753
+ ],
+ "z": [
+ -0.0974757371949339
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Euryarchaeota archaeon",
+ "Euryarchaeota",
+ null,
+ "UCE80363.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(115, 207, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.19310353804445213
+ ],
+ "y": [
+ -0.22297105615190077
+ ],
+ "z": [
+ 0.13941655222181432
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Thermoprotei archaeon",
+ "Thermoproteota",
+ null,
+ "MCD6114320.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(183, 222, 43)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.24619445849396915
+ ],
+ "y": [
+ 0.12748405958118256
+ ],
+ "z": [
+ 0.012885437314622267
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natronobacterium texcoconense",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_090386117.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(52, 96, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.034798307708589375
+ ],
+ "y": [
+ 0.13785304173593058
+ ],
+ "z": [
+ 0.00022348330842303176
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Halobacteriales archaeon QS_8_69_26",
+ "Euryarchaeota",
+ "Halobacteria",
+ "PSQ15689.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(104, 204, 91)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.03752711220679854
+ ],
+ "y": [
+ 0.1142740081757647
+ ],
+ "z": [
+ 0.01565167083784945
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natrarchaeobius chitinivorans",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_124197364.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(63, 69, 135)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.03123006234004002
+ ],
+ "y": [
+ 0.1292141492620188
+ ],
+ "z": [
+ -0.016869428556231993
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Haloprofundus halophilus",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_117591019.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(48, 106, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.03591367611208579
+ ],
+ "y": [
+ 0.10902120875968137
+ ],
+ "z": [
+ -0.00402772070247011
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Theionarchaea archaeon",
+ "Euryarchaeota",
+ null,
+ "MBU7025755.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(37, 165, 132)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.8089501131655384
+ ],
+ "y": [
+ 0.4442553501965237
+ ],
+ "z": [
+ -0.14907612637604095
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halogranum rubrum",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_089871735.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(76, 192, 107)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.010562872403394484
+ ],
+ "y": [
+ 0.14316616931015308
+ ],
+ "z": [
+ 0.015412377694884344
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natronococcus jeotgali",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_008425871.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(71, 26, 107)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.017788625748620297
+ ],
+ "y": [
+ 0.13942854457113849
+ ],
+ "z": [
+ 0.019360542453714623
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Thermoplasmatota archaeon",
+ "Candidatus Thermoplasmatota",
+ null,
+ "MCL5666017.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(72, 40, 120)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.26541163179454674
+ ],
+ "y": [
+ -0.2037424810361282
+ ],
+ "z": [
+ 0.062132556951226194
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Candidatus Micrarchaeota archaeon",
+ "Candidatus Micrarchaeota",
+ null,
+ "MBI5159355.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(41, 123, 142)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.8124600829018415
+ ],
+ "y": [
+ -0.7230339476950353
+ ],
+ "z": [
+ 0.8023177843540765
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "S-adenosylmethionine synthetase",
+ "Halobacteriales archaeon QS_4_62_28",
+ "Euryarchaeota",
+ "Halobacteria",
+ "PSP93059.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(42, 171, 129)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "S-adenosylmethionine synthetase",
+ "type": "scatter3d",
+ "x": [
+ -0.005413606596445798
+ ],
+ "y": [
+ 0.14349888560275992
+ ],
+ "z": [
+ 0.023984979528447303
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halorussus vallis",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_253516867.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(90, 198, 100)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.01919106540005617
+ ],
+ "y": [
+ 0.12017847424192976
+ ],
+ "z": [
+ 0.024604961307963143
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halorubrum sp. 48-1-W",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_112079538.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(245, 230, 38)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.02092300705155082
+ ],
+ "y": [
+ 0.14949497515096472
+ ],
+ "z": [
+ 0.0023212230792628787
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Theionarchaea archaeon",
+ "Euryarchaeota",
+ null,
+ "MBU7031515.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(37, 165, 132)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ 0.816749206361719
+ ],
+ "y": [
+ 0.4705776489265028
+ ],
+ "z": [
+ -0.1291596429815075
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natrialba asiatica",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_006109281.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(51, 98, 141)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.025066997213201617
+ ],
+ "y": [
+ 0.1482422443944375
+ ],
+ "z": [
+ 0.011697557838537848
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanomicrobiales archaeon",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "NLA39026.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(58, 83, 139)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.21512893650831605
+ ],
+ "y": [
+ -0.05049832840306235
+ ],
+ "z": [
+ -0.08662173103105054
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "unclassified Halorhabdus",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_154552100.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(34, 162, 135)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.04850751144401809
+ ],
+ "y": [
+ 0.11884495317326671
+ ],
+ "z": [
+ -0.0033186831292885883
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Halobellus",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_256287971.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(65, 64, 132)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.02559067067204765
+ ],
+ "y": [
+ 0.12049405482667874
+ ],
+ "z": [
+ 0.01737979538696331
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Methanofollis fontis",
+ "Euryarchaeota",
+ "Methanomicrobia",
+ "WP_130646405.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(66, 61, 131)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.1847988247565108
+ ],
+ "y": [
+ -0.04050167083908747
+ ],
+ "z": [
+ -0.06924110230629237
+ ]
+ },
+ {
+ "customdata": [
+ [
+ "methionine adenosyltransferase",
+ "Natrarchaeobius halalkaliphilus",
+ "Euryarchaeota",
+ "Halobacteria",
+ "WP_124177345.1"
+ ]
+ ],
+ "hovertemplate": "%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ "marker": {
+ "color": "rgb(68, 2, 85)",
+ "size": 7
+ },
+ "mode": "markers",
+ "text": "methionine adenosyltransferase",
+ "type": "scatter3d",
+ "x": [
+ -0.030158796521055915
+ ],
+ "y": [
+ 0.1389772978797611
+ ],
+ "z": [
+ 0.012477334393911991
+ ]
+ }
+ ],
+ "layout": {
+ "hovermode": "closest",
+ "margin": {
+ "b": 0,
+ "l": 0,
+ "r": 0,
+ "t": 0
+ },
+ "plot_bgcolor": "white",
+ "scene": {
+ "xaxis": {
+ "visible": false
+ },
+ "yaxis": {
+ "visible": false
+ },
+ "zaxis": {
+ "visible": false
+ }
+ },
+ "showlegend": false,
+ "template": {
+ "data": {
+ "bar": [
+ {
+ "error_x": {
+ "color": "#2a3f5f"
+ },
+ "error_y": {
+ "color": "#2a3f5f"
+ },
+ "marker": {
+ "line": {
+ "color": "#E5ECF6",
+ "width": 0.5
+ },
+ "pattern": {
+ "fillmode": "overlay",
+ "size": 10,
+ "solidity": 0.2
+ }
+ },
+ "type": "bar"
+ }
+ ],
+ "barpolar": [
+ {
+ "marker": {
+ "line": {
+ "color": "#E5ECF6",
+ "width": 0.5
+ },
+ "pattern": {
+ "fillmode": "overlay",
+ "size": 10,
+ "solidity": 0.2
+ }
+ },
+ "type": "barpolar"
+ }
+ ],
+ "carpet": [
+ {
+ "aaxis": {
+ "endlinecolor": "#2a3f5f",
+ "gridcolor": "white",
+ "linecolor": "white",
+ "minorgridcolor": "white",
+ "startlinecolor": "#2a3f5f"
+ },
+ "baxis": {
+ "endlinecolor": "#2a3f5f",
+ "gridcolor": "white",
+ "linecolor": "white",
+ "minorgridcolor": "white",
+ "startlinecolor": "#2a3f5f"
+ },
+ "type": "carpet"
+ }
+ ],
+ "choropleth": [
+ {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ },
+ "type": "choropleth"
+ }
+ ],
+ "contour": [
+ {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ },
+ "colorscale": [
+ [
+ 0,
+ "#0d0887"
+ ],
+ [
+ 0.1111111111111111,
+ "#46039f"
+ ],
+ [
+ 0.2222222222222222,
+ "#7201a8"
+ ],
+ [
+ 0.3333333333333333,
+ "#9c179e"
+ ],
+ [
+ 0.4444444444444444,
+ "#bd3786"
+ ],
+ [
+ 0.5555555555555556,
+ "#d8576b"
+ ],
+ [
+ 0.6666666666666666,
+ "#ed7953"
+ ],
+ [
+ 0.7777777777777778,
+ "#fb9f3a"
+ ],
+ [
+ 0.8888888888888888,
+ "#fdca26"
+ ],
+ [
+ 1,
+ "#f0f921"
+ ]
+ ],
+ "type": "contour"
+ }
+ ],
+ "contourcarpet": [
+ {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ },
+ "type": "contourcarpet"
+ }
+ ],
+ "heatmap": [
+ {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ },
+ "colorscale": [
+ [
+ 0,
+ "#0d0887"
+ ],
+ [
+ 0.1111111111111111,
+ "#46039f"
+ ],
+ [
+ 0.2222222222222222,
+ "#7201a8"
+ ],
+ [
+ 0.3333333333333333,
+ "#9c179e"
+ ],
+ [
+ 0.4444444444444444,
+ "#bd3786"
+ ],
+ [
+ 0.5555555555555556,
+ "#d8576b"
+ ],
+ [
+ 0.6666666666666666,
+ "#ed7953"
+ ],
+ [
+ 0.7777777777777778,
+ "#fb9f3a"
+ ],
+ [
+ 0.8888888888888888,
+ "#fdca26"
+ ],
+ [
+ 1,
+ "#f0f921"
+ ]
+ ],
+ "type": "heatmap"
+ }
+ ],
+ "heatmapgl": [
+ {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ },
+ "colorscale": [
+ [
+ 0,
+ "#0d0887"
+ ],
+ [
+ 0.1111111111111111,
+ "#46039f"
+ ],
+ [
+ 0.2222222222222222,
+ "#7201a8"
+ ],
+ [
+ 0.3333333333333333,
+ "#9c179e"
+ ],
+ [
+ 0.4444444444444444,
+ "#bd3786"
+ ],
+ [
+ 0.5555555555555556,
+ "#d8576b"
+ ],
+ [
+ 0.6666666666666666,
+ "#ed7953"
+ ],
+ [
+ 0.7777777777777778,
+ "#fb9f3a"
+ ],
+ [
+ 0.8888888888888888,
+ "#fdca26"
+ ],
+ [
+ 1,
+ "#f0f921"
+ ]
+ ],
+ "type": "heatmapgl"
+ }
+ ],
+ "histogram": [
+ {
+ "marker": {
+ "pattern": {
+ "fillmode": "overlay",
+ "size": 10,
+ "solidity": 0.2
+ }
+ },
+ "type": "histogram"
+ }
+ ],
+ "histogram2d": [
+ {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ },
+ "colorscale": [
+ [
+ 0,
+ "#0d0887"
+ ],
+ [
+ 0.1111111111111111,
+ "#46039f"
+ ],
+ [
+ 0.2222222222222222,
+ "#7201a8"
+ ],
+ [
+ 0.3333333333333333,
+ "#9c179e"
+ ],
+ [
+ 0.4444444444444444,
+ "#bd3786"
+ ],
+ [
+ 0.5555555555555556,
+ "#d8576b"
+ ],
+ [
+ 0.6666666666666666,
+ "#ed7953"
+ ],
+ [
+ 0.7777777777777778,
+ "#fb9f3a"
+ ],
+ [
+ 0.8888888888888888,
+ "#fdca26"
+ ],
+ [
+ 1,
+ "#f0f921"
+ ]
+ ],
+ "type": "histogram2d"
+ }
+ ],
+ "histogram2dcontour": [
+ {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ },
+ "colorscale": [
+ [
+ 0,
+ "#0d0887"
+ ],
+ [
+ 0.1111111111111111,
+ "#46039f"
+ ],
+ [
+ 0.2222222222222222,
+ "#7201a8"
+ ],
+ [
+ 0.3333333333333333,
+ "#9c179e"
+ ],
+ [
+ 0.4444444444444444,
+ "#bd3786"
+ ],
+ [
+ 0.5555555555555556,
+ "#d8576b"
+ ],
+ [
+ 0.6666666666666666,
+ "#ed7953"
+ ],
+ [
+ 0.7777777777777778,
+ "#fb9f3a"
+ ],
+ [
+ 0.8888888888888888,
+ "#fdca26"
+ ],
+ [
+ 1,
+ "#f0f921"
+ ]
+ ],
+ "type": "histogram2dcontour"
+ }
+ ],
+ "mesh3d": [
+ {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ },
+ "type": "mesh3d"
+ }
+ ],
+ "parcoords": [
+ {
+ "line": {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ }
+ },
+ "type": "parcoords"
+ }
+ ],
+ "pie": [
+ {
+ "automargin": true,
+ "type": "pie"
+ }
+ ],
+ "scatter": [
+ {
+ "fillpattern": {
+ "fillmode": "overlay",
+ "size": 10,
+ "solidity": 0.2
+ },
+ "type": "scatter"
+ }
+ ],
+ "scatter3d": [
+ {
+ "line": {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ }
+ },
+ "marker": {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ }
+ },
+ "type": "scatter3d"
+ }
+ ],
+ "scattercarpet": [
+ {
+ "marker": {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ }
+ },
+ "type": "scattercarpet"
+ }
+ ],
+ "scattergeo": [
+ {
+ "marker": {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ }
+ },
+ "type": "scattergeo"
+ }
+ ],
+ "scattergl": [
+ {
+ "marker": {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ }
+ },
+ "type": "scattergl"
+ }
+ ],
+ "scattermapbox": [
+ {
+ "marker": {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ }
+ },
+ "type": "scattermapbox"
+ }
+ ],
+ "scatterpolar": [
+ {
+ "marker": {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ }
+ },
+ "type": "scatterpolar"
+ }
+ ],
+ "scatterpolargl": [
+ {
+ "marker": {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ }
+ },
+ "type": "scatterpolargl"
+ }
+ ],
+ "scatterternary": [
+ {
+ "marker": {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ }
+ },
+ "type": "scatterternary"
+ }
+ ],
+ "surface": [
+ {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ },
+ "colorscale": [
+ [
+ 0,
+ "#0d0887"
+ ],
+ [
+ 0.1111111111111111,
+ "#46039f"
+ ],
+ [
+ 0.2222222222222222,
+ "#7201a8"
+ ],
+ [
+ 0.3333333333333333,
+ "#9c179e"
+ ],
+ [
+ 0.4444444444444444,
+ "#bd3786"
+ ],
+ [
+ 0.5555555555555556,
+ "#d8576b"
+ ],
+ [
+ 0.6666666666666666,
+ "#ed7953"
+ ],
+ [
+ 0.7777777777777778,
+ "#fb9f3a"
+ ],
+ [
+ 0.8888888888888888,
+ "#fdca26"
+ ],
+ [
+ 1,
+ "#f0f921"
+ ]
+ ],
+ "type": "surface"
+ }
+ ],
+ "table": [
+ {
+ "cells": {
+ "fill": {
+ "color": "#EBF0F8"
+ },
+ "line": {
+ "color": "white"
+ }
+ },
+ "header": {
+ "fill": {
+ "color": "#C8D4E3"
+ },
+ "line": {
+ "color": "white"
+ }
+ },
+ "type": "table"
+ }
+ ]
+ },
+ "layout": {
+ "annotationdefaults": {
+ "arrowcolor": "#2a3f5f",
+ "arrowhead": 0,
+ "arrowwidth": 1
+ },
+ "autotypenumbers": "strict",
+ "coloraxis": {
+ "colorbar": {
+ "outlinewidth": 0,
+ "ticks": ""
+ }
+ },
+ "colorscale": {
+ "diverging": [
+ [
+ 0,
+ "#8e0152"
+ ],
+ [
+ 0.1,
+ "#c51b7d"
+ ],
+ [
+ 0.2,
+ "#de77ae"
+ ],
+ [
+ 0.3,
+ "#f1b6da"
+ ],
+ [
+ 0.4,
+ "#fde0ef"
+ ],
+ [
+ 0.5,
+ "#f7f7f7"
+ ],
+ [
+ 0.6,
+ "#e6f5d0"
+ ],
+ [
+ 0.7,
+ "#b8e186"
+ ],
+ [
+ 0.8,
+ "#7fbc41"
+ ],
+ [
+ 0.9,
+ "#4d9221"
+ ],
+ [
+ 1,
+ "#276419"
+ ]
+ ],
+ "sequential": [
+ [
+ 0,
+ "#0d0887"
+ ],
+ [
+ 0.1111111111111111,
+ "#46039f"
+ ],
+ [
+ 0.2222222222222222,
+ "#7201a8"
+ ],
+ [
+ 0.3333333333333333,
+ "#9c179e"
+ ],
+ [
+ 0.4444444444444444,
+ "#bd3786"
+ ],
+ [
+ 0.5555555555555556,
+ "#d8576b"
+ ],
+ [
+ 0.6666666666666666,
+ "#ed7953"
+ ],
+ [
+ 0.7777777777777778,
+ "#fb9f3a"
+ ],
+ [
+ 0.8888888888888888,
+ "#fdca26"
+ ],
+ [
+ 1,
+ "#f0f921"
+ ]
+ ],
+ "sequentialminus": [
+ [
+ 0,
+ "#0d0887"
+ ],
+ [
+ 0.1111111111111111,
+ "#46039f"
+ ],
+ [
+ 0.2222222222222222,
+ "#7201a8"
+ ],
+ [
+ 0.3333333333333333,
+ "#9c179e"
+ ],
+ [
+ 0.4444444444444444,
+ "#bd3786"
+ ],
+ [
+ 0.5555555555555556,
+ "#d8576b"
+ ],
+ [
+ 0.6666666666666666,
+ "#ed7953"
+ ],
+ [
+ 0.7777777777777778,
+ "#fb9f3a"
+ ],
+ [
+ 0.8888888888888888,
+ "#fdca26"
+ ],
+ [
+ 1,
+ "#f0f921"
+ ]
+ ]
+ },
+ "colorway": [
+ "#636efa",
+ "#EF553B",
+ "#00cc96",
+ "#ab63fa",
+ "#FFA15A",
+ "#19d3f3",
+ "#FF6692",
+ "#B6E880",
+ "#FF97FF",
+ "#FECB52"
+ ],
+ "font": {
+ "color": "#2a3f5f"
+ },
+ "geo": {
+ "bgcolor": "white",
+ "lakecolor": "white",
+ "landcolor": "#E5ECF6",
+ "showlakes": true,
+ "showland": true,
+ "subunitcolor": "white"
+ },
+ "hoverlabel": {
+ "align": "left"
+ },
+ "hovermode": "closest",
+ "mapbox": {
+ "style": "light"
+ },
+ "paper_bgcolor": "white",
+ "plot_bgcolor": "#E5ECF6",
+ "polar": {
+ "angularaxis": {
+ "gridcolor": "white",
+ "linecolor": "white",
+ "ticks": ""
+ },
+ "bgcolor": "#E5ECF6",
+ "radialaxis": {
+ "gridcolor": "white",
+ "linecolor": "white",
+ "ticks": ""
+ }
+ },
+ "scene": {
+ "xaxis": {
+ "backgroundcolor": "#E5ECF6",
+ "gridcolor": "white",
+ "gridwidth": 2,
+ "linecolor": "white",
+ "showbackground": true,
+ "ticks": "",
+ "zerolinecolor": "white"
+ },
+ "yaxis": {
+ "backgroundcolor": "#E5ECF6",
+ "gridcolor": "white",
+ "gridwidth": 2,
+ "linecolor": "white",
+ "showbackground": true,
+ "ticks": "",
+ "zerolinecolor": "white"
+ },
+ "zaxis": {
+ "backgroundcolor": "#E5ECF6",
+ "gridcolor": "white",
+ "gridwidth": 2,
+ "linecolor": "white",
+ "showbackground": true,
+ "ticks": "",
+ "zerolinecolor": "white"
+ }
+ },
+ "shapedefaults": {
+ "line": {
+ "color": "#2a3f5f"
+ }
+ },
+ "ternary": {
+ "aaxis": {
+ "gridcolor": "white",
+ "linecolor": "white",
+ "ticks": ""
+ },
+ "baxis": {
+ "gridcolor": "white",
+ "linecolor": "white",
+ "ticks": ""
+ },
+ "bgcolor": "#E5ECF6",
+ "caxis": {
+ "gridcolor": "white",
+ "linecolor": "white",
+ "ticks": ""
+ }
+ },
+ "title": {
+ "x": 0.05
+ },
+ "xaxis": {
+ "automargin": true,
+ "gridcolor": "white",
+ "linecolor": "white",
+ "ticks": "",
+ "title": {
+ "standoff": 15
+ },
+ "zerolinecolor": "white",
+ "zerolinewidth": 2
+ },
+ "yaxis": {
+ "automargin": true,
+ "gridcolor": "white",
+ "linecolor": "white",
+ "ticks": "",
+ "title": {
+ "standoff": 15
+ },
+ "zerolinecolor": "white",
+ "zerolinewidth": 2
+ }
+ }
+ },
+ "xaxis": {
+ "visible": false
+ },
+ "yaxis": {
+ "visible": false
+ }
+ }
+ }
+ },
+ "metadata": {},
+ "output_type": "display_data"
+ }
+ ],
+ "source": [
+ "n = SequenceNetwork(\n",
+ " sequences=blast_results,\n",
+ " pairwise_alignments=multi_parwise_alignments,\n",
+ " threshold=0.65,\n",
+ " weight=\"identity\",\n",
+ " dimensions=3,\n",
+ " color=\"taxonomy_id\",\n",
+ ")\n",
+ "n.visualize()"
+ ]
+ }
+ ],
+ "metadata": {
+ "kernelspec": {
+ "display_name": "pye",
+ "language": "python",
+ "name": "python3"
+ },
+ "language_info": {
+ "codemirror_mode": {
+ "name": "ipython",
+ "version": 3
+ },
+ "file_extension": ".py",
+ "mimetype": "text/x-python",
+ "name": "python",
+ "nbconvert_exporter": "python",
+ "pygments_lexer": "ipython3",
+ "version": "3.10.13"
+ }
+ },
+ "nbformat": 4,
+ "nbformat_minor": 2
+}
diff --git a/examples/test.ipynb b/examples/test.ipynb
deleted file mode 100644
index fddfea96..00000000
--- a/examples/test.ipynb
+++ /dev/null
@@ -1,259 +0,0 @@
-{
- "cells": [
- {
- "cell_type": "markdown",
- "metadata": {},
- "source": [
- "# Test Docker-integrated Aligners"
- ]
- },
- {
- "cell_type": "code",
- "execution_count": 1,
- "metadata": {},
- "outputs": [],
- "source": [
- "%reload_ext autoreload\n",
- "%autoreload 2\n",
- "from pyeed.core import ProteinInfo\n",
- "from pyeed.core import Alignment\n",
- "from pyeed.aligners import ClustalOmega\n"
- ]
- },
- {
- "cell_type": "code",
- "execution_count": 2,
- "metadata": {},
- "outputs": [],
- "source": [
- "# Get a query sequence from NCBI\n",
- "ald1 = ProteinInfo.from_ncbi(\"UCS38941.1\")"
- ]
- },
- {
- "cell_type": "code",
- "execution_count": 3,
- "metadata": {},
- "outputs": [
- {
- "ename": "KeyboardInterrupt",
- "evalue": "",
- "output_type": "error",
- "traceback": [
- "\u001b[0;31m---------------------------------------------------------------------------\u001b[0m",
- "\u001b[0;31mKeyboardInterrupt\u001b[0m Traceback (most recent call last)",
- "Cell \u001b[0;32mIn[3], line 2\u001b[0m\n\u001b[1;32m 1\u001b[0m \u001b[38;5;66;03m# Run local blastp search\u001b[39;00m\n\u001b[0;32m----> 2\u001b[0m blast_results \u001b[38;5;241m=\u001b[39m \u001b[43mald1\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mblastp\u001b[49m\u001b[43m(\u001b[49m\n\u001b[1;32m 3\u001b[0m \u001b[43m \u001b[49m\u001b[43mdb_path\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[38;5;124;43m\"\u001b[39;49m\u001b[38;5;124;43m/Users/max/Documents/GitHub/blast-db/data/source\u001b[39;49m\u001b[38;5;124;43m\"\u001b[39;49m\u001b[43m,\u001b[49m\n\u001b[1;32m 4\u001b[0m \u001b[43m \u001b[49m\u001b[43mn_hits\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[38;5;241;43m100\u001b[39;49m\u001b[43m,\u001b[49m\n\u001b[1;32m 5\u001b[0m \u001b[43m)\u001b[49m\n",
- "File \u001b[0;32m~/Documents/GitHub/pyeed/pyeed/core/proteininfo.py:261\u001b[0m, in \u001b[0;36mProteinInfo.blastp\u001b[0;34m(self, db_path, identity, evalue, n_hits, subst_matrix, word_size, gapopen, gapextend, threshold, n_cores, ncbi_key)\u001b[0m\n\u001b[1;32m 247\u001b[0m \u001b[38;5;28;01mdef\u001b[39;00m \u001b[38;5;21mblastp\u001b[39m(\n\u001b[1;32m 248\u001b[0m \u001b[38;5;28mself\u001b[39m,\n\u001b[1;32m 249\u001b[0m db_path: \u001b[38;5;28mstr\u001b[39m,\n\u001b[0;32m (...)\u001b[0m\n\u001b[1;32m 259\u001b[0m ncbi_key: \u001b[38;5;28mstr\u001b[39m \u001b[38;5;241m=\u001b[39m \u001b[38;5;28;01mNone\u001b[39;00m,\n\u001b[1;32m 260\u001b[0m ):\n\u001b[0;32m--> 261\u001b[0m blaster \u001b[38;5;241m=\u001b[39m \u001b[43mBlastp\u001b[49m\u001b[43m(\u001b[49m\n\u001b[1;32m 262\u001b[0m \u001b[43m \u001b[49m\u001b[43m_db_path\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mdb_path\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 263\u001b[0m \u001b[43m \u001b[49m\u001b[43midentity\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43midentity\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 264\u001b[0m \u001b[43m \u001b[49m\u001b[43mevalue\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mevalue\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 265\u001b[0m \u001b[43m \u001b[49m\u001b[43mn_hits\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mn_hits\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 266\u001b[0m \u001b[43m \u001b[49m\u001b[43msubst_matrix\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43msubst_matrix\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 267\u001b[0m \u001b[43m \u001b[49m\u001b[43mword_size\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mword_size\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 268\u001b[0m \u001b[43m \u001b[49m\u001b[43mgapopen\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mgapopen\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 269\u001b[0m \u001b[43m \u001b[49m\u001b[43mgapextend\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mgapextend\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 270\u001b[0m \u001b[43m \u001b[49m\u001b[43mthreshold\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mthreshold\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 271\u001b[0m \u001b[43m \u001b[49m\u001b[43mn_cores\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mn_cores\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 272\u001b[0m \u001b[43m \u001b[49m\u001b[43mncbi_key\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mncbi_key\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 273\u001b[0m \u001b[43m \u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 275\u001b[0m command \u001b[38;5;241m=\u001b[39m blaster\u001b[38;5;241m.\u001b[39msetup_command()\n\u001b[1;32m 276\u001b[0m accession_ids \u001b[38;5;241m=\u001b[39m blaster\u001b[38;5;241m.\u001b[39mrun_container(command\u001b[38;5;241m=\u001b[39mcommand, data\u001b[38;5;241m=\u001b[39m\u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39mto_fasta())\n",
- "File \u001b[0;32m~/Documents/GitHub/pyeed/pyeed/containers/abstract_container.py:152\u001b[0m, in \u001b[0;36mBlastp.__init__\u001b[0;34m(self, _db_path, ncbi_key, **kwargs)\u001b[0m\n\u001b[1;32m 151\u001b[0m \u001b[38;5;28;01mdef\u001b[39;00m \u001b[38;5;21m__init__\u001b[39m(\u001b[38;5;28mself\u001b[39m, _db_path: \u001b[38;5;28mstr\u001b[39m, ncbi_key: \u001b[38;5;28mstr\u001b[39m \u001b[38;5;241m=\u001b[39m \u001b[38;5;28;01mNone\u001b[39;00m, \u001b[38;5;241m*\u001b[39m\u001b[38;5;241m*\u001b[39mkwargs):\n\u001b[0;32m--> 152\u001b[0m \u001b[38;5;28;43msuper\u001b[39;49m\u001b[43m(\u001b[49m\u001b[43m)\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[38;5;21;43m__init__\u001b[39;49m\u001b[43m(\u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43mkwargs\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 153\u001b[0m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_db_path \u001b[38;5;241m=\u001b[39m _db_path\n\u001b[1;32m 154\u001b[0m \u001b[38;5;28;01mif\u001b[39;00m \u001b[38;5;129;01mnot\u001b[39;00m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_ncbi_key:\n",
- "File \u001b[0;32m~/Documents/GitHub/pyeed/pyeed/containers/abstract_container.py:65\u001b[0m, in \u001b[0;36mAbstractContainer.__init__\u001b[0;34m(self, **kwargs)\u001b[0m\n\u001b[1;32m 63\u001b[0m \u001b[38;5;28msuper\u001b[39m()\u001b[38;5;241m.\u001b[39m\u001b[38;5;21m__init__\u001b[39m(\u001b[38;5;241m*\u001b[39m\u001b[38;5;241m*\u001b[39mkwargs)\n\u001b[1;32m 64\u001b[0m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_tempdir_path \u001b[38;5;241m=\u001b[39m tempfile\u001b[38;5;241m.\u001b[39mmkdtemp()\n\u001b[0;32m---> 65\u001b[0m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_client \u001b[38;5;241m=\u001b[39m \u001b[43mdocker\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mfrom_env\u001b[49m\u001b[43m(\u001b[49m\u001b[43m)\u001b[49m\n",
- "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/docker/client.py:94\u001b[0m, in \u001b[0;36mDockerClient.from_env\u001b[0;34m(cls, **kwargs)\u001b[0m\n\u001b[1;32m 92\u001b[0m version \u001b[38;5;241m=\u001b[39m kwargs\u001b[38;5;241m.\u001b[39mpop(\u001b[38;5;124m'\u001b[39m\u001b[38;5;124mversion\u001b[39m\u001b[38;5;124m'\u001b[39m, \u001b[38;5;28;01mNone\u001b[39;00m)\n\u001b[1;32m 93\u001b[0m use_ssh_client \u001b[38;5;241m=\u001b[39m kwargs\u001b[38;5;241m.\u001b[39mpop(\u001b[38;5;124m'\u001b[39m\u001b[38;5;124muse_ssh_client\u001b[39m\u001b[38;5;124m'\u001b[39m, \u001b[38;5;28;01mFalse\u001b[39;00m)\n\u001b[0;32m---> 94\u001b[0m \u001b[38;5;28;01mreturn\u001b[39;00m \u001b[38;5;28;43mcls\u001b[39;49m\u001b[43m(\u001b[49m\n\u001b[1;32m 95\u001b[0m \u001b[43m \u001b[49m\u001b[43mtimeout\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mtimeout\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 96\u001b[0m \u001b[43m \u001b[49m\u001b[43mmax_pool_size\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mmax_pool_size\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 97\u001b[0m \u001b[43m \u001b[49m\u001b[43mversion\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mversion\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 98\u001b[0m \u001b[43m \u001b[49m\u001b[43muse_ssh_client\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43muse_ssh_client\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 99\u001b[0m \u001b[43m \u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43mkwargs_from_env\u001b[49m\u001b[43m(\u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43mkwargs\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 100\u001b[0m \u001b[43m\u001b[49m\u001b[43m)\u001b[49m\n",
- "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/docker/client.py:45\u001b[0m, in \u001b[0;36mDockerClient.__init__\u001b[0;34m(self, *args, **kwargs)\u001b[0m\n\u001b[1;32m 44\u001b[0m \u001b[38;5;28;01mdef\u001b[39;00m \u001b[38;5;21m__init__\u001b[39m(\u001b[38;5;28mself\u001b[39m, \u001b[38;5;241m*\u001b[39margs, \u001b[38;5;241m*\u001b[39m\u001b[38;5;241m*\u001b[39mkwargs):\n\u001b[0;32m---> 45\u001b[0m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39mapi \u001b[38;5;241m=\u001b[39m \u001b[43mAPIClient\u001b[49m\u001b[43m(\u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43margs\u001b[49m\u001b[43m,\u001b[49m\u001b[43m \u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43mkwargs\u001b[49m\u001b[43m)\u001b[49m\n",
- "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/docker/api/client.py:197\u001b[0m, in \u001b[0;36mAPIClient.__init__\u001b[0;34m(self, base_url, version, timeout, tls, user_agent, num_pools, credstore_env, use_ssh_client, max_pool_size)\u001b[0m\n\u001b[1;32m 192\u001b[0m \u001b[38;5;66;03m# version detection needs to be after unix adapter mounting\u001b[39;00m\n\u001b[1;32m 193\u001b[0m \u001b[38;5;28;01mif\u001b[39;00m version \u001b[38;5;129;01mis\u001b[39;00m \u001b[38;5;28;01mNone\u001b[39;00m \u001b[38;5;129;01mor\u001b[39;00m (\u001b[38;5;28misinstance\u001b[39m(\n\u001b[1;32m 194\u001b[0m version,\n\u001b[1;32m 195\u001b[0m \u001b[38;5;28mstr\u001b[39m\n\u001b[1;32m 196\u001b[0m ) \u001b[38;5;129;01mand\u001b[39;00m version\u001b[38;5;241m.\u001b[39mlower() \u001b[38;5;241m==\u001b[39m \u001b[38;5;124m'\u001b[39m\u001b[38;5;124mauto\u001b[39m\u001b[38;5;124m'\u001b[39m):\n\u001b[0;32m--> 197\u001b[0m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_version \u001b[38;5;241m=\u001b[39m \u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43m_retrieve_server_version\u001b[49m\u001b[43m(\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 198\u001b[0m \u001b[38;5;28;01melse\u001b[39;00m:\n\u001b[1;32m 199\u001b[0m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_version \u001b[38;5;241m=\u001b[39m version\n",
- "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/docker/api/client.py:213\u001b[0m, in \u001b[0;36mAPIClient._retrieve_server_version\u001b[0;34m(self)\u001b[0m\n\u001b[1;32m 211\u001b[0m \u001b[38;5;28;01mdef\u001b[39;00m \u001b[38;5;21m_retrieve_server_version\u001b[39m(\u001b[38;5;28mself\u001b[39m):\n\u001b[1;32m 212\u001b[0m \u001b[38;5;28;01mtry\u001b[39;00m:\n\u001b[0;32m--> 213\u001b[0m \u001b[38;5;28;01mreturn\u001b[39;00m \u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mversion\u001b[49m\u001b[43m(\u001b[49m\u001b[43mapi_version\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[38;5;28;43;01mFalse\u001b[39;49;00m\u001b[43m)\u001b[49m[\u001b[38;5;124m\"\u001b[39m\u001b[38;5;124mApiVersion\u001b[39m\u001b[38;5;124m\"\u001b[39m]\n\u001b[1;32m 214\u001b[0m \u001b[38;5;28;01mexcept\u001b[39;00m \u001b[38;5;167;01mKeyError\u001b[39;00m \u001b[38;5;28;01mas\u001b[39;00m ke:\n\u001b[1;32m 215\u001b[0m \u001b[38;5;28;01mraise\u001b[39;00m DockerException(\n\u001b[1;32m 216\u001b[0m \u001b[38;5;124m'\u001b[39m\u001b[38;5;124mInvalid response from docker daemon: key \u001b[39m\u001b[38;5;124m\"\u001b[39m\u001b[38;5;124mApiVersion\u001b[39m\u001b[38;5;124m\"\u001b[39m\u001b[38;5;124m'\u001b[39m\n\u001b[1;32m 217\u001b[0m \u001b[38;5;124m'\u001b[39m\u001b[38;5;124m is missing.\u001b[39m\u001b[38;5;124m'\u001b[39m\n\u001b[1;32m 218\u001b[0m ) \u001b[38;5;28;01mfrom\u001b[39;00m \u001b[38;5;21;01mke\u001b[39;00m\n",
- "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/docker/api/daemon.py:181\u001b[0m, in \u001b[0;36mDaemonApiMixin.version\u001b[0;34m(self, api_version)\u001b[0m\n\u001b[1;32m 169\u001b[0m \u001b[38;5;250m\u001b[39m\u001b[38;5;124;03m\"\"\"\u001b[39;00m\n\u001b[1;32m 170\u001b[0m \u001b[38;5;124;03mReturns version information from the server. Similar to the ``docker\u001b[39;00m\n\u001b[1;32m 171\u001b[0m \u001b[38;5;124;03mversion`` command.\u001b[39;00m\n\u001b[0;32m (...)\u001b[0m\n\u001b[1;32m 178\u001b[0m \u001b[38;5;124;03m If the server returns an error.\u001b[39;00m\n\u001b[1;32m 179\u001b[0m \u001b[38;5;124;03m\"\"\"\u001b[39;00m\n\u001b[1;32m 180\u001b[0m url \u001b[38;5;241m=\u001b[39m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_url(\u001b[38;5;124m\"\u001b[39m\u001b[38;5;124m/version\u001b[39m\u001b[38;5;124m\"\u001b[39m, versioned_api\u001b[38;5;241m=\u001b[39mapi_version)\n\u001b[0;32m--> 181\u001b[0m \u001b[38;5;28;01mreturn\u001b[39;00m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_result(\u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43m_get\u001b[49m\u001b[43m(\u001b[49m\u001b[43murl\u001b[49m\u001b[43m)\u001b[49m, json\u001b[38;5;241m=\u001b[39m\u001b[38;5;28;01mTrue\u001b[39;00m)\n",
- "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/docker/utils/decorators.py:44\u001b[0m, in \u001b[0;36mupdate_headers..inner\u001b[0;34m(self, *args, **kwargs)\u001b[0m\n\u001b[1;32m 42\u001b[0m \u001b[38;5;28;01melse\u001b[39;00m:\n\u001b[1;32m 43\u001b[0m kwargs[\u001b[38;5;124m'\u001b[39m\u001b[38;5;124mheaders\u001b[39m\u001b[38;5;124m'\u001b[39m]\u001b[38;5;241m.\u001b[39mupdate(\u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_general_configs[\u001b[38;5;124m'\u001b[39m\u001b[38;5;124mHttpHeaders\u001b[39m\u001b[38;5;124m'\u001b[39m])\n\u001b[0;32m---> 44\u001b[0m \u001b[38;5;28;01mreturn\u001b[39;00m \u001b[43mf\u001b[49m\u001b[43m(\u001b[49m\u001b[38;5;28;43mself\u001b[39;49m\u001b[43m,\u001b[49m\u001b[43m \u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43margs\u001b[49m\u001b[43m,\u001b[49m\u001b[43m \u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43mkwargs\u001b[49m\u001b[43m)\u001b[49m\n",
- "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/docker/api/client.py:236\u001b[0m, in \u001b[0;36mAPIClient._get\u001b[0;34m(self, url, **kwargs)\u001b[0m\n\u001b[1;32m 234\u001b[0m \u001b[38;5;129m@update_headers\u001b[39m\n\u001b[1;32m 235\u001b[0m \u001b[38;5;28;01mdef\u001b[39;00m \u001b[38;5;21m_get\u001b[39m(\u001b[38;5;28mself\u001b[39m, url, \u001b[38;5;241m*\u001b[39m\u001b[38;5;241m*\u001b[39mkwargs):\n\u001b[0;32m--> 236\u001b[0m \u001b[38;5;28;01mreturn\u001b[39;00m \u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mget\u001b[49m\u001b[43m(\u001b[49m\u001b[43murl\u001b[49m\u001b[43m,\u001b[49m\u001b[43m \u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43m_set_request_timeout\u001b[49m\u001b[43m(\u001b[49m\u001b[43mkwargs\u001b[49m\u001b[43m)\u001b[49m\u001b[43m)\u001b[49m\n",
- "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/requests/sessions.py:602\u001b[0m, in \u001b[0;36mSession.get\u001b[0;34m(self, url, **kwargs)\u001b[0m\n\u001b[1;32m 594\u001b[0m \u001b[38;5;250m\u001b[39m\u001b[38;5;124mr\u001b[39m\u001b[38;5;124;03m\"\"\"Sends a GET request. Returns :class:`Response` object.\u001b[39;00m\n\u001b[1;32m 595\u001b[0m \n\u001b[1;32m 596\u001b[0m \u001b[38;5;124;03m:param url: URL for the new :class:`Request` object.\u001b[39;00m\n\u001b[1;32m 597\u001b[0m \u001b[38;5;124;03m:param \\*\\*kwargs: Optional arguments that ``request`` takes.\u001b[39;00m\n\u001b[1;32m 598\u001b[0m \u001b[38;5;124;03m:rtype: requests.Response\u001b[39;00m\n\u001b[1;32m 599\u001b[0m \u001b[38;5;124;03m\"\"\"\u001b[39;00m\n\u001b[1;32m 601\u001b[0m kwargs\u001b[38;5;241m.\u001b[39msetdefault(\u001b[38;5;124m\"\u001b[39m\u001b[38;5;124mallow_redirects\u001b[39m\u001b[38;5;124m\"\u001b[39m, \u001b[38;5;28;01mTrue\u001b[39;00m)\n\u001b[0;32m--> 602\u001b[0m \u001b[38;5;28;01mreturn\u001b[39;00m \u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mrequest\u001b[49m\u001b[43m(\u001b[49m\u001b[38;5;124;43m\"\u001b[39;49m\u001b[38;5;124;43mGET\u001b[39;49m\u001b[38;5;124;43m\"\u001b[39;49m\u001b[43m,\u001b[49m\u001b[43m \u001b[49m\u001b[43murl\u001b[49m\u001b[43m,\u001b[49m\u001b[43m \u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43mkwargs\u001b[49m\u001b[43m)\u001b[49m\n",
- "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/requests/sessions.py:589\u001b[0m, in \u001b[0;36mSession.request\u001b[0;34m(self, method, url, params, data, headers, cookies, files, auth, timeout, allow_redirects, proxies, hooks, stream, verify, cert, json)\u001b[0m\n\u001b[1;32m 584\u001b[0m send_kwargs \u001b[38;5;241m=\u001b[39m {\n\u001b[1;32m 585\u001b[0m \u001b[38;5;124m\"\u001b[39m\u001b[38;5;124mtimeout\u001b[39m\u001b[38;5;124m\"\u001b[39m: timeout,\n\u001b[1;32m 586\u001b[0m \u001b[38;5;124m\"\u001b[39m\u001b[38;5;124mallow_redirects\u001b[39m\u001b[38;5;124m\"\u001b[39m: allow_redirects,\n\u001b[1;32m 587\u001b[0m }\n\u001b[1;32m 588\u001b[0m send_kwargs\u001b[38;5;241m.\u001b[39mupdate(settings)\n\u001b[0;32m--> 589\u001b[0m resp \u001b[38;5;241m=\u001b[39m \u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43msend\u001b[49m\u001b[43m(\u001b[49m\u001b[43mprep\u001b[49m\u001b[43m,\u001b[49m\u001b[43m \u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43msend_kwargs\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 591\u001b[0m \u001b[38;5;28;01mreturn\u001b[39;00m resp\n",
- "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/requests/sessions.py:703\u001b[0m, in \u001b[0;36mSession.send\u001b[0;34m(self, request, **kwargs)\u001b[0m\n\u001b[1;32m 700\u001b[0m start \u001b[38;5;241m=\u001b[39m preferred_clock()\n\u001b[1;32m 702\u001b[0m \u001b[38;5;66;03m# Send the request\u001b[39;00m\n\u001b[0;32m--> 703\u001b[0m r \u001b[38;5;241m=\u001b[39m \u001b[43madapter\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43msend\u001b[49m\u001b[43m(\u001b[49m\u001b[43mrequest\u001b[49m\u001b[43m,\u001b[49m\u001b[43m \u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43mkwargs\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 705\u001b[0m \u001b[38;5;66;03m# Total elapsed time of the request (approximately)\u001b[39;00m\n\u001b[1;32m 706\u001b[0m elapsed \u001b[38;5;241m=\u001b[39m preferred_clock() \u001b[38;5;241m-\u001b[39m start\n",
- "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/requests/adapters.py:486\u001b[0m, in \u001b[0;36mHTTPAdapter.send\u001b[0;34m(self, request, stream, timeout, verify, cert, proxies)\u001b[0m\n\u001b[1;32m 483\u001b[0m timeout \u001b[38;5;241m=\u001b[39m TimeoutSauce(connect\u001b[38;5;241m=\u001b[39mtimeout, read\u001b[38;5;241m=\u001b[39mtimeout)\n\u001b[1;32m 485\u001b[0m \u001b[38;5;28;01mtry\u001b[39;00m:\n\u001b[0;32m--> 486\u001b[0m resp \u001b[38;5;241m=\u001b[39m \u001b[43mconn\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43murlopen\u001b[49m\u001b[43m(\u001b[49m\n\u001b[1;32m 487\u001b[0m \u001b[43m \u001b[49m\u001b[43mmethod\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mrequest\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mmethod\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 488\u001b[0m \u001b[43m \u001b[49m\u001b[43murl\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43murl\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 489\u001b[0m \u001b[43m \u001b[49m\u001b[43mbody\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mrequest\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mbody\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 490\u001b[0m \u001b[43m \u001b[49m\u001b[43mheaders\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mrequest\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mheaders\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 491\u001b[0m \u001b[43m \u001b[49m\u001b[43mredirect\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[38;5;28;43;01mFalse\u001b[39;49;00m\u001b[43m,\u001b[49m\n\u001b[1;32m 492\u001b[0m \u001b[43m \u001b[49m\u001b[43massert_same_host\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[38;5;28;43;01mFalse\u001b[39;49;00m\u001b[43m,\u001b[49m\n\u001b[1;32m 493\u001b[0m \u001b[43m \u001b[49m\u001b[43mpreload_content\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[38;5;28;43;01mFalse\u001b[39;49;00m\u001b[43m,\u001b[49m\n\u001b[1;32m 494\u001b[0m \u001b[43m \u001b[49m\u001b[43mdecode_content\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[38;5;28;43;01mFalse\u001b[39;49;00m\u001b[43m,\u001b[49m\n\u001b[1;32m 495\u001b[0m \u001b[43m \u001b[49m\u001b[43mretries\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mmax_retries\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 496\u001b[0m \u001b[43m \u001b[49m\u001b[43mtimeout\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mtimeout\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 497\u001b[0m \u001b[43m \u001b[49m\u001b[43mchunked\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mchunked\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 498\u001b[0m \u001b[43m \u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 500\u001b[0m \u001b[38;5;28;01mexcept\u001b[39;00m (ProtocolError, \u001b[38;5;167;01mOSError\u001b[39;00m) \u001b[38;5;28;01mas\u001b[39;00m err:\n\u001b[1;32m 501\u001b[0m \u001b[38;5;28;01mraise\u001b[39;00m \u001b[38;5;167;01mConnectionError\u001b[39;00m(err, request\u001b[38;5;241m=\u001b[39mrequest)\n",
- "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/urllib3/connectionpool.py:793\u001b[0m, in \u001b[0;36mHTTPConnectionPool.urlopen\u001b[0;34m(self, method, url, body, headers, retries, redirect, assert_same_host, timeout, pool_timeout, release_conn, chunked, body_pos, preload_content, decode_content, **response_kw)\u001b[0m\n\u001b[1;32m 790\u001b[0m response_conn \u001b[38;5;241m=\u001b[39m conn \u001b[38;5;28;01mif\u001b[39;00m \u001b[38;5;129;01mnot\u001b[39;00m release_conn \u001b[38;5;28;01melse\u001b[39;00m \u001b[38;5;28;01mNone\u001b[39;00m\n\u001b[1;32m 792\u001b[0m \u001b[38;5;66;03m# Make the request on the HTTPConnection object\u001b[39;00m\n\u001b[0;32m--> 793\u001b[0m response \u001b[38;5;241m=\u001b[39m \u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43m_make_request\u001b[49m\u001b[43m(\u001b[49m\n\u001b[1;32m 794\u001b[0m \u001b[43m \u001b[49m\u001b[43mconn\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 795\u001b[0m \u001b[43m \u001b[49m\u001b[43mmethod\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 796\u001b[0m \u001b[43m \u001b[49m\u001b[43murl\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 797\u001b[0m \u001b[43m \u001b[49m\u001b[43mtimeout\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mtimeout_obj\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 798\u001b[0m \u001b[43m \u001b[49m\u001b[43mbody\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mbody\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 799\u001b[0m \u001b[43m \u001b[49m\u001b[43mheaders\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mheaders\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 800\u001b[0m \u001b[43m \u001b[49m\u001b[43mchunked\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mchunked\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 801\u001b[0m \u001b[43m \u001b[49m\u001b[43mretries\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mretries\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 802\u001b[0m \u001b[43m \u001b[49m\u001b[43mresponse_conn\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mresponse_conn\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 803\u001b[0m \u001b[43m \u001b[49m\u001b[43mpreload_content\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mpreload_content\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 804\u001b[0m \u001b[43m \u001b[49m\u001b[43mdecode_content\u001b[49m\u001b[38;5;241;43m=\u001b[39;49m\u001b[43mdecode_content\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 805\u001b[0m \u001b[43m \u001b[49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[38;5;241;43m*\u001b[39;49m\u001b[43mresponse_kw\u001b[49m\u001b[43m,\u001b[49m\n\u001b[1;32m 806\u001b[0m \u001b[43m\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 808\u001b[0m \u001b[38;5;66;03m# Everything went great!\u001b[39;00m\n\u001b[1;32m 809\u001b[0m clean_exit \u001b[38;5;241m=\u001b[39m \u001b[38;5;28;01mTrue\u001b[39;00m\n",
- "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/urllib3/connectionpool.py:537\u001b[0m, in \u001b[0;36mHTTPConnectionPool._make_request\u001b[0;34m(self, conn, method, url, body, headers, retries, timeout, chunked, response_conn, preload_content, decode_content, enforce_content_length)\u001b[0m\n\u001b[1;32m 535\u001b[0m \u001b[38;5;66;03m# Receive the response from the server\u001b[39;00m\n\u001b[1;32m 536\u001b[0m \u001b[38;5;28;01mtry\u001b[39;00m:\n\u001b[0;32m--> 537\u001b[0m response \u001b[38;5;241m=\u001b[39m \u001b[43mconn\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mgetresponse\u001b[49m\u001b[43m(\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 538\u001b[0m \u001b[38;5;28;01mexcept\u001b[39;00m (BaseSSLError, \u001b[38;5;167;01mOSError\u001b[39;00m) \u001b[38;5;28;01mas\u001b[39;00m e:\n\u001b[1;32m 539\u001b[0m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_raise_timeout(err\u001b[38;5;241m=\u001b[39me, url\u001b[38;5;241m=\u001b[39murl, timeout_value\u001b[38;5;241m=\u001b[39mread_timeout)\n",
- "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/site-packages/urllib3/connection.py:466\u001b[0m, in \u001b[0;36mHTTPConnection.getresponse\u001b[0;34m(self)\u001b[0m\n\u001b[1;32m 463\u001b[0m \u001b[38;5;28;01mfrom\u001b[39;00m \u001b[38;5;21;01m.\u001b[39;00m\u001b[38;5;21;01mresponse\u001b[39;00m \u001b[38;5;28;01mimport\u001b[39;00m HTTPResponse\n\u001b[1;32m 465\u001b[0m \u001b[38;5;66;03m# Get the response from http.client.HTTPConnection\u001b[39;00m\n\u001b[0;32m--> 466\u001b[0m httplib_response \u001b[38;5;241m=\u001b[39m \u001b[38;5;28;43msuper\u001b[39;49m\u001b[43m(\u001b[49m\u001b[43m)\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mgetresponse\u001b[49m\u001b[43m(\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 468\u001b[0m \u001b[38;5;28;01mtry\u001b[39;00m:\n\u001b[1;32m 469\u001b[0m assert_header_parsing(httplib_response\u001b[38;5;241m.\u001b[39mmsg)\n",
- "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/http/client.py:1375\u001b[0m, in \u001b[0;36mHTTPConnection.getresponse\u001b[0;34m(self)\u001b[0m\n\u001b[1;32m 1373\u001b[0m \u001b[38;5;28;01mtry\u001b[39;00m:\n\u001b[1;32m 1374\u001b[0m \u001b[38;5;28;01mtry\u001b[39;00m:\n\u001b[0;32m-> 1375\u001b[0m \u001b[43mresponse\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mbegin\u001b[49m\u001b[43m(\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 1376\u001b[0m \u001b[38;5;28;01mexcept\u001b[39;00m \u001b[38;5;167;01mConnectionError\u001b[39;00m:\n\u001b[1;32m 1377\u001b[0m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39mclose()\n",
- "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/http/client.py:318\u001b[0m, in \u001b[0;36mHTTPResponse.begin\u001b[0;34m(self)\u001b[0m\n\u001b[1;32m 316\u001b[0m \u001b[38;5;66;03m# read until we get a non-100 response\u001b[39;00m\n\u001b[1;32m 317\u001b[0m \u001b[38;5;28;01mwhile\u001b[39;00m \u001b[38;5;28;01mTrue\u001b[39;00m:\n\u001b[0;32m--> 318\u001b[0m version, status, reason \u001b[38;5;241m=\u001b[39m \u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43m_read_status\u001b[49m\u001b[43m(\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 319\u001b[0m \u001b[38;5;28;01mif\u001b[39;00m status \u001b[38;5;241m!=\u001b[39m CONTINUE:\n\u001b[1;32m 320\u001b[0m \u001b[38;5;28;01mbreak\u001b[39;00m\n",
- "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/http/client.py:279\u001b[0m, in \u001b[0;36mHTTPResponse._read_status\u001b[0;34m(self)\u001b[0m\n\u001b[1;32m 278\u001b[0m \u001b[38;5;28;01mdef\u001b[39;00m \u001b[38;5;21m_read_status\u001b[39m(\u001b[38;5;28mself\u001b[39m):\n\u001b[0;32m--> 279\u001b[0m line \u001b[38;5;241m=\u001b[39m \u001b[38;5;28mstr\u001b[39m(\u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mfp\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mreadline\u001b[49m\u001b[43m(\u001b[49m\u001b[43m_MAXLINE\u001b[49m\u001b[43m \u001b[49m\u001b[38;5;241;43m+\u001b[39;49m\u001b[43m \u001b[49m\u001b[38;5;241;43m1\u001b[39;49m\u001b[43m)\u001b[49m, \u001b[38;5;124m\"\u001b[39m\u001b[38;5;124miso-8859-1\u001b[39m\u001b[38;5;124m\"\u001b[39m)\n\u001b[1;32m 280\u001b[0m \u001b[38;5;28;01mif\u001b[39;00m \u001b[38;5;28mlen\u001b[39m(line) \u001b[38;5;241m>\u001b[39m _MAXLINE:\n\u001b[1;32m 281\u001b[0m \u001b[38;5;28;01mraise\u001b[39;00m LineTooLong(\u001b[38;5;124m\"\u001b[39m\u001b[38;5;124mstatus line\u001b[39m\u001b[38;5;124m\"\u001b[39m)\n",
- "File \u001b[0;32m~/miniconda3/envs/pye/lib/python3.10/socket.py:705\u001b[0m, in \u001b[0;36mSocketIO.readinto\u001b[0;34m(self, b)\u001b[0m\n\u001b[1;32m 703\u001b[0m \u001b[38;5;28;01mwhile\u001b[39;00m \u001b[38;5;28;01mTrue\u001b[39;00m:\n\u001b[1;32m 704\u001b[0m \u001b[38;5;28;01mtry\u001b[39;00m:\n\u001b[0;32m--> 705\u001b[0m \u001b[38;5;28;01mreturn\u001b[39;00m \u001b[38;5;28;43mself\u001b[39;49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43m_sock\u001b[49m\u001b[38;5;241;43m.\u001b[39;49m\u001b[43mrecv_into\u001b[49m\u001b[43m(\u001b[49m\u001b[43mb\u001b[49m\u001b[43m)\u001b[49m\n\u001b[1;32m 706\u001b[0m \u001b[38;5;28;01mexcept\u001b[39;00m timeout:\n\u001b[1;32m 707\u001b[0m \u001b[38;5;28mself\u001b[39m\u001b[38;5;241m.\u001b[39m_timeout_occurred \u001b[38;5;241m=\u001b[39m \u001b[38;5;28;01mTrue\u001b[39;00m\n",
- "\u001b[0;31mKeyboardInterrupt\u001b[0m: "
- ]
- }
- ],
- "source": [
- "# Run local blastp search\n",
- "blast_results = ald1.blastp(\n",
- " db_path=\"/Users/max/Documents/GitHub/blast-db/data/source\",\n",
- " n_hits=100,\n",
- ")"
- ]
- },
- {
- "cell_type": "code",
- "execution_count": null,
- "metadata": {},
- "outputs": [
- {
- "ename": "NameError",
- "evalue": "name 'blast_results' is not defined",
- "output_type": "error",
- "traceback": [
- "\u001b[0;31m---------------------------------------------------------------------------\u001b[0m",
- "\u001b[0;31mNameError\u001b[0m Traceback (most recent call last)",
- "Cell \u001b[0;32mIn[1], line 1\u001b[0m\n\u001b[0;32m----> 1\u001b[0m \u001b[43mblast_results\u001b[49m[\u001b[38;5;241m0\u001b[39m]\u001b[38;5;241m.\u001b[39msource_id\n",
- "\u001b[0;31mNameError\u001b[0m: name 'blast_results' is not defined"
- ]
- }
- ],
- "source": [
- "blast_results[0].source_id"
- ]
- },
- {
- "cell_type": "markdown",
- "metadata": {},
- "source": [
- "## MSA with Clustal Omega"
- ]
- },
- {
- "cell_type": "markdown",
- "metadata": {},
- "source": []
- },
- {
- "cell_type": "code",
- "execution_count": null,
- "metadata": {},
- "outputs": [
- {
- "name": "stdout",
- "output_type": "stream",
- "text": [
- "π Running CLUSTALO\n"
- ]
- }
- ],
- "source": [
- "alignment = Alignment.from_sequences(blast_results)\n",
- "alignment.align(ClustalOmega)"
- ]
- },
- {
- "cell_type": "code",
- "execution_count": null,
- "metadata": {},
- "outputs": [],
- "source": [
- "alignment.apply_standard_numbering()"
- ]
- },
- {
- "cell_type": "code",
- "execution_count": null,
- "metadata": {},
- "outputs": [
- {
- "data": {
- "text/plain": [
- "Alignment(id='alignment0', method='CLUSTALO', consensus='MEQXQQAXXXXXXXXPXXXXAXXXXXXXPQPXSAPQMXXMXXXXXXXXXXXXXMXHSARPPXRXXXXXXXXXXXXXXXXXAPXLPPPXXXXXXXXXXXXXXPXXXXXEXXXXXXXXHXHXXXXXXXXXXXRXXXXXXXXXXXXXDXXPXSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXSXXXNXXXSXXPQXXXXXXXXXXXXXXXXXXXXXXNXVXIKVGXVGDAQXGKTSLMVKYVEXXXDEXYXQTLGVNFXEKXISIRXTXITFSIXDLGGQREFXNMLPLVXXDAVAIXFMFDLTRXXTLNSIKEWYRQXRGFNXTAIPXLVGTKYDXFXXXXXEXQEEISXQAXXXAXAMXAXLIFXSTXXSINVQKIFKIVLXKXFDLXXTIPEIXXXGXPLLXYXXXGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYXXXXXSXXPXPXXXXXXXXIKNLHXCLRHXQLRCLRVV', input_sequences=[Sequence(id='sequence0', source_id='BAH60832.1', sequence='MSASEMRAASERVGEERNSLPSVRNQVDIQVGLIGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVSIRSTDIVFSLMDLGGQREFINMLPIATLGSSVIILLFDLTRPETLNSIKEWYRQALGLNDSAIPILVGTKYNLFIDLEEEYQEKVSKTSMKYAQVMDAPLIFCSTAKSINIQKIFKVALAKIFDLTLTIPEINEIGDPLLIYKELGSKKNKSKNSSKPRRRSPVDNENKELVSQPHNYGHTSE'), Sequence(id='sequence1', source_id='CAI4663910.1', sequence='MATPSTGANNSIPAVRNQVEVQVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQADGLNDSAIPILVGTKYDLLIDLDPEYQEQISRTSMKYAQVMNAPLIFCSTAKSINIQKIFKIALAKIFNLTLTIPEINEIGDPLLIYKHLGGQQHRHHNKSQDRKSHNIRKPSSSPSSKAPSPGVNT'), Sequence(id='sequence2', source_id='EJT44931.1', sequence='MTTPITGGSTSIPAVRNQVEVQVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQAYGLNDSAIPILVGTKYDLLIDLDPEYQEQISGTSMKYAQVMNAPLIFCSTAKSINIQKIFKIALAKIFNLTLTIPEINEIGDPLLIYKHLGSQQRRRQSKSQDRKNHTVKKPSSSPSSKPPSPGVNI'), Sequence(id='sequence3', source_id='XP_037139093.1', sequence='MSSGGTDVQAQQELPKVKSRVDVQVGLVGDAQVGKTSLIVKYVQNVFDEEYTQTLGVNFLKRKVSIRSTDIVFSIMDLGGQREFINMLPIASLGSSAIVFLFDLTRPETLSSIKEWYRQAHGLNETAVPLLVGTKYDLFVDLDPEYQEQLSRTSMEYAQVMDAPLVFCSTAKSVNVQKIFKIALAKIFNLTLTIPEINEIGDPLLIYKSLGNHRARGEEISRRPSPSARTSFS'), Sequence(id='sequence4', source_id='XP_003680887.1', sequence='MSEAQEQQELPKAKNRVDVQVGLVGDAQVGKTSLMVKYVQNVFDEEYTQTLGVNFLKRKVSIRSTDIVFSLMDLGGQREFINMLPIASLGSSAIVFLFDLTRPETLSSIKEWYRQAHGLNETAVPLLVGTKYDLFVDLDPEYQEQLSRTSMEYAQVMDAPLIFCSTAKSINVQKIFKIALAKIFKLTLTVQEINDVGDPLLIYRHLGNQRHDSDEVSRRSSPSTRSSTS'), Sequence(id='sequence5', source_id='XP_037144827.1', sequence='MSQEYRTRSRSRSFSDQAATQEEERPFVNLNMNVNMRPKNQVEVQIGLVGDAQVGKTSLMVKYVQNVFDEEYTQTLGVNFLKRKVSVRSTDIVFSLMDLGGQREFINMLPIASLGSSAIIFLFDLTRAETLSSIKEWFRQAHGLNDTAIPILVGTKYDLFVDLDPDYQEQMSRTSMEYAQVMDAPLIFCSTAKSINVQKIFKVALAKIFSLTLTIQEINEVGDPLLIYKTLGTAKRDQDKTDNIKNSNTNVTTESRRKSPTYTQ'), Sequence(id='sequence6', source_id='AQZ18344.1', sequence='MEGSQETQGQQTMNVKVKNQVEVQIGLVGDAQVGKTSLMVKYVQNVFDEEYTQTLGVNFLKRKVSIRSTDIVFSIMDLGGQREFINMLPIASLGSSAMVFLFDLTRPDTLTSVKEWYRQAHGLNETAVPLLVGTKYDLFVDLDPAYQEQLSRTSMEYAQVMDAPLVFCSTAKSINVQKIFKIALAKIFHLTLTLPEINEIGDPLLIYSTLGNKRSRRAARG'), Sequence(id='sequence7', source_id='XP_002495560.1', sequence='MDNSDQEVQGHQHQQQQQPTNVKVKNQVEVQIGLVGDAQVGKTSLMVKYVQNVFDEEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINMLPIASLGSSALVFLFDLTRPETLTSIKEWYRQAHGLNEGAIPVLVGTKYDLFVDLDPVYQEQLSRASMEYAQVMDAPLIFCSTAKSINVQKIFKVALAKIFSLTLTVPEINEIGDPLLIYSAFGNKRSRGAAR'), Sequence(id='sequence8', source_id='XP_003673548.1', sequence='MPNSSPADHEPIPDVRNQVDLQIGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVKLHSTDIVFSLMDLGGQKEFINMLPIAAVGSSVIVFLFDLTRPETLNSIKDWYRQVKGLNDIAIPILVGTKYDLLINLSAEYQEQISTAAIDYANVMDAPLIFCSTAESINVQKIFKIALAKIFNLTLVVPEIRDIGDPLLLYKELGNNIQKVKQSKSPQRLS'), Sequence(id='sequence9', source_id='XP_003958955.1', sequence='MVASEEHEKHQQIPFVRNQVDIQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVNLRSTDIVFSLMDLGGQREFINMLPLAAVGSAAIIFLFDLTRPETLESVKEWYRQAYGLNNQAIPILVGTKYDLFIDLDEEYQRQVSKTALDYSEVMDAPLVFCSTAKSINIQKIFKIALAKIFSLTLTISEIKDTGDPILLYKRFGSKLSKNKSSPSSSTKLKTPRA'), Sequence(id='sequence10', source_id='XP_001644471.1', sequence='MQSSSIPKTRNQIEVQIGLVGDAQVGKTSLMVKYVQNIFNDEYTQTLGVNFLKRKVSVRSTDIVFSILDLGGQKEFINMLPIASIGSSAIIFLFDLTRPETLNSIKEWYRQANGLNDQAIPILVGTKYDLFIDLDQSTQEKISRIAMQYAQVMNAPLIFTSTAKSINVQKIFKIALSKIFNLTLTISEINEIGDPLLIYKTLGNRSTPIANASASSSASSPSAST'), Sequence(id='sequence11', source_id='XP_003684279.1', sequence='MPYRENRNASSAGGMMRSVPKSRNQVEIQVGLIGDAQVGKTSLMVKYVQNIFNEEYTQTLGVNFLKRTVSVRSTDIVFSLLDLGGQKEFINMLPIATVGSAAIVFLFDLTRPETLNSIKNWYRQANGLNEMAIPILVGTKYDLFINLDKEHQDSISRLSMEIAQVMDSPLVFCSTSKSINVQKIFKIALSKIFNLTLTIPEINEIGDPLLIYKTLGNNFNNNRSHNSSPIRTNNNNNSNNDTNSNNDGNSNTVNNNNYSALDNSNYPNPTASEHLNRIKNLHQCLRHAQLRCLRVV'), Sequence(id='sequence12', source_id='SMN18735.1', sequence='MPGSEPKRNLVPDVKNQVEIQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKINLRSTDIVFSLMDLGGQREFINMLPLASVGSSAIIFLFDLTRPETLDSVKEWYRQVYGLNNLAIPILVGTKYDLFIDMDKEYQKQISHTVLEYAQVMNAPIVFSSTAKSINIQKIFKIALSKIFNLTLTIPEITRTGDPLLIYRKFGNQNRNPTNVSASPVFSSQSSSISPPKSKGTTAS'), Sequence(id='sequence13', source_id='CAD1779387.1', sequence='MPGSESKRNIVPDVKNQVEIQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKINLRSTDIVFSLMDLGGQREFINMLPLASVGSSAIIFLFDLTRPETLDSVKEWYRQVYGLNNLAIPILVGTKYDLFIDMDKEYQKQISNTVLEYAQVMNAPIVFSSTAKSINIQKIFKIALSKIFNLTLTIPEITRTGDPLLIYRKFGNQNCKPTKVMTSPAFSSQTSSTSTSQVKAKETTAT'), Sequence(id='sequence14', source_id='KAG0666170.1', sequence='MPHSSSRRHQVPDVKNQVEIQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKINLRSTDIVFSLMDLGGQREFINMLPLASVGSSAIIFLFDLTRPETLDSVKEWYRQVYGLNNLAIPILVGTKYDLFIDMDKEYQKQISNTVLEYANVMNAPIIFSSTAKSINIQKIFKVALSKIFNLTLTIPEITRTGDPLLIYKKFGNQDRKSSKITTSSSQSSSSPASVSVSPRKSKSTITSS'), Sequence(id='sequence15', source_id='XP_022464898.1', sequence='MANVRSRHSSIPGIKNQIDVQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVNLRSTDIIFSIMDLGGQKEFINMLPLAAVGSSVIIFMFDLTRPKTLQSIKDWFRQAHGLNDSAVPILVGTKYDLSIETDERVPGNISCTAMRYAQVMNAPIVFCSTAKSIHIQKIFKIALAKIFNLTLTVPEIESIGDPLLIYRDFGNNVKRQSKSSPKRTGSMERTPVSSQQ'), Sequence(id='sequence16', source_id='XP_003669861.1', sequence='MSNSSSPEHEPIPAVRNQVDLQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNYLKRKVRLHSTDIIYSLMDLGGQREFINMLPIAAVGSSAIIFLFDLTRPETLNSIKDWYRQVNGLNDVAIPILVGTKYDLFIGLDSNYQNHISNSAIEYSKIMNSPLVFCSTAEGINIQKIFKIALAKIFNLTLVIPEITTVGDPLLIYKNLGNATNK'), Sequence(id='sequence17', source_id='XP_003678517.1', sequence='MASEHRARTSKDSEANLAQPEEIQIQVGLVGDAQVGKTSLMVKYAQNGFDEEYTQTLGVNLLKRKVRIKSSNIVFSLMDLGGQKEFINMLPIASVNSSVIIFLFDLTRPESLESIKNWYMQAHGLNHDAVCILVGTKYDLFIDLPTEYQEQISRTSMKYAQAMDSPLIFSSSIASINIQKIFKIALAKVFDLTLIIPEITQIGDPLLIYKHLGSFAGRKRNNK'), Sequence(id='sequence18', source_id='KAG0659075.1', sequence='MQQNTPTSINRHDPIPGVKNQIDIQIGLVGDAQVGKTSLMVKYVQNIFDNEYTQTLGVNFLKRKVKLRQTEIIFSLMDLGGQSEFINMLPLAAVGSSVIIFLFDLTRPVTLKSIKGWFRQAKGLNDLAIPILVGTKFDLFYTMDSQYQNEISKVAMEYSQVMDAPLIFCSTAKSIHIQKIFKIALAKLFNLTLTINEINLPGDPLLIYKDKGNNCINQSTNNNNNNTNLRRKSSHGHTSNNNNNNNTPIQASPIAVRSSYNHRHH'), Sequence(id='sequence19', source_id='XP_451758.1', sequence='MSLDKDRVPSLRHQVKVKVGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKVVLGSTDVIFSIMDLGGQREFINMLPLVSEGAVAIVFLFDLTRPETLNSIKEWYRQARGFNDTAISILVGTKYDLFVDMDPEYQENVSRTAMKYAQVMKSPLIFCSTQSSINVQKIFKVVIAKAFNLTLKVPEYKQIGEPLLIYKSFGPSRPSSPKRQVHTPPPSS'), Sequence(id='sequence20', source_id='NP_984991.1', sequence='MASENTIPQLKNEVKIKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKINLGSTDVIFSIMDLGGQREFINMLPLVSNRAVAIIFLFDLTRPETLTSIREWYRQARGFNETAIPLLVGTKYDLFVNLDVAYQEELSKTSMRYAQVMGAPLVFCSTASSINVQKIFKVIIAKAFNLTLRIPEIKDMGDPLLIYKSLGNAPQRVPSEYTHHGRYRQPEHIRNMAEQ'), Sequence(id='sequence21', source_id='XP_017989070.1', sequence='MVGESGIPQPKNEVKIKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKINLGSTDVIFSIMDLGGQREFINMLPLVSNRAVAIIFLFDLTRPETLTSIREWFRQARGFNDTAIPLLVGTKYDLFINLDASYQEEISKTSMRYAQAMGAPLVFCSTASSINVQKIFKVIIAKAFRLTLRIPEIRDIGDPLLIYKSLGNSVPKRDAAGTVMAASSGYSPTSATVEQGQYRQSERAQHTASEQ'), Sequence(id='sequence22', source_id='KAG0673910.1', sequence='MSTDKVPSLRHQVRVKVGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKVVLGSTDVIFSIMDLGGQREFINMLPLVSEGAVAIVFLFDLTRPETLNSIKEWYRQARGFNETAISILVGTKYDLFVEMDSKYQEEVSRTAMKYAQVMKSPLIFSSTQSSINVQKIFKVVIAKAFNITLKVPEYKQIGEPLLIYKSLGPTRPPSPNKRQVHTPPPSS'), Sequence(id='sequence23', source_id='SMN21971.1', sequence='MNSEKNKVSPREEIQLQIGIIGDAQVGKTSLMVKYVQDIYNKEYTQTLGVNFLKKRIRLRSTDITLSLMDLGGQREFINMLPLAAMDSYCIILLFDLTRPETLKSVKEWYRQAFGLNKNAIPILVGTKYDLFIEMDQDYQEEISRTCLKYAQIMDSPVIFSSSAYSINIQKLFKIIISKIFNLTLTLAEISDIGDPLLIYKEFGNTHLNGL'), Sequence(id='sequence24', source_id='KAG0661436.1', sequence='MNSTKLKSSKRPAKREEIQLQIGIIGDAQVGKTSLMVKYVQDIYNKEYTQTLGVNFLKKTIRLRSTDIVLSLMDLGGQKEFINMLPLAAMDSYCIILLFDLTRPETLKSVKEWYRQAFGLNKNAISVLVGTKYDIFIDMDEDYQEEISRTCIKYAQIMDSPVIFSSSAYSINIQKLFKIIVSKIFNLKLTIPEIRDIGDPLLIYEEFGNGHLNN'), Sequence(id='sequence25', source_id='SCV02624.1', sequence='MSTNEANVPTLPQPKNTFTIKVGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLDKKIKLGSADIVFYIMDLGGQREFINMLPLASEGARAIIFLFDLTRPETLKSIKEWHRQATGFNEMAVPLLVGTKYDLFVNFDPEYQVQVSKQSMRYAQAMDAPLIFCSTSHSINIQKIFKVIIAKLYNLTMRASEIKQIGDPLLIYKHLGSKRRFSENPSSRNSSSRTPSPHRSP'), Sequence(id='sequence26', source_id='SCV99388.1', sequence='MSLATSDTPVLPHPTNTFTIKVGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLDKKIRLGSADILFYIMDLGGQREFINMLPLASEGAKAIIFLFDLTRPETLKSIKEWHRQATGFNENAVPLLVGTKYDLFVNMDPEYQVQVSKQSMRYAQVMDAPLIFCSTSHSINVQRIFKIIIAKIYNLTMRASEIKQIGDPLLIYKYLGNSRRRSPSS'), Sequence(id='sequence27', source_id='CUS20182.1', sequence='MSMVSGGDTPLLPHPKNTFTLKIGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLSKKITLGSADILFYIMDLGGQREFINMLPLASEGAKAIIFLFDLTRPETLKSIKEWHRQATGFNEQAVPLLVGTKYDLFVNLDPDYQAQISKQSMRYAQAMDAPLIFCSTSHSINVQKIFKIVIAKLYNLTMRASEIKQIGDPLLIYKYLGSSRRPASGSSTSSGTS'), Sequence(id='sequence28', source_id='XP_045933944.1', sequence='MHFQQQQQQHYHTPLRHGSDPAQHITNNSEEHINNYGNNTVDTPQQLRHTSAMTVINSSQAATNNNYSDNNNNTSPVRGTTSTAETIPDELIPRTTFRLKVGLIGDAQVGKTSLMVKYVQSVFDEEYIQTLGVHHLEKRESLKYADILFVINDLGGQREFINMLPIVSEDAVAIVYLFDLTRPETLTSIKEWYRQAKGLNSKAIPLLIGTKYDLFIDMDPSYQEKMSRIGMLYAEAMNAPLIFSSTAESINVKIIFKIVVAKAFNLKLTVPEIKDLGDPILIYKNLGEKKKKN'), Sequence(id='sequence29', source_id='KAA8901327.1', sequence='MSTPSSPSGGGSKATAAEAARNSVSLKVGMIGDAQIGKTSLMVKYVEGTFDEDYIQTLGVNFMEKVVSIRNTDITFSIWDLGGQREFVNMLPLVSNDAVAILFMFDLTRKSTLNSVKEWYRQARGFNKTAIPFLVGTKFDMFVNLAEEDQEEITKQAKRFAKAMKASLIFCSTSHSINVQKIFKIVLSKAFDLKLTLPEITMTGEPLLIYQQW'), Sequence(id='sequence30', source_id='KAF8417303.1', sequence='MSDSSTIASGSGAGGSYHHQQASTSSAGSALQETPGRRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSVKEWYRQARGFNKTAIPFLVGTKFDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINIQKIFKIVLSKSFDLKCTIPEIEQVGEPLLLYQEV'), Sequence(id='sequence31', source_id='KAF3929277.1', sequence='MTTTPPTKRETSPVSPLRASFANLNTEDHSQATAAIRAQAGHTRHESLEKYTRRDSTASENRNEEGYRERGSISSQSGAAGAKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGLNKTAIPFLIGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGDPLLIYQDVELGNR'), Sequence(id='sequence32', source_id='OEJ86227.1', sequence='MTEYENGQQQQRERIRGQERESYDEQERESYDEQERERIREQERRINNEQQRRVNNEQQRRXNNQQRSTTNDNVSSNKNTHKDLDLQDNLIPRTTFKLKVGLVGDAQVGKTSLMVKYVQSVFDDEYIQTLGVHHLEKTEFLKYADILFVINDLGGQREFINMLPIVSEDAVAIVYMFDLTRPETLTSIKEWYRQAKGLNNKAISLLVGTKYDLFIEMDSEYQEKISKIATLYSZAMNAPLIFSSTSESINVKVIFKIIVAKSFNLKLTIKEIXEIGDPLLLYKNLGNKHRISH'), Sequence(id='sequence33', source_id='XP_046060918.1', sequence='MDKNTVTLKVGLVGDAQVGKTSLMVKYVENCFDEVYTQTLGVNYMERSINIKSTEITFSIWDLGGEAEFTNMLPLVASDAVAVLFMFDLSRKSTLSSIKDWYRQTRGFNRTAIPFLVGTKYDLFVDLSDAEQEEITRHAQKFARAMNAPLIFCSTSASINIQKIFKIVISKAFDLRLRIPEIENVGEPILIYHEHDRERERTSRRPTASHS'), Sequence(id='sequence34', source_id='EPS36031.1', sequence='MTTTPPTKRDASPVSPLRASFANLNTDDHTSATAAIRAAAGHTRHESLEKYTRRDSTASENRPEEGYRERGSISSQGGSAGAKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGLNKTAIPFLIGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGDPLLIYQDVELGNR'), Sequence(id='sequence35', source_id='KAI5807151.1', sequence='MHELPLAPSLPPPQSPPTPDRYSQGAARHYHSNSAASAPAMIGDAAGAYYRGSPPPPMPQQPYVPRDRSSESYHNGSSAQQQQQQYAMEQKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFTREEQEEVSKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQDV'), Sequence(id='sequence36', source_id='XP_011117899.1', sequence='MTTTPPTKRESSPVSPLRASFANLNADDHSSATAAIRAAAGHTRHESLEKYTRRDSTASENRNDESYRDRSSVSSQGGSGAKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGLNKTAIPFLIGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGDPLLIYQDVEAGNR'), Sequence(id='sequence37', source_id='KAI1438264.1', sequence='MEQDLHTTPGADLEPHGLPDDGSISSIEDTPEAASSLNGHETYHQHPQSLDYVVSSSQNTDETDPNAQYETVPATSQAQSISRPPSGLSGAGGDRQAAHSDRGSNGADHPSARNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSRDEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC'), Sequence(id='sequence38', source_id='XP_022456167.1', sequence='MSSQNSVSLKVGLVGDAQIGKTSLMVKYVEGCFNEDYTQTLGVNFMERSILIKNTQITFSIWDLGGEREFLNMLPLVSSDAVAILFMFDLTRKSTLNSIKEWYRQTRGFNKTAIPFLVGTKYDLFIDMPMEDQEEVTTQARKFAKAMNASLIFCSTSASINIQKIFKIVISKAFDLRLTIPEVTHIGEPILLYQGV'), Sequence(id='sequence39', source_id='KAF3908940.1', sequence='MTTTPPTKRDVSPVSPLRASFANLNTTDDGQSATAAIRASAGHTRHESLEKYTRRDSTASESRNEDGYRERSSISSQGGSGGNKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLVGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENTGDPLLIYQDVELGNR'), Sequence(id='sequence40', source_id='XP_006693239.1', sequence='MERDQLAAPAPSESAASDYRDHSLADAEVAPSSDCENNGFHDHHYSQSQHYDQDDAAESEPTARYNTPSGSGQQISRPPSGLSGERGAGYATDQGSRAGSNSASQEQQQQQSQQPPARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNLSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEITNVGEPLLIYKDV'), Sequence(id='sequence41', source_id='EWC45326.1', sequence='MATTPPTKRDTSPVSPLRASFANLNTTDDGQQSAAAAIRAAAGHTRHESLEKYTRRDSTASESRNDDGYRERSSISSQGGGAGGNKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLVGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGDPLLIYQDVETGNR'), Sequence(id='sequence42', source_id='KAF3930522.1', sequence='MTTTPPTKQGSRNVSPVSPLRASFANLNTTDENHSSATAAIRAAAGHTRHESLEKYTRRDSNASESKNEDGYRERSSVSSQGGSSQKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLIGTKYDHFVNLSKEDQEEISRQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENIGDPLLIYQDVESGNR'), Sequence(id='sequence43', source_id='KAF8249497.1', sequence='MQQHDDDALPQPQTTELPLAPSLPPPVALAHSPPTPRRRNSSPTRHYHSSSNASGAPPYIGSPGSVESAQYYNSQGSPPTPAAPHQQQQFATSRADGGYHNGGGYAQQQLEAKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQDV'), Sequence(id='sequence44', source_id='XP_002174495.1', sequence='MAEQTKNSVTIKLGMVGDSSIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAVPILIGTKYDYFVGLSREDQEEITKQARRYAKVMKASLVFCSTSHSINVQKIFKIVLAKVFDLKCTIPEITAVGEPILEYQSV'), Sequence(id='sequence45', source_id='PRP83484.1', sequence='MGDQNDTEARIGHSRLPFFIMSGDGEYTGSGKAGEGKKNSVVVKVGMVGDSQIGKTSLMVKYVEGTFDEDYIQTLGVNFMEKTISIKGTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLIGTKYDFFANLPAEEQEEITKQARKFAKAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLSCTIPEIIKVGEPILEYQNLS'), Sequence(id='sequence46', source_id='GAA97202.1', sequence='MASSTSTGAGSSSSRQRQESYRSSHSQQSSSQHAPAPAPQDDDRNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKSISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFSTLAESEQEDVTRQAKRFAKAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTLPEITETGEPLLLYQDI'), Sequence(id='sequence47', source_id='OBA26219.1', sequence='MESMLQSHNRRRHTNSMSISGSSNNNVHSELRQNNNNRISSMPSSQPASNSNNKPVDNIKLTEKDMNKYIDKDLVPKTTFKLKVGIIGDAQVGKTTLMCKYVNSAFDDEYIQTLGIHHLQKKETLKYSNILFTINDLGGQREFINMLPIVSEGAVAIIYLFDLTQPESLNSIKEWYRQAKGLNEKAISILVGTKYDLFLDLDPEYQTNISQIATLYSEAMNAPLIFASTAASINVKIIFKVIVAKAFGLDLAVPEITQIGDPLLIYKKLGNVIKQIKR'), Sequence(id='sequence48', source_id='KAI1823332.1', sequence='MEQDFHAVPAPDSEPHDHPDDGLGGLEESPDIAPGSNGHELYHQHPQSLDYVISNNQNIDDVDPNAPYEAVATTSQPQSISRPPSGLSGAGGDRQTAHSDRGSNGAEHPSARNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC'), Sequence(id='sequence49', source_id='CDO57487.1', sequence='MSIPSIYPNHKPTGMYTGQFISTLHPCANYPFFSRVSLKVGMIGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKAISIRNTEITFSIWDLGGQREFVNMLPLVSNDAVAILFMFDLTRKSTLNSVKEWYRQARGFNKTAIPFLVGTKFDLFANLPEEDQEEISTQSKRFAKAMKASLIFCSTSHSINVQKIFKIVLSKAFDLRLTLPEITNTGEPLMIYQQW'), Sequence(id='sequence50', source_id='KAI2629167.1', sequence='MDQDPMATPIPHDVHDDTLGGIEGSMHLPNEPHNHETHHRQSQSLDQGLANNAHPDEVDPNAQYEAHQYDQPSQSVPRPASSMSSTGGERQYSDQAARESNGADRNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence51', source_id='KAI5811198.1', sequence='MSNDPLPTIPSATSSTVDLSNGNDGSAQNENEPPHRSQHHTGMTSIHLNDPTSQSNAAASYSQTHSGATMLSSGSGATGSFQQAGGPSSGGPAGAQTQGQQALGGDYSRRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPKEDQEEISKQARKFARAMKASLIFSSTSHSINIQKIFKIVLSKSFDLKCTIPEIEQVGEPLLLYQDV'), Sequence(id='sequence52', source_id='KAG9017701.1', sequence='MSTAASGSGAPPATPLSAASADLGGDERNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISVRRTTITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSVKEWYRQARGFNKTAIPFLIGTKYDTFATFSRDEQEEITKQAKRFAKAMHAPLIFCSTSSSINVQKIFKIVLAKAFDLKCVIPEVHNVGEPLLIYMDQ'), Sequence(id='sequence53', source_id='OTA67948.1', sequence='MHFPGHLPDEPSSSSHEPHHRQSQSLDQGLANSAHPHPHPDDIDPNAQYEAQQYDPPQQSTQRPPSSMSSTGERQYTEQASRESNGADRNARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence54', source_id='KAH6626466.1', sequence='MEQEQQAMAPPLPITPTTGIASDAPLVPAAAAAQVPLPHSLSPPLQIDPHDDTLSSAGTVSHQALPDHNNFHEHNGYHDQPQHPIQFQPLDHSVNNSPRSYYPADQTDSEPTARYATPPVAAPAISRPSSGLSGQGAGYGADHVSRAGSNGAAAESSQAPGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNLSREEQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEITNVGEPLLIYQSC'), Sequence(id='sequence55', source_id='ORX96310.1', sequence='MEAEAQKKNSVVVKVGLVGDAQIGKTSLMVKYVEGAFDEDYIQTLGVNFMEKTIHIRNTEITFSLWDLGGQREFINMLPLVCNDAVAILFLFDLSRKSTLNSIKEWYRQARGFNKTAIPILVGTKYDQFAECPPEEQEEVTRQARKFSKAMRAPLIFCSTSHSINVQKIFKIVLSKAFDLRCTIPEISDVGAPILEYHID'), Sequence(id='sequence56', source_id='XP_028477951.1', sequence='MTDPGYASSGSGSGRVSGGEGGDRNAIVLKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKAITIRNTEITFSIWDLGGQREFVSMLPLVSNDAVAILFMFDLTRKATLNSVKEWYRQARGFNKTAIPVLIGTKYDKFAALSREEQEEITKQAKRFSKAMHAPLIFCSTSHSINVQKIFKIVLAKAFDLKCVIPEIDQVGEPILLYNDL'), Sequence(id='sequence57', source_id='XP_024666830.1', sequence='MSRDRVPVDLNDQQQQVTVKVGLIGDAQIGKTSLMVKYVNNTFDDDYIQTLGVNFLEKSVNIRNTQITFSIWDLGGQREFINMLPLVCNDAAALVFMFDLTRKSTLNSVRNWYRQARGFNRTAVPLLVGTKFDMFYEMSDQEQLEITEQAKKYAQAMKAPLVFCSTAMGINVQKLFKIVLAKTFDLKLTIPELAATGEPILIYQQW'), Sequence(id='sequence58', source_id='KAI0099584.1', sequence='MHIPGHLPGESSSSHEPHHRQSQSLDQGLANSAPPLPDDIDPNAQYEAHQYDPPQQPVQRPASSMSSTGERQYNEQASRESNGADRNARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence59', source_id='KAI1801530.1', sequence='MHIAGEPGVHEPHHRQSRSLDQGLANSAHADDIDTHAVDPHAIDPIAVDHNAQYEAHSYEPPAQSMSRPASSSGTGERHLNGEASREGNGADRNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence60', source_id='KAF9351078.1', sequence='MSDTPESTKKGSGNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKTTLNSIKEWYRQARGFNKTAIPFLVGTKYDYFAMFSKEEQEEVTKQARKFARAMKAPLIFCSTAQSINVQKIFKIVLSKAFDLKCTIPEISESGAPILEYQSY'), Sequence(id='sequence61', source_id='KAF9160900.1', sequence='MAATSESAKKSSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDYFSTFSKEEQEEVTKQARKFARAMKAPLIFCSTAHSINVQKIFKIVLSKAFDLKCTIPEISESGAPILEYATYCDRDRKKLTI'), Sequence(id='sequence62', source_id='KAG0263740.1', sequence='MAAAGDSGKKSSSPNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDYFSTFSKEEQEEVTKQARKFARAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTIPEISEAGAPILEYTDK'), Sequence(id='sequence63', source_id='KAI1135662.1', sequence='MEQDPVAAPVPHDIHEDTIGGIEGSMHIPAEPSTSHEPHRHRQSQSLDRGLASSKHPEDIDPNAQYDTPQYDPPQQSMPRPASSSSAGERHYAEQASRESNGADRNARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence64', source_id='XP_045969802.1', sequence='MTTTPPPLENNGSLPSHIDIDVAATPRQEHYTSSSDPSLAFSPQDSNSPSRANIGDDQRHSGTPPLSQSQLYGNGGGMNSFTSAAGAAAGGGQGAEAKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIEHVGEPLLLYQDVM'), Sequence(id='sequence65', source_id='KAI1414505.1', sequence='MHFSGEPSSSHEPLHRQSQSLDQGLANSAHPHPDDIDPNAQYEAHQYDPPQQSMQRPTSSMSSGGERHYTEQAPRESNGTDRNARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence66', source_id='KAG0239750.1', sequence='MATLGDSGKKSSNSSHNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKATLNSIKEWYRQARGFNKTAIPFLVGTKYDYFTMFSKEEQEEVTKQARKFARAMKAPLIFCSTAQSINVQKIFKIVLSKAFDLKCTIPEINEAGAPILEYQSY'), Sequence(id='sequence67', source_id='XP_044688071.1', sequence='MTTTPPPPENNGSLPSHIDVDVAATPRQEHYTSSDPSLTFSPQDSNSPSRAIGDERNSGTPPLSQSQLYGNGGGMNNFTSAAAAAGGQGAEAKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIEHVGEPLLLYQDVM'), Sequence(id='sequence68', source_id='RPB01516.1', sequence='MTTTPPLLFSPSPPPPLPDSLYPDEPEEVTTPTATLPPPPPSPPPRQPSPARHQHSGSAPATVGNFGSPPPNPPPPPQSLAYQQNGAGTTPTQAHYGGGGAVDMGKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIEHVGEPLLLYQDV'), Sequence(id='sequence69', source_id='KAG0236582.1', sequence='MAASADSARRSSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDFFSTFSKEEQEEITKQARKFARAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTIPEISEPGAPILEYTS'), Sequence(id='sequence70', source_id='KAH6640987.1', sequence='MEQDQAISPAYAVAPDSALAPARIPSPAGFPTDPHDDTLSGVESVTHQAVPDHHIHEHNGFHEQQHISQLQPLDHNVTNSPRSPYPTDTTDSEPTARYATPPIQAPTISRPPSGLSGQGAAYGADQVSRAGSNGAQAESSQSPGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNLSREEQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEITNVGEPLLIYQSC'), Sequence(id='sequence71', source_id='XP_002493958.1', sequence='MPDSPRRNQHRRSHSEQQNVPHSQRETNSVAVKIGLIGDAQIGKTSLMVKYVEGCYDENYTQTLGANFMERIINIRNTQITLSIWDLGGEKEFINMLPLVTTDAVVIIFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDLFIDLPDEDQIEITNQAKKYARAMSASLIFSSTSHSINIQKLFKVILSKVFDIKATIPEIVNTGEPLLLYQSI'), Sequence(id='sequence72', source_id='KAA8914877.1', sequence='MTTTPPPSRTSTSDMDHSARTPSSSSSSIPEEYIHTELRLAPSLSSLQSPPTPDRGSPSRYHHSHSNSATSAPSDGASYYGGSPPAMRDRDREGYYGNGAGAAGGSGGGAGSSAYNMAEQQRTKQNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQEV'), Sequence(id='sequence73', source_id='XP_018701974.1', sequence='METDDVPAATLHDNLDDTLGGLDGSPQVPSSSHYSNHHHDHQYQNPHHSNNDTHEHEPQSPGGGPSHHQQQHHDEDPPCTRYTPPAPGSSAPASAAPGSRAGSEMSNPSSSQQQHQAYGEYASSRQGSGEPAAPNGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPIQDQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence74', source_id='KAI2643608.1', sequence='MEHDLHGAPVSGLEPHAHHDDDSLNDADEHSDIASSLNGHESYHQPSQSLDYVLSHGQDTDEADPNSQYETQPTTSQPQSISRPPSGLSGAGGDRQTAHSDRGSNGADQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC'), Sequence(id='sequence75', source_id='KAG0125076.1', sequence='MTTTPPPLFSPSPPPPLPDSLCPDDPEEVTTPTSNLPPPPLPSPPPRQPSPVRHHHSGPAPAAVGNFGSPPPNPPPPPQSLAYQQNGAGTTPTQAHYGSGGAVDLGKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIEHVGEPLLLYQDV'), Sequence(id='sequence76', source_id='KAH9904989.1', sequence='MEQDPVAAAVPQDGYDDTLGGIEGSPHVGPTQINREKRHQQSQSLDNGLPNNGHADEIDPNARYDTPPNPLQPHSISRPPSGLSGAGDRHNAYSDHASRGSNGAEQNNGRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQARRFAKAMRAPLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC'), Sequence(id='sequence77', source_id='VEU24358.1', sequence='MDNRSVSTRIPRSHSTSEALSEEPARSVSSTVDGYDNYYGHQHHHAHRHRYGEEERQSAEKNTVTIKVGLIGDAQVGKTSLMVKYVENCFDEIYTQTLGVNFMERTIRIKNTEITFSIWDLGGEAEFTNMLPLVASDAVAVLFMFDLSRKSTLNSVKDWYRQARGFNRTAIPFLVGTKYDLFVDLPDEEQEEITRQARKYAKAMNAPLIFSSTCASINIQKIFKIVISKTFDLRLKIPEIVNTGEPILLYQNV'), Sequence(id='sequence78', source_id='KAI1283572.1', sequence='MDTMEQDFHAAPIPGPHEHLDEPLPDTFADVEGGPHVSPSQNGHEVYHHHHQQSQSLDHGLASSQNHDEADLNGRYETPPSTAHPQSISRPPSGLSGGDRQTAYSDRGSNGADQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC'), Sequence(id='sequence79', source_id='KAI1500557.1', sequence='MMEHDPAFATAPGPHNGIDDMLGGIEGSPTLASGQNGHETYHHHHSQSFDQEIPLNENPDDMDTTAQYDTPPVTAQPQSISRPPSALDGAAGERHASNGDRGSNGADYNNTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENIGEPLLLYQSC'), Sequence(id='sequence80', source_id='KAI2623093.1', sequence='MDQDPITTPVQAPAQDPTPHELHEDTFGGIEGSMHLSGEPGTPEAHHRQSQSLDQGLANSVHPDEVDPNTQYEAHQYDAPPQSMPRPASSMSGAGERQYPEHASRESNGADRNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence81', source_id='NP_593285.1', sequence='MADARKNNVTIKVGMIGDSSIGKTSLMVTYVQGSFDEESTQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPMVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAVPILIGTKYDHFMTFPREDQEEITKQARRYAKAMKASLVFCSTSHSINVQKIFKIVLAKVFDLKCTIPEIKNVGDPILEYIDR'), Sequence(id='sequence82', source_id='KAI0431960.1', sequence='MDTMEQDFHAAPIPGPHEHLDETLPDTLADVEGAPHVSPSQNGHEVYHHHQQSHSLDQGLANSQTSDEPDLNGRYETPPSTGHAQSISRPPSGLSGGDRQTAYSDRGSNGADQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC'), Sequence(id='sequence83', source_id='KAH8926511.1', sequence='MSDSAGPLALEKGGAEAGEKNSVVLKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLIGTKYDHFSNFSRDEQEEITRQSRRFARAMKAPLIFCSTSHSINVQKIFKIVLSKSFDLKCTIPEITDVGEPMLIYIDV'), Sequence(id='sequence84', source_id='RMJ24013.1', sequence='MNPSYHNGYSSDSHAQYSTGPAGFNPPVHDSTSQDAEQTRLTFSPSITQQPQPPSLSRPSSAFSSGPERHGASQQHHETSQRAQPAKNSVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLIGTKYDHFVNFPREDQEEISVQAKRFAKAMKASLIFSSTSHSINVQKIFKIVLAKAFDLKCTIPEIENVGEPLLLYKSV'), Sequence(id='sequence85', source_id='KAF8931046.1', sequence='MAATGESAKKSSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDYFSTFSKEEQEEVTKQARKFARAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTIPEISEAGAPILEYASN'), Sequence(id='sequence86', source_id='ODQ76250.1', sequence='MSSAAPNGSDGSVARKNAVVIKVGMIGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRDTEITFSIWDLGGQREFVNMLPLVSNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDTFAQFPREDQEEITKQARRFAKVMKASLIFCSTSHSINIQKIFKIVLSKAFELKCVIPEIATIGDPILLYHDV'), Sequence(id='sequence87', source_id='KXJ93426.1', sequence='MDQEPAALPPTRNPLDVAPDDTLGGIESSPRVYSDPESTIRTHHHSQSLDQGLASSAHYQHNSEDMDHQTRQDTPPIPQQPQSISRPPSGLSGAGDRQPAQYSDHASRSSGGQPEPQNGRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFPREDQEEISNQARRFAKAMRAPLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC'), Sequence(id='sequence88', source_id='XP_051368163.1', sequence='MDQDLLGTPTAPHDTLDDALAGVEGPLHLASESGNLEPHHRQSQSLDRGLANNAQVDDFDTAVPFDSPQYDTPPPAMQRPASSDSAAGEKQLAEHASREANGADRNNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence89', source_id='GES63634.1', sequence='METIHNLNTGVSEPVEQQPQESAFEASPVSHPAGSTDEPTSASVYHRSGYNSDSHAQYSSLATHQPQPPTSSRPSSGLSGPERYGPSQEVTQKQPSQPPSSQTKNSVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLVGTKYDHFVNFPREDQEEISIQAKRFAKAMKASLIFSSTSHSINVQKIFKIVLAKAFDLKCTIPEIENIGEPLLLYKNV'), Sequence(id='sequence90', source_id='RPA74746.1', sequence='MADHHEGSSHSYDRTSHSSRPATAEKQPAPKEETKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLIGTKYDHYVNFPIEDQEEISKQAKRFAKAMKASLIFSSTSHSINIQKIFKIVLSKAFDLKCTIPEITEIGEPLLLYQDV'), Sequence(id='sequence91', source_id='XP_024675402.1', sequence='MDTPQPSDPLAGVAPERHEQHPQPQSAPQQSQYPVNPAGPYPSHVESVPPEVIPSASTYHAGYSSDSHANYSSNAVDFNSGSEYPPQPRAELPRAQEAVPSMMHPPAAPSSSRPSSGLSSGPDRLGSVQSGQELPQKQPIPSNKNSVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLVGTKYDHFVNFPREDQEEISIQAKRFAKAMKASLIFSSTSHSINVQKIFKIVLAKAFDLKCTIPEIENIGEPLLLYKNL'), Sequence(id='sequence92', source_id='KAH6850716.1', sequence='MEQEQAFNPAYTMAPDPALAPAPIPAPISSPVGLPTDPHDDTLSGVESVTHQALPDHNIHDHNGFHEQQHLVQLQPLDHSVNNSPRSPYPTDTTDSEPTARYATPPIPAPTISRPPSGLSGQGAAYGADQVSRAGSNGAQAESSQSPGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNLSREEQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEITNVGEPLLIYQSC'), Sequence(id='sequence93', source_id='PHH71636.1', sequence='MEHQQPELDQQPPPLHAAHDSLDDTLGGIEGSPHVAAANNGFHQQSQSLDSAVPNSPRYDDDAANRHTPPVSSAPSLSRPGSQMSNPSSSNPPQQMHGNDHRQGSNEPPNGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPPQDQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQNV'), Sequence(id='sequence94', source_id='KAJ3562589.1', sequence='MDTMEQDLHTTPIPGVHEHHHLDDALPDPHADVDARPHSAPGQNGHEVYHQQSHSLDQGIAHGQHPDEADLNGRYDTPPSATHPQSISRPPSGLSGAGGDRQTTYSDRGSNGTDQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQQTV'), Sequence(id='sequence95', source_id='RDA84390.1', sequence='MDHQPAADQEQPQELPRPASHDGLDDTLGGIEGSPHPVASSNGFHAHQEAPGSPRYDDDNAARQTPPVSAPLSRPGSQMSNPPQHASGSDYRQGSNEPPNGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPPQDQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQNV'), Sequence(id='sequence96', source_id='XP_007413704.1', sequence='MSNMTSSTGPAGSSGSTSNSSLQQNDDKNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLIGTKYDHFAAFSKDEQEEITRQSRRFAKAMRAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTIPEINGSGEPLLIYLDV'), Sequence(id='sequence97', source_id='KAI0376630.1', sequence='MHLPNEPHNHETHHRQSQSLDQGLANNVHPDDVDPNAQYEAHQYDQPSQSVPRPASSMSSTGGERQYSDQAARESNGAADRNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV'), Sequence(id='sequence98', source_id='XP_047831721.1', sequence='MEQDFHTAPIPGPREHLDALPDTHDTHADVVARPHTAPDQNGHEVYHQQSQSLDQGLSDSQHHDDADVAGRYETHPSTTHPQSISRPPSGLSGAGGDRQATYSDRGSNGTDQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISSQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC'), Sequence(id='sequence99', source_id='KAI9294962.1', sequence='MAEEGKNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQHEFVNMLPLVCNDAVAILFMFDLSRKATLNSIKEWYRQARGFNKTAMPFLVGTKYDHFASFNREEQEEITKQARKFAKAMRAPLIFCSTSHSINVQKVFKVVLSKAFDLKCTIPEISDIGAPILEYEVGSE')], aligned_sequences=[Sequence(id='sequence100', source_id='BAH60832.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSA------------SE-----MR-----A---------ASERVGEERNSLPSVRNQVDIQVGLIGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVSIRSTDIVFSLMDLGGQREFINMLPIATLGSSVIILLFDLTRPETLNSIKEWYRQALGLNDSAIPILVGTKYNLFIDLEEEYQEKVSKTSMKYAQVMDAPLIFCSTAKSINIQKIFKVALAKIFDLTLTIPEINEIGDPLLIYKELGSKKNKSKNSSKPRRRSPVDN-ENKELV---------SQPHNYGHTSE---------------------------------'), Sequence(id='sequence101', source_id='CAI4663910.1', sequence='-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M---------A-TPSTGANNSIPAVRNQVEVQVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQADGLNDSAIPILVGTKYDLLIDLDPEYQEQISRTSMKYAQVMNAPLIFCSTAKSINIQKIFKIALAKIFNLTLTIPEINEIGDPLLIYKHLGGQQHRHHNKSQD--RKSHNIRKPSS-------------------SPSSKAPSPGVNT-----------------------'), Sequence(id='sequence102', source_id='EJT44931.1', sequence='-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M---------T-TPITGGSTSIPAVRNQVEVQVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQAYGLNDSAIPILVGTKYDLLIDLDPEYQEQISGTSMKYAQVMNAPLIFCSTAKSINIQKIFKIALAKIFNLTLTIPEINEIGDPLLIYKHLGSQQRRRQSKSQD--RKNHTVKKPSS-------------------SPSSKPPSPGVNI-----------------------'), Sequence(id='sequence103', source_id='XP_037139093.1', sequence='-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSSGGTDVQAQQELPKVKSRVDVQVGLVGDAQVGKTSLIVKYVQNVFDEEYTQTLGVNFLKRKVSIRSTDIVFSIMDLGGQREFINMLPIASLGSSAIVFLFDLTRPETLSSIKEWYRQAHGLNETAVPLLVGTKYDLFVDLDPEYQEQLSRTSMEYAQVMDAPLVFCSTAKSVNVQKIFKIALAKIFNLTLTIPEINEIGDPLLIYKSLGNHRARGEEISRRP--SPSARTSFS--------------------------------------------------------'), Sequence(id='sequence104', source_id='XP_003680887.1', sequence='-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSEAQEQQELPKAKNRVDVQVGLVGDAQVGKTSLMVKYVQNVFDEEYTQTLGVNFLKRKVSIRSTDIVFSLMDLGGQREFINMLPIASLGSSAIVFLFDLTRPETLSSIKEWYRQAHGLNETAVPLLVGTKYDLFVDLDPEYQEQLSRTSMEYAQVMDAPLIFCSTAKSINVQKIFKIALAKIFKLTLTVQEINDVGDPLLIYRHLGNQRHDSDEVSRRS--SPSTRSSTS--------------------------------------------------------'), Sequence(id='sequence105', source_id='XP_037144827.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------MSQEYR----T---------RSRSRSF------------SD-----QA-----AT-----QEEERPFVNLNMNVNMRPKNQVEVQIGLVGDAQVGKTSLMVKYVQNVFDEEYTQTLGVNFLKRKVSVRSTDIVFSLMDLGGQREFINMLPIASLGSSAIIFLFDLTRAETLSSIKEWFRQAHGLNDTAIPILVGTKYDLFVDLDPDYQEQMSRTSMEYAQVMDAPLIFCSTAKSINVQKIFKVALAKIFSLTLTIQEINEVGDPLLIYKTLGTAKRDQDKTDNIK--NSNTNVTTES-----------------------RRKSPTYTQ-----------------------'), Sequence(id='sequence106', source_id='AQZ18344.1', sequence='-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MEGSQETQGQQTMNVKVKNQVEVQIGLVGDAQVGKTSLMVKYVQNVFDEEYTQTLGVNFLKRKVSIRSTDIVFSIMDLGGQREFINMLPIASLGSSAMVFLFDLTRPDTLTSVKEWYRQAHGLNETAVPLLVGTKYDLFVDLDPAYQEQLSRTSMEYAQVMDAPLVFCSTAKSINVQKIFKIALAKIFHLTLTLPEINEIGDPLLIYSTLGNKRSRRAARG----------------------------------------------------------------------'), Sequence(id='sequence107', source_id='XP_002495560.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MDN------------SD-----QE-------------VQGHQHQQQQQPTNVKVKNQVEVQIGLVGDAQVGKTSLMVKYVQNVFDEEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINMLPIASLGSSALVFLFDLTRPETLTSIKEWYRQAHGLNEGAIPVLVGTKYDLFVDLDPVYQEQLSRASMEYAQVMDAPLIFCSTAKSINVQKIFKVALAKIFSLTLTVPEINEIGDPLLIYSAFGNKRSRGAAR-----------------------------------------------------------------------'), Sequence(id='sequence108', source_id='XP_003673548.1', sequence='---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MPNSSPADHEPIPDVRNQVDLQIGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVKLHSTDIVFSLMDLGGQKEFINMLPIAAVGSSVIVFLFDLTRPETLNSIKDWYRQVKGLNDIAIPILVGTKYDLLINLSAEYQEQISTAAIDYANVMDAPLIFCSTAESINVQKIFKIALAKIFNLTLVVPEIRDIGDPLLLYKELGNNIQKVKQSKSPQRLS----------------------------------------------------------------'), Sequence(id='sequence109', source_id='XP_003958955.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MVASEEHEKHQQIPFVRNQVDIQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVNLRSTDIVFSLMDLGGQREFINMLPLAAVGSAAIIFLFDLTRPETLESVKEWYRQAYGLNNQAIPILVGTKYDLFIDLDEEYQRQVSKTALDYSEVMDAPLVFCSTAKSINIQKIFKIALAKIFSLTLTISEIKDTGDPILLYKRFGSKLSKNKSSPSSSTKLK-TP-------RA---------------------------------------------------'), Sequence(id='sequence110', source_id='XP_001644471.1', sequence='---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MQSSSIPKTRNQIEVQIGLVGDAQVGKTSLMVKYVQNIFNDEYTQTLGVNFLKRKVSVRSTDIVFSILDLGGQKEFINMLPIASIGSSAIIFLFDLTRPETLNSIKEWYRQANGLNDQAIPILVGTKYDLFIDLDQSTQEKISRIAMQYAQVMNAPLIFTSTAKSINVQKIFKIALSKIFNLTLTISEINEIGDPLLIYKTLGNRSTPIANASAS--SSA-------S-------------------SPS-------AST-----------------------'), Sequence(id='sequence111', source_id='XP_003684279.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MPY------------RE-----NR-----N---------A-SSAGGMMRSVPKSRNQVEIQVGLIGDAQVGKTSLMVKYVQNIFNEEYTQTLGVNFLKRTVSVRSTDIVFSLLDLGGQKEFINMLPIATVGSAAIVFLFDLTRPETLNSIKNWYRQANGLNEMAIPILVGTKYDLFINLDKEHQDSISRLSMEIAQVMDSPLVFCSTSKSINVQKIFKIALSKIFNLTLTIPEINEIGDPLLIYKTLGNNFNNNRSHNSSPIRTNNNNNSNNDTNSNNDGNSNTVNNNNYSALDNSNYPNPTASEHLNRIKNLHQCLRHAQLRCLRVV'), Sequence(id='sequence112', source_id='SMN18735.1', sequence='----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MPGSEPKRNLVPDVKNQVEIQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKINLRSTDIVFSLMDLGGQREFINMLPLASVGSSAIIFLFDLTRPETLDSVKEWYRQVYGLNNLAIPILVGTKYDLFIDMDKEYQKQISHTVLEYAQVMNAPIVFSSTAKSINIQKIFKIALSKIFNLTLTIPEITRTGDPLLIYRKFGNQNRNPTNVSASPVFSSQSS---SISPPKSKGTTAS--------------------------------------------'), Sequence(id='sequence113', source_id='CAD1779387.1', sequence='----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MPGSESKRNIVPDVKNQVEIQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKINLRSTDIVFSLMDLGGQREFINMLPLASVGSSAIIFLFDLTRPETLDSVKEWYRQVYGLNNLAIPILVGTKYDLFIDMDKEYQKQISNTVLEYAQVMNAPIVFSSTAKSINIQKIFKIALSKIFNLTLTIPEITRTGDPLLIYRKFGNQNCKPTKVMTSPAFSSQTS---STSTSQVKAKETTAT------------------------------------------'), Sequence(id='sequence114', source_id='KAG0666170.1', sequence='----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MPHSSSRRHQVPDVKNQVEIQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKINLRSTDIVFSLMDLGGQREFINMLPLASVGSSAIIFLFDLTRPETLDSVKEWYRQVYGLNNLAIPILVGTKYDLFIDMDKEYQKQISNTVLEYANVMNAPIIFSSTAKSINIQKIFKVALSKIFNLTLTIPEITRTGDPLLIYKKFGNQDRKSSKITTSSSQSSSSPASVSVSPRKSKSTITSS-------------------------------------------'), Sequence(id='sequence115', source_id='XP_022464898.1', sequence='----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MANVRSRHSSIPGIKNQIDVQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVNLRSTDIIFSIMDLGGQKEFINMLPLAAVGSSVIIFMFDLTRPKTLQSIKDWFRQAHGLNDSAVPILVGTKYDLSIETDERVPGNISCTAMRYAQVMNAPIVFCSTAKSIHIQKIFKIALAKIFNLTLTVPEIESIGDPLLIYRDFGNNVKRQSKSSPKRTGSMERT-PVSSQQ-----------------------------------------------------'), Sequence(id='sequence116', source_id='XP_003669861.1', sequence='---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSNSSSPEHEPIPAVRNQVDLQVGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNYLKRKVRLHSTDIIYSLMDLGGQREFINMLPIAAVGSSAIIFLFDLTRPETLNSIKDWYRQVNGLNDVAIPILVGTKYDLFIGLDSNYQNHISNSAIEYSKIMNSPLVFCSTAEGINIQKIFKIALAKIFNLTLVIPEITTVGDPLLIYKNLGNATNK---------------------------------------------------------------------------'), Sequence(id='sequence117', source_id='XP_003678517.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------MA-------------------------------------SE----------------------HRARTSKDSEANLAQPEEIQIQVGLVGDAQVGKTSLMVKYAQNGFDEEYTQTLGVNLLKRKVRIKSSNIVFSLMDLGGQKEFINMLPIASVNSSVIIFLFDLTRPESLESIKNWYMQAHGLNHDAVCILVGTKYDLFIDLPTEYQEQISRTSMKYAQAMDSPLIFSSSIASINIQKIFKIALAKVFDLTLIIPEITQIGDPLLIYKHLGSFAGRKRNNK----------------------------------------------------------------------'), Sequence(id='sequence118', source_id='KAG0659075.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MQQNTPTSINRHDPIPGVKNQIDIQIGLVGDAQVGKTSLMVKYVQNIFDNEYTQTLGVNFLKRKVKLRQTEIIFSLMDLGGQSEFINMLPLAAVGSSVIIFLFDLTRPVTLKSIKGWFRQAKGLNDLAIPILVGTKFDLFYTMDSQYQNEISKVAMEYSQVMDAPLIFCSTAKSIHIQKIFKIALAKLFNLTLTINEINLPGDPLLIYKDKGNNCINQSTNNNNNNTNLRRKSS--------HG--HTSNNNNNNNTPIQASPIAVRSSYNHR----HH-------------'), Sequence(id='sequence119', source_id='XP_451758.1', sequence='-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSLDKDRVPSLRHQVKVKVGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKVVLGSTDVIFSIMDLGGQREFINMLPLVSEGAVAIVFLFDLTRPETLNSIKEWYRQARGFNDTAISILVGTKYDLFVDMDPEYQENVSRTAMKYAQVMKSPLIFCSTQSSINVQKIFKVVIAKAFNLTLKVPEYKQIGEPLLIYKSFGPSRPSSP-KRQVH-----TPPPSS--------------------------------------------------------'), Sequence(id='sequence120', source_id='NP_984991.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MASENTIPQLKNEVKIKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKINLGSTDVIFSIMDLGGQREFINMLPLVSNRAVAIIFLFDLTRPETLTSIREWYRQARGFNETAIPLLVGTKYDLFVNLDVAYQEELSKTSMRYAQVMGAPLVFCSTASSINVQKIFKVIIAKAFNLTLRIPEIKDMGDPLLIYKSLGNAPQRVPS--------------------E------YTHHGRYRQ--------PEHIRNMAE----------Q--------'), Sequence(id='sequence121', source_id='XP_017989070.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MVGESGIPQPKNEVKIKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKINLGSTDVIFSIMDLGGQREFINMLPLVSNRAVAIIFLFDLTRPETLTSIREWFRQARGFNDTAIPLLVGTKYDLFINLDASYQEEISKTSMRYAQAMGAPLVFCSTASSINVQKIFKVIIAKAFRLTLRIPEIRDIGDPLLIYKSLGNSVPKRDAAGTVM-----AASSGYSPTSA------TVEQGQYRQ--------SERAQHTAS----------EQ-------'), Sequence(id='sequence122', source_id='KAG0673910.1', sequence='---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSTDKVPSLRHQVRVKVGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKVVLGSTDVIFSIMDLGGQREFINMLPLVSEGAVAIVFLFDLTRPETLNSIKEWYRQARGFNETAISILVGTKYDLFVEMDSKYQEEVSRTAMKYAQVMKSPLIFSSTQSSINVQKIFKVVIAKAFNITLKVPEYKQIGEPLLIYKSLGPTRPPSPNKRQVH-----TPPPSS--------------------------------------------------------'), Sequence(id='sequence123', source_id='SMN21971.1', sequence='----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MNSE----KNKVSPREEIQLQIGIIGDAQVGKTSLMVKYVQDIYNKEYTQTLGVNFLKKRIRLRSTDITLSLMDLGGQREFINMLPLAAMDSYCIILLFDLTRPETLKSVKEWYRQAFGLNKNAIPILVGTKYDLFIEMDQDYQEEISRTCLKYAQIMDSPVIFSSSAYSINIQKLFKIIISKIFNLTLTLAEISDIGDPLLIYKEFGNTHLNGL-------------------------------------------------------------------------'), Sequence(id='sequence124', source_id='KAG0661436.1', sequence='----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MNSTKLKSSKRPAKREEIQLQIGIIGDAQVGKTSLMVKYVQDIYNKEYTQTLGVNFLKKTIRLRSTDIVLSLMDLGGQKEFINMLPLAAMDSYCIILLFDLTRPETLKSVKEWYRQAFGLNKNAISVLVGTKYDIFIDMDEDYQEEISRTCIKYAQIMDSPVIFSSSAYSINIQKLFKIIVSKIFNLKLTIPEIRDIGDPLLIYEEFGNGHLNN--------------------------------------------------------------------------'), Sequence(id='sequence125', source_id='SCV02624.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MST----NEANVPTLPQPKNTFTIKVGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLDKKIKLGSADIVFYIMDLGGQREFINMLPLASEGARAIIFLFDLTRPETLKSIKEWHRQATGFNEMAVPLLVGTKYDLFVNFDPEYQVQVSKQSMRYAQAMDAPLIFCSTSHSINIQKIFKVIIAKLYNLTMRASEIKQIGDPLLIYKHLGSKRRFSENPSSRNSSSR-TPSPHRSP------------------------------------------------------'), Sequence(id='sequence126', source_id='SCV99388.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSL----ATSDTPVLPHPTNTFTIKVGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLDKKIRLGSADILFYIMDLGGQREFINMLPLASEGAKAIIFLFDLTRPETLKSIKEWHRQATGFNENAVPLLVGTKYDLFVNMDPEYQVQVSKQSMRYAQVMDAPLIFCSTSHSINVQRIFKIIIAKIYNLTMRASEIKQIGDPLLIYKYLGNSRRRSPSS-----------------------------------------------------------------------'), Sequence(id='sequence127', source_id='CUS20182.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M-----SMV----SGGDTPLLPHPKNTFTLKIGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLSKKITLGSADILFYIMDLGGQREFINMLPLASEGAKAIIFLFDLTRPETLKSIKEWHRQATGFNEQAVPLLVGTKYDLFVNLDPDYQAQISKQSMRYAQAMDAPLIFCSTSHSINVQKIFKIVIAKLYNLTMRASEIKQIGDPLLIYKYLGSSRRPASGSSTSSGTS----------------------------------------------------------------'), Sequence(id='sequence128', source_id='XP_045933944.1', sequence='-------------------------------------MHFQQ----------------------------------------------------------------------QQQQHYHTPLRHGSDPAQ-HITNNSEEHINN--------YGNNTVDTPQQLRHTS---------AMTVINS---SQAATNNNYSDN---NNNT-SPVRG-----TTS----TAETIPDELIPRTTFRLKVGLIGDAQVGKTSLMVKYVQSVFDEEYIQTLGVHHLEKRESLKYADILFVINDLGGQREFINMLPIVSEDAVAIVYLFDLTRPETLTSIKEWYRQAKGLNSKAIPLLIGTKYDLFIDMDPSYQEKMSRIGMLYAEAMNAPLIFSSTAESINVKIIFKIVVAKAFNLKLTVPEIKDLGDPILIYKNLGEKKKKN--------------------------------------------------------------------------'), Sequence(id='sequence129', source_id='KAA8901327.1', sequence='---------------------------------------------------------------------------------------------------------------------------------------------------------------------MSTPS-----S------PSG-----------GG---------------------------SKATAAEAARNSVSLKVGMIGDAQIGKTSLMVKYVEGTFDEDYIQTLGVNFMEKVVSIRNTDITFSIWDLGGQREFVNMLPLVSNDAVAILFMFDLTRKSTLNSVKEWYRQARGFNKTAIPFLVGTKFDMFVNLAEEDQEEITKQAKRFAKAMKASLIFCSTSHSINVQKIFKIVLSKAFDLKLTLPEITMTGEPLLIYQQW---------------------------------------------------------------------------------'), Sequence(id='sequence130', source_id='KAF8417303.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------------MSD-SSTIA-------------SGSGAGGSYHHQQA------STS-------------SAGSALQETPGRRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSVKEWYRQARGFNKTAIPFLVGTKFDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINIQKIFKIVLSKSFDLKCTIPEIEQVGEPLLLYQEV---------------------------------------------------------------------------------'), Sequence(id='sequence131', source_id='KAF3929277.1', sequence='---------------------------------------MTTTPP-------------------------------TK------------RETSP----VSPLRASF--ANLN--------TEDHS---------QATAAIR---AQ---------------AGHTR-HESL--EKYTRR-DSTASE-NRNEEGY----------------------RERGSISSQSGAAG-AKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGLNKTAIPFLIGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGDPLLIYQDVELGNR----------------------------------------------------------------------------'), Sequence(id='sequence132', source_id='OEJ86227.1', sequence='------------------------------------MTEYEN----------------------------------------------G----QQQQ---------RERIRGQERESYDEQERESYDEQERERIREQERRINN--------EQQRRVNNEQQ--------------------------RRXNNQQRST---TNDN-VSSNK-----NTH----KDLDLQDNLIPRTTFKLKVGLVGDAQVGKTSLMVKYVQSVFDDEYIQTLGVHHLEKTEFLKYADILFVINDLGGQREFINMLPIVSEDAVAIVYMFDLTRPETLTSIKEWYRQAKGLNNKAISLLVGTKYDLFIEMDSEYQEKISKIATLYSZAMNAPLIFSSTSESINVKVIFKIIVAKSFNLKLTIKEIXEIGDPLLLYKNLGNKHRISH-------------------------------------------------------------------------'), Sequence(id='sequence133', source_id='XP_046060918.1', sequence='----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MDKNTVTLKVGLVGDAQVGKTSLMVKYVENCFDEVYTQTLGVNYMERSINIKSTEITFSIWDLGGEAEFTNMLPLVASDAVAVLFMFDLSRKSTLSSIKDWYRQTRGFNRTAIPFLVGTKYDLFVDLSDAEQEEITRHAQKFARAMNAPLIFCSTSASINIQKIFKIVISKAFDLRLRIPEIENVGEPILIYHEHDRERERTSRRPTASHS-----------------------------------------------------------------'), Sequence(id='sequence134', source_id='EPS36031.1', sequence='---------------------------------------MTTTPP-------------------------------TK------------RDASP----VSPLRASF--ANLN--------TDDHT---------SATAAIR---AA---------------AGHTR-HESL--EKYTRR-DSTASE-NRPEEGY----------------------RERGSISSQGGSAG-AKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGLNKTAIPFLIGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGDPLLIYQDVELGNR----------------------------------------------------------------------------'), Sequence(id='sequence135', source_id='KAI5807151.1', sequence='--------------------------------------------------------------------------MHELPLAPSLPPPQ----SPPTPDR----------YSQGAARHY---HSNSAAS-A-----PAMIG-----------DA-------AGAYYRGSPPPPMPQQPYVP-R----D-RS-SESYHNGSS--------------------AQQ-QQQQYAMEQKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFTREEQEEVSKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQDV---------------------------------------------------------------------------------'), Sequence(id='sequence136', source_id='XP_011117899.1', sequence='---------------------------------------MTTTPP-------------------------------TK------------RESSP----VSPLRASF--ANLN--------ADDHS---------SATAAIR---AA---------------AGHTR-HESL--EKYTRR-DSTASE-NRNDESY----------------------RDRSSVSSQG-GSG-AKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGLNKTAIPFLIGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGDPLLIYQDVEAGNR----------------------------------------------------------------------------'), Sequence(id='sequence137', source_id='KAI1438264.1', sequence='---------------------------------------MEQDLHTTPGADLE----------P--HGLPDD---GSI---------SSIEDTPEA--------AS--SLNGHETYHQ---HPQSLDYVV-----SSS---------------QNTDETDPNAQYET-VPATSQAQSISR-PPSGLSGAGGDRQAA------------------------HSDRGSNGADHPSARNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSRDEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence138', source_id='XP_022456167.1', sequence='---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSSQNSVSLKVGLVGDAQIGKTSLMVKYVEGCFNEDYTQTLGVNFMERSILIKNTQITFSIWDLGGEREFLNMLPLVSSDAVAILFMFDLTRKSTLNSIKEWYRQTRGFNKTAIPFLVGTKYDLFIDMPMEDQEEVTTQARKFAKAMNASLIFCSTSASINIQKIFKIVISKAFDLRLTIPEVTHIGEPILLYQGV---------------------------------------------------------------------------------'), Sequence(id='sequence139', source_id='KAF3908940.1', sequence='---------------------------------------MTTTPP-------------------------------TK------------RDVSP----VSPLRASF--ANLN--------TTDDGQS--------ATAAIR---AS---------------AGHTR-HESL--EKYTRR-DSTASE-SRNEDGY----------------------RERSSISSQG-GSGGNKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLVGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENTGDPLLIYQDVELGNR----------------------------------------------------------------------------'), Sequence(id='sequence140', source_id='XP_006693239.1', sequence='---------------------------------------MERDQLAAPAPSE------------------S-----AA---------SDYRDHSLADAEVAPSSDCE--NNGFHDHHY--SQSQHYDQ-------DDAAESE---PT---------------ARYNT-PSGS--GQQISR-PPSGLS-GERGAGYATDQGSRAG------------SNSASQEQQQQQSQQPPARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNLSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEITNVGEPLLIYKDV---------------------------------------------------------------------------------'), Sequence(id='sequence141', source_id='EWC45326.1', sequence='---------------------------------------MATTPP-------------------------------TK------------RDTSP----VSPLRASF--ANLN--------TTDDGQQ-------SAAAAIR---AA---------------AGHTR-HESL--EKYTRR-DSTASE-SRNDDGY----------------------RERSSISSQGGGAGGNKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLVGTKYDHFVNLSKEDQEEISKQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGDPLLIYQDVETGNR----------------------------------------------------------------------------'), Sequence(id='sequence142', source_id='KAF3930522.1', sequence='---------------------------------------MTTTPP-------------------------------TK---------QGSRNVSP----VSPLRASF--ANLN--------TTDENHS-------SATAAIR---AA---------------AGHTR-HESL--EKYTRR-DSNASE-SKNEDGY----------------------RERSSVSSQGGS--SQKKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLIGTKYDHFVNLSKEDQEEISRQAKRFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENIGDPLLIYQDVESGNR----------------------------------------------------------------------------'), Sequence(id='sequence143', source_id='KAF8249497.1', sequence='-----------------------------------------------------MQ------Q-HDDDALPQP-QTTELPLAPSLPPPVALAHSPPTPRR----------RNSSPTRHY---HSSSNASGA-----PPYIG-----------SP---GSVESAQYYNSQGSPPTPAAPHQQ-QQFATS-RA-DGGYHNGGG-------------------------YAQQQLEAKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQDV---------------------------------------------------------------------------------'), Sequence(id='sequence144', source_id='XP_002174495.1', sequence='-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MAEQTKNSVTIKLGMVGDSSIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAVPILIGTKYDYFVGLSREDQEEITKQARRYAKVMKASLVFCSTSHSINVQKIFKIVLAKVFDLKCTIPEITAVGEPILEYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence145', source_id='PRP83484.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------MG-----------DQ---NDTE-------------ARIGHSR-LPFFIM-SG-DGEYTG-----------------------------SGKAGEGKKNSVVVKVGMVGDSQIGKTSLMVKYVEGTFDEDYIQTLGVNFMEKTISIKGTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLIGTKYDFFANLPAEEQEEITKQARKFAKAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLSCTIPEIIKVGEPILEYQNLS--------------------------------------------------------------------------------'), Sequence(id='sequence146', source_id='GAA97202.1', sequence='-------------------------------------------------------------------------------------------------------------------------MASSTSTG---------AG-----------SS---SSRQRQESYRSS--------------------------HSQQSS--------------------SQH-APAPAPQDDDRNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKSISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFSTLAESEQEDVTRQAKRFAKAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTLPEITETGEPLLLYQDI---------------------------------------------------------------------------------'), Sequence(id='sequence147', source_id='OBA26219.1', sequence='------------------------------------MESML-------------------------------------------------------------------------------------QSHNRRR-HTNSMSISG--------SSNNNVHSELRQNNNN---------RISSMPS---SQPASN----------SNN-KPVDN-----IKLTEKDMNKYIDKDLVPKTTFKLKVGIIGDAQVGKTTLMCKYVNSAFDDEYIQTLGIHHLQKKETLKYSNILFTINDLGGQREFINMLPIVSEGAVAIIYLFDLTQPESLNSIKEWYRQAKGLNEKAISILVGTKYDLFLDLDPEYQTNISQIATLYSEAMNAPLIFASTAASINVKIIFKVIVAKAFGLDLAVPEITQIGDPLLIYKKLGNVIKQIKR------------------------------------------------------------------------'), Sequence(id='sequence148', source_id='KAI1823332.1', sequence='---------------------------------------MEQDFHAVPAPDSE----------P--HDHPDD---G-L---------GGLEESPDI--------AP--GSNGHELYHQ---HPQSLDYVI-----SNN---------------QNIDDVDPNAPYEA-VATTSQPQSISR-PPSGLSGAGGDRQTA------------------------HSDRGSNGAEHPSARNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence149', source_id='CDO57487.1', sequence='---------------------------------------------------------------------------------------------------------------------------------------------------------------------MSIPS-----IYPNH-KPTGM--------YTGQ-----------------------FISTLHPCANYPFFSRVSLKVGMIGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKAISIRNTEITFSIWDLGGQREFVNMLPLVSNDAVAILFMFDLTRKSTLNSVKEWYRQARGFNKTAIPFLVGTKFDLFANLPEEDQEEISTQSKRFAKAMKASLIFCSTSHSINVQKIFKIVLSKAFDLRLTLPEITNTGEPLMIYQQW---------------------------------------------------------------------------------'), Sequence(id='sequence150', source_id='KAI2629167.1', sequence='---------------------------------------MDQD--------PM----------A--TPIPHDVHDDTL---------GGIEGSMHLP---------NEPHN--HETHH--RQSQSLDQGL-----ANNA---------------HPDEVDPNAQYEA-HQYDQPSQSVPR-PASSMSSTGGERQY---------------------SDQ--AARESNGA-DRNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence151', source_id='KAI5811198.1', sequence='---------------------------------------MSNDPL----PTIP----------SA-TSSTVD----LS---------NG--NDGSA---QNE---N---EPPHRSQHH--TGM------------TSIHL-----NDPTSQSNAA---ASYSQTHSG-ATMLS-------------SGSGATGSFQQAGG------PSSGGP-----AGAQTQGQQALGGDYSRRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPKEDQEEISKQARKFARAMKASLIFSSTSHSINIQKIFKIVLSKSFDLKCTIPEIEQVGEPLLLYQDV---------------------------------------------------------------------------------'), Sequence(id='sequence152', source_id='KAG9017701.1', sequence='------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSTAASGSGAPPAT--------------------PLS-AASADLGGDERNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISVRRTTITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSVKEWYRQARGFNKTAIPFLIGTKYDTFATFSRDEQEEITKQAKRFAKAMHAPLIFCSTSSSINVQKIFKIVLAKAFDLKCVIPEVHNVGEPLLIYMDQ---------------------------------------------------------------------------------'), Sequence(id='sequence153', source_id='OTA67948.1', sequence='-----------------------------------------------------------------------------------------MHFPGHLP---------DEPSSSSHEPHH--RQSQSLDQGL-----ANSAHP-----------HPHPDDIDPNAQYEA-QQYDPPQQSTQR-PPSSMSS-TGERQY---------------------TEQ--ASRESNGA-DRNARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence154', source_id='KAH6626466.1', sequence='MEQEQQAMAPPLPITPTTGIASDAPLVP---A-----------AAAAQVPLPH----------SLSPPLQIDPHDDTL---------SSAGTVSHQ---ALPDHNNFHEHNGYHD------QPQHPIQFQ-----PLDHSVN---NSPRSYYPADQTDSEPTARYAT-PPVA--APAISR-PSSGLSGQGAGYGAD--HVSRAG-----------------SNGAAAESSQAPGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNLSREEQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEITNVGEPLLIYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence155', source_id='ORX96310.1', sequence='-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MEAEAQKKNSVVVKVGLVGDAQIGKTSLMVKYVEGAFDEDYIQTLGVNFMEKTIHIRNTEITFSLWDLGGQREFINMLPLVCNDAVAILFLFDLSRKSTLNSIKEWYRQARGFNKTAIPILVGTKYDQFAECPPEEQEEVTRQARKFSKAMRAPLIFCSTSHSINVQKIFKIVLSKAFDLRCTIPEISDVGAPILEYHID---------------------------------------------------------------------------------'), Sequence(id='sequence156', source_id='XP_028477951.1', sequence='---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MTD-P--------------------------------GYASSG-SGSGRVSGGEGGDRNAIVLKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKAITIRNTEITFSIWDLGGQREFVSMLPLVSNDAVAILFMFDLTRKATLNSVKEWYRQARGFNKTAIPVLIGTKYDKFAALSREEQEEITKQAKRFSKAMHAPLIFCSTSHSINVQKIFKIVLAKAFDLKCVIPEIDQVGEPILLYNDL---------------------------------------------------------------------------------'), Sequence(id='sequence157', source_id='XP_024666830.1', sequence='-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSRDRVPVDLNDQQQQVTVKVGLIGDAQIGKTSLMVKYVNNTFDDDYIQTLGVNFLEKSVNIRNTQITFSIWDLGGQREFINMLPLVCNDAAALVFMFDLTRKSTLNSVRNWYRQARGFNRTAVPLLVGTKFDMFYEMSDQEQLEITEQAKKYAQAMKAPLVFCSTAMGINVQKLFKIVLAKTFDLKLTIPELAATGEPILIYQQW---------------------------------------------------------------------------------'), Sequence(id='sequence158', source_id='KAI0099584.1', sequence='-----------------------------------------------------------------------------------------MHIPGHLP---------GES-SSSHEPHH--RQSQSLDQGL-----ANSAP-------------PLPDDIDPNAQYEA-HQYDPPQQPVQR-PASSMSS-TGERQY---------------------NEQ--ASRESNGA-DRNARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence159', source_id='KAI1801530.1', sequence='---------------------------------------------------------------------------------------------MHIA---------GEPGV--HEPHH--RQSRSLDQGL-----ANSAHADDIDTHAVDPHAIDPIAVDHNAQYEA-HSYEPPAQSMSR-PASS--SGTGERHL---------------------NGE--ASREGNGA-DRNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence160', source_id='KAF9351078.1', sequence='-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSD-------------------------TPESTKKGSGNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKTTLNSIKEWYRQARGFNKTAIPFLVGTKYDYFAMFSKEEQEEVTKQARKFARAMKAPLIFCSTAQSINVQKIFKIVLSKAFDLKCTIPEISESGAPILEYQSY---------------------------------------------------------------------------------'), Sequence(id='sequence161', source_id='KAF9160900.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MAATS-----------------------------ES--AKKSSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDYFSTFSKEEQEEVTKQARKFARAMKAPLIFCSTAHSINVQKIFKIVLSKAFDLKCTIPEISESGAPILEYATYCDRDRKKLTI-----------------------------------------------------------------------'), Sequence(id='sequence162', source_id='KAG0263740.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MAAAGD-------------------------SGKKS--SSPNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDYFSTFSKEEQEEVTKQARKFARAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTIPEISEAGAPILEYTDK---------------------------------------------------------------------------------'), Sequence(id='sequence163', source_id='KAI1135662.1', sequence='-----------------------------------------------MEQDPV----------A--APVPHDIHEDTI---------GGIEGSMHIP---------AEPSTSHEPHRH--RQSQSLDRGL-----ASSK---------------HPEDIDPNAQYDT-PQYDPPQQSMPR-PASS-SS-AGERHY---------------------AEQ--ASRESNGA-DRNARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence164', source_id='XP_045969802.1', sequence='---------------------------------------MTTTPP----PLEN----------NGSLPSHID----ID---------VA---------------------ATPRQEHY--TSSSD----------PSLAFSP---QDSNSPSRAN---IGDDQRHSG-TPPLSQSQLY--------GNGGGMNSFTSAAG------AA----------------AGGGQGAEAKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIEHVGEPLLLYQDVM--------------------------------------------------------------------------------'), Sequence(id='sequence165', source_id='KAI1414505.1', sequence='-----------------------------------------------------------------------------------------MHFSGE--------------PSSSHEPLH--RQSQSLDQGL-----ANSAHP-------------HPDDIDPNAQYEA-HQYDPPQQSMQR-PTSSMSS-GGERHY---------------------TEQ--APRESNGT-DRNARNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence166', source_id='KAG0239750.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MATLGD-------------------------SGKKSSNSSHNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKATLNSIKEWYRQARGFNKTAIPFLVGTKYDYFTMFSKEEQEEVTKQARKFARAMKAPLIFCSTAQSINVQKIFKIVLSKAFDLKCTIPEINEAGAPILEYQSY---------------------------------------------------------------------------------'), Sequence(id='sequence167', source_id='XP_044688071.1', sequence='---------------------------------------MTTTPP----PPEN----------NGSLPSHID----VD---------VA---------------------ATPRQEHY--TS-SD----------PSLTFSP---QDSNSPSRAI-----GDERNSG-TPPLSQSQLY--------GNGGGMNNFTSAAA------------------------AAGGQGAEAKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIEHVGEPLLLYQDVM--------------------------------------------------------------------------------'), Sequence(id='sequence168', source_id='RPB01516.1', sequence='---------------------------------------MTTTPPLLFSPSP-------PPP-LPDSLYPDEPEEVTTPTA-TLPPPP------PSPPP----------RQPSPARHQ---HSGSAPA---------TVG-----------NF---GSPP------PNPPPPPQSLAYQQ-N--GAGTTPTQAHYGG-----------------------------GGAVDMGKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIEHVGEPLLLYQDV---------------------------------------------------------------------------------'), Sequence(id='sequence169', source_id='KAG0236582.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MAA-----------------------------SADS--ARRSSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDFFSTFSKEEQEEITKQARKFARAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTIPEISEPGAPILEYTS----------------------------------------------------------------------------------'), Sequence(id='sequence170', source_id='KAH6640987.1', sequence='MEQD-QAIS------PAYAVAPDSALA------------------PARIP--------------SPAGFPTDPHDDTL---------SGVESVTHQ---AVPDHH-IHEHNGFHE------Q-QHISQLQ-----PLDHNVT---NSPRSPYPTDTTDSEPTARYAT-PPIQ--APTISR-PPSGLSGQGAAYGAD--QVSRAG-----------------SNGAQAESSQSPGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNLSREEQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEITNVGEPLLIYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence171', source_id='XP_002493958.1', sequence='-----------------------------------------------------------------------------------------------------------------------------------------------------------------------MPDSPR-------------------RNQHRRS----------------------HSEQQNVPHSQRETNSVAVKIGLIGDAQIGKTSLMVKYVEGCYDENYTQTLGANFMERIINIRNTQITLSIWDLGGEKEFINMLPLVTTDAVVIIFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDLFIDLPDEDQIEITNQAKKYARAMSASLIFSSTSHSINIQKLFKVILSKVFDIKATIPEIVNTGEPLLLYQSI---------------------------------------------------------------------------------'), Sequence(id='sequence172', source_id='KAA8914877.1', sequence='---------------------------------------MTTTPPPSRTSTSDMDHSARTPS-SSSSSIPEEYIHTELRLAPS----LSSLQSPPTPDR----------GSPSRYHHS---HSNSATSAP----------------------------SDGASYYGGSPPA-MRDRD-RE-GYYGNGAGA-AGGSGGGAG--------------------SSA-YNMAEQQRTKQNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQEV---------------------------------------------------------------------------------'), Sequence(id='sequence173', source_id='XP_018701974.1', sequence='---------------------------------------METDDV--PAATLH----------D-----NLD----DT---------LG----GLDGSPQVPSSSHY--SNHHHDHQY--QNPHHSNN-------DTHEHEP---QSPG-GGPSH---HQ-QQHHDE-DPPC--TRY-TP-PAPGSS-APASAAPGSRAGSEMSNPSSSQQQHQAYGEYASSRQGSGEPAAPNGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPIQDQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence174', source_id='KAI2643608.1', sequence='---------------------------------------MEHDLHGAPVSGLE----------P--HAHHDD---DSL---------NDADEHSDI--------AS--SLNGHESYHQ---PSQSLDYVL-----SHG---------------QDTDEADPNSQYET-QPTTSQPQSISR-PPSGLSGAGGDRQTA------------------------HSDRGSNGADQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence175', source_id='KAG0125076.1', sequence='---------------------------------------MTTTPPPLFSPSP-------PPP-LPDSLCPDDPEEVTTPTS-NLPPPP-----LPSPPP----------RQPSPVRHH---HSGPAPA---------AVG-----------NF---GSPP------PNPPPPPQSLAYQQ-N--GAGTTPTQAHYGS-----------------------------GGAVDLGKRNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFVNFPREDQEEISKQARKFARAMKASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIEHVGEPLLLYQDV---------------------------------------------------------------------------------'), Sequence(id='sequence176', source_id='KAH9904989.1', sequence='---------------------------------------MEQDPV--------------------AAAVPQDGYDDTLG---------GIEGSPHVGPT----------QINREKRHQ---QSQSLDNGL-----P-NNG-----------HA---DEIDPNARYDTPPN-PLQPHSISR-PPSGLS-GAGDRHNAYSDH--------------------ASR-GSNGAEQNNGRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQARRFAKAMRAPLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence177', source_id='VEU24358.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------MDNRSVSTRIPRSHSTSEALSEEPARSVSSTV--DGYDNYY-----------GHQH---HHAHRHRYGEEERQSAEKNTVTIKVGLIGDAQVGKTSLMVKYVENCFDEIYTQTLGVNFMERTIRIKNTEITFSIWDLGGEAEFTNMLPLVASDAVAVLFMFDLSRKSTLNSVKDWYRQARGFNRTAIPFLVGTKYDLFVDLPDEEQEEITRQARKYAKAMNAPLIFSSTCASINIQKIFKIVISKTFDLRLKIPEIVNTGEPILLYQNV---------------------------------------------------------------------------------'), Sequence(id='sequence178', source_id='KAI1283572.1', sequence='------------------------------------MDTMEQDFHAAPIPGPH----------E--HLD--EPLPDTF---------ADVEGGPHV--------SP--SQNGHEVYHHHHQQSQSLDHGL-----ASS---------------QNHDEADLNGRYET-PPSTAHPQSISR-PPSGLS--GGDRQTA------------------------YSDRGSNGADQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence179', source_id='KAI1500557.1', sequence='--------------------------------------MMEHDPAFATAPGPH----------N-----GIDD--------------------MLGGIEGSPTLASG--QNGHETYHH--HHSQSFDQ-------E----IP---LN---ENPDD---MDTTAQYDT-PPVTAQPQSISR-PPSALD-GAAGER-----------------------HASNGDRGSNGADYNNTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENIGEPLLLYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence180', source_id='KAI2623093.1', sequence='---------------------------------------MDQDPITTPVQAPA----------Q--DPTPHELHEDTF---------GGIEGSMHLS---------GEPGT--PEAHH--RQSQSLDQGL-----ANSV---------------HPDEVDPNTQYEA-HQYDAPPQSMPR-PASSMSG-AGERQY---------------------PEH--ASRESNGA-DRNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence181', source_id='NP_593285.1', sequence='-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MADARKNNVTIKVGMIGDSSIGKTSLMVTYVQGSFDEESTQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPMVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAVPILIGTKYDHFMTFPREDQEEITKQARRYAKAMKASLVFCSTSHSINVQKIFKIVLAKVFDLKCTIPEIKNVGDPILEYIDR---------------------------------------------------------------------------------'), Sequence(id='sequence182', source_id='KAI0431960.1', sequence='------------------------------------MDTMEQDFHAAPIPGPH----------E--HLD--ETLPDTL---------ADVEGAPHV--------SP--SQNGHEVYHHH-QQSHSLDQGL-----ANS---------------QTSDEPDLNGRYET-PPSTGHAQSISR-PPSGLS--GGDRQTA------------------------YSDRGSNGADQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence183', source_id='KAH8926511.1', sequence='-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSDSAGP-----LALE-----KGGAEAGEKNSVVLKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLIGTKYDHFSNFSRDEQEEITRQSRRFARAMKAPLIFCSTSHSINVQKIFKIVLSKSFDLKCTIPEITDVGEPMLIYIDV---------------------------------------------------------------------------------'), Sequence(id='sequence184', source_id='RMJ24013.1', sequence='-----------------------------------------MNPS-------------------------------YH---------NGYSSDSHA--QYSTGPAGF--NPPVHDS-----TSQDAEQ-------TRLTFSP---SI---------------TQQPQ-PPSL---SRPS---SAFSS-GPERHG-------------------------ASQQHHETSQRAQPAKNSVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLIGTKYDHFVNFPREDQEEISVQAKRFAKAMKASLIFSSTSHSINVQKIFKIVLAKAFDLKCTIPEIENVGEPLLLYKSV---------------------------------------------------------------------------------'), Sequence(id='sequence185', source_id='KAF8931046.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MAATG-----------------------------ES--AKKSSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYVQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDYFSTFSKEEQEEVTKQARKFARAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTIPEISEAGAPILEYASN---------------------------------------------------------------------------------'), Sequence(id='sequence186', source_id='ODQ76250.1', sequence='-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSS------AA----------------PNGSDGSVARKNAVVIKVGMIGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRDTEITFSIWDLGGQREFVNMLPLVSNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDTFAQFPREDQEEITKQARRFAKVMKASLIFCSTSHSINIQKIFKIVLSKAFELKCVIPEIATIGDPILLYHDV---------------------------------------------------------------------------------'), Sequence(id='sequence187', source_id='KXJ93426.1', sequence='---------------------------------------MDQEPAAL------------PPTRNPLDVAPDD----TL---------GGIESSPRVYSD----------PESTIRTHH---HSQSLDQGL-----ASSAH-----------YQHNSEDMD-HQTRQDTPPIPQQPQSISR-PPSGLSGAGDRQPAQYSDH--------------------ASRSSGGQPEPQNGRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFPREDQEEISNQARRFAKAMRAPLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence188', source_id='XP_051368163.1', sequence='---------------------------------------MDQDLLG-----------------T--PTAPHDTLDDAL---------AGVEGPLHLA---------SESGN--LEPHH--RQSQSLDRGL-----ANNAQVDDF---------------DTAVPFDS-PQYDTPPPAMQR-PASSD-SAAGEKQL---------------------AEH--ASREANGADRNNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence189', source_id='GES63634.1', sequence='-------METIHNL--NTGV-SEPVEQQP------QESAFEASPVSHPAGSTD----------E-----PTSASVYHR---------SGYNSDSHA--QYSSLA----------------------------------------------------------THQPQ-PP------TSSR-PSSGLS-GPERYGP----------------------SQEVTQKQPSQPPSSQTKNSVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLVGTKYDHFVNFPREDQEEISIQAKRFAKAMKASLIFSSTSHSINVQKIFKIVLAKAFDLKCTIPEIENIGEPLLLYKNV---------------------------------------------------------------------------------'), Sequence(id='sequence190', source_id='RPA74746.1', sequence='--------------------------------------------------------------------------------------------------------------------------------------------------M---------------ADHHE-GSSH---SYDR---TSHSS-RP-------------------------------ATAEKQPAPKEETKNSVVIKVGMVGDAQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLIGTKYDHYVNFPIEDQEEISKQAKRFAKAMKASLIFSSTSHSINIQKIFKIVLSKAFDLKCTIPEITEIGEPLLLYQDV---------------------------------------------------------------------------------'), Sequence(id='sequence191', source_id='XP_024675402.1', sequence='-------MDTPQPSDPLAGVAPERHEQHPQPQSAPQQSQYPVNPA-GPYPSHV----------ESVPPEVIPSASTYH---------AGYSSDSHAN--YSSNAVDF--NS--------------------------GSEYP---PQPRAELPRA---QEAVPSMMH-PPAA---PSSSR-PSSGLSSGPDRL-----------------------GSVQSGQELPQKQPIPSNKNSVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPFLVGTKYDHFVNFPREDQEEISIQAKRFAKAMKASLIFSSTSHSINVQKIFKIVLAKAFDLKCTIPEIENIGEPLLLYKNL---------------------------------------------------------------------------------'), Sequence(id='sequence192', source_id='KAH6850716.1', sequence='MEQE-QAFN------PAYTMAPDPALA------------------PAPIPAPI----------SSPVGLPTDPHDDTL---------SGVESVTHQ---ALPDHN-IHDHNGFHE------Q-QHLVQLQ-----PLDHSVN---NSPRSPYPTDTTDSEPTARYAT-PPIP--APTISR-PPSGLSGQGAAYGAD--QVSRAG-----------------SNGAQAESSQSPGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNLSREEQEEISNQARRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEITNVGEPLLIYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence193', source_id='PHH71636.1', sequence='---------------------------------------MEHQQPE-LDQ--Q----------PPPLHAAHDSLDDTL---------GGIEGSPHVAA----------ANNGFHQ------QSQSLDSAV-----P---------NSPR--------YDDDAANRHT-P-PVSSAPSLSR-PGSQMS-----------------NPSSSNPPQQMHG----NDHRQGSNEPPNGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPPQDQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQNV---------------------------------------------------------------------------------'), Sequence(id='sequence194', source_id='KAJ3562589.1', sequence='------------------------------------MDTMEQDLHTTPIPGVH----------E--HHHLDDALPDPH---------ADVDARPHS--------AP--GQNGHEVYH---QQSHSLDQGI-----AHG---------------QHPDEADLNGRYDT-PPSATHPQSISR-PPSGLSGAGGDRQTT------------------------YSDRGSNGTDQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQQTV--------------------------------------------------------------------------------'), Sequence(id='sequence195', source_id='RDA84390.1', sequence='---------------------------------------MDHQPAA-DQEQPQ----------ELPRPASHDGLDDTL---------GGIEGSPHPVA----------SSNGFHA------HQ-----EA-----P---------GSPR--------YDDDNAARQT-P-PVSA--PLSR-PGSQMS-----------------N-----PPQHASG----SDYRQGSNEPPNGRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPPQDQEEISNQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQNV---------------------------------------------------------------------------------'), Sequence(id='sequence196', source_id='XP_007413704.1', sequence='----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSNMTSSTGP-----AGSSGSTSNSSLQQNDDKNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLIGTKYDHFAAFSKDEQEEITRQSRRFAKAMRAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTIPEINGSGEPLLIYLDV---------------------------------------------------------------------------------'), Sequence(id='sequence197', source_id='KAI0376630.1', sequence='---------------------------------------------------------------------------------------------MHLP---------NEPHN--HETHH--RQSQSLDQGL-----ANNV---------------HPDDVDPNAQYEA-HQYDQPSQSVPR-PASSMSSTGGERQY---------------------SDQ--AARESNGAADRNTRNHVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPILVGTKYDHFVNFPREDQEEISNQAKRFAKAMRAALIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSV---------------------------------------------------------------------------------'), Sequence(id='sequence198', source_id='XP_047831721.1', sequence='---------------------------------------MEQDFHTAPIPGPR----------E--HLDALPDTHDTH---------ADVVARPHT--------AP--DQNGHEVYH---QQSQSLDQGL-----SDS---------------QHHDDADVAGRYET-HPSTTHPQSISR-PPSGLSGAGGDRQAT------------------------YSDRGSNGTDQASTRNQVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQGRGFNKTAIPVLVGTKYDHFVNFSREEQEEISSQARRFAKAMRASLIFSSTSHSINVQKIFKIVLSKAFDLKCTIPEIENVGEPLLLYQSC---------------------------------------------------------------------------------'), Sequence(id='sequence199', source_id='KAI9294962.1', sequence='-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MAEEGKNSVVIKVGMVGDSQIGKTSLMVKYVEGSFDEDYIQTLGVNFMEKTISIRNTEITFSIWDLGGQHEFVNMLPLVCNDAVAILFMFDLSRKATLNSIKEWYRQARGFNKTAMPFLVGTKYDHFASFNREEQEEITKQARKFAKAMRAPLIFCSTSHSINVQKVFKVVLSKAFDLKCTIPEISDIGAPILEYEVGSE-------------------------------------------------------------------------------')], standard_numberings=[StandardNumbering(id='standardnumbering0', reference_id='BAH60832.1', numbered_id='CAI4663910.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '9.213', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222.425', '223.426', '224.427', '225.428', '226.429', '227.430', '228.431', '229.432', '230', '231', '232.433', '233.434', '234.435', '235.436', '236.437', '237.438', '237.439', '238.440', '239.441', '240.442', '241.443', '242', '243', '243.444', '243.445', '243.446', '243.447', '243.448', '243.449', '243.450', '243.451', '243.452', '244', '245', '246', '247', '248', '249', '250', '251', '252.453', '253.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486', '254.487', '254.488']), StandardNumbering(id='standardnumbering1', reference_id='BAH60832.1', numbered_id='EJT44931.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '9.213', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222.425', '223.426', '224.427', '225.428', '226.429', '227.430', '228.431', '229.432', '230', '231', '232.433', '233.434', '234.435', '235.436', '236.437', '237.438', '237.439', '238.440', '239.441', '240.442', '241.443', '242', '243', '243.444', '243.445', '243.446', '243.447', '243.448', '243.449', '243.450', '243.451', '243.452', '244', '245', '246', '247', '248', '249', '250', '251', '252.453', '253.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486', '254.487', '254.488']), StandardNumbering(id='standardnumbering2', reference_id='BAH60832.1', numbered_id='XP_037139093.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9.212', '10.213', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222.425', '223.426', '224.427', '225.428', '226.429', '227.430', '228.431', '229.432', '230.433', '231', '232', '233.434', '234.435', '235.436', '236.437', '237.438', '237.439', '238.440', '239.441', '240.442', '241', '242', '243', '243.443', '243.444', '243.445', '243.446', '243.447', '243.448', '243.449', '243.450', '243.451', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484']), StandardNumbering(id='standardnumbering3', reference_id='BAH60832.1', numbered_id='XP_003680887.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11.212', '12.213', '13.214', '14.215', '15.216', '16.217', '17.218', '18.219', '19.220', '20.221', '21.222', '22.223', '23.224', '24.225', '25.226', '26.227', '27.228', '28.229', '29.230', '30.231', '31.232', '32.233', '33.234', '34.235', '35.236', '36.237', '37.238', '38.239', '39.240', '40.241', '41.242', '42.243', '43.244', '44.245', '45.246', '46.247', '47.248', '48.249', '49.250', '50.251', '51.252', '52.253', '53.254', '54.255', '55.256', '56.257', '57.258', '58.259', '59.260', '60.261', '61.262', '62.263', '63.264', '64.265', '65.266', '66.267', '67.268', '68.269', '69.270', '70.271', '71.272', '72.273', '73.274', '74.275', '75.276', '76.277', '77.278', '78.279', '79.280', '80.281', '81.282', '82.283', '83.284', '84.285', '85.286', '86.287', '87.288', '88.289', '89.290', '90.291', '91.292', '92.293', '93.294', '94.295', '95.296', '96.297', '97.298', '98.299', '99.300', '100.301', '101.302', '102.303', '103.304', '104.305', '105.306', '106.307', '107.308', '108.309', '109.310', '110.311', '111.312', '112.313', '113.314', '114.315', '115.316', '116.317', '117.318', '118.319', '119.320', '120.321', '121.322', '122.323', '123.324', '124.325', '125.326', '126.327', '127.328', '128.329', '129.330', '130.331', '131.332', '132.333', '133.334', '134.335', '135.336', '136.337', '137.338', '138.339', '139.340', '140.341', '141.342', '142.343', '143.344', '144.345', '145.346', '146.347', '147.348', '148.349', '149.350', '150.351', '151.352', '152.353', '153.354', '154.355', '155.356', '156.357', '157.358', '158.359', '159.360', '160.361', '161.362', '162.363', '163.364', '164.365', '165.366', '166.367', '167.368', '168.369', '169.370', '170.371', '171.372', '172.373', '173.374', '174.375', '175.376', '176.377', '177.378', '178.379', '179.380', '180.381', '181.382', '182.383', '183.384', '184.385', '185.386', '186.387', '187.388', '188.389', '189.390', '190.391', '191.392', '192.393', '193.394', '194.395', '195.396', '196.397', '197.398', '198.399', '199.400', '200.401', '201.402', '202.403', '203.404', '204.405', '205.406', '206.407', '207.408', '208.409', '209.410', '210.411', '211.412', '212.413', '213.414', '214.415', '215.416', '216.417', '217.418', '218.419', '219.420', '220.421', '221.422', '222.423', '223.424', '224.425', '225.426', '226.427', '227.428', '228.429', '229.430', '230.431', '231', '232', '233.432', '234.433', '235.434', '236.435', '237.436', '237.437', '238.438', '239.439', '240.440', '241', '242', '243', '243.441', '243.442', '243.443', '243.444', '243.445', '243.446', '243.447', '243.448', '243.449', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482']), StandardNumbering(id='standardnumbering4', reference_id='BAH60832.1', numbered_id='XP_037144827.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1.181', '2.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '3.195', '4.196', '5.197', '5.198', '5.199', '5.200', '5.201', '5.202', '6.203', '7.204', '7.205', '7.206', '7.207', '7.208', '7.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '8.217', '8.218', '8.219', '9.220', '10.221', '11.222', '12.223', '13.224', '14.225', '15.226', '16.227', '17.228', '18.229', '19.230', '20.231', '21.232', '22.233', '23.234', '24.235', '25.236', '26.237', '27.238', '28.239', '29.240', '30.241', '31.242', '32.243', '33.244', '34.245', '35.246', '36.247', '37.248', '38.249', '39.250', '40.251', '41.252', '42.253', '43.254', '44.255', '45.256', '46.257', '47.258', '48.259', '49.260', '50.261', '51.262', '52.263', '53.264', '54.265', '55.266', '56.267', '57.268', '58.269', '59.270', '60.271', '61.272', '62.273', '63.274', '64.275', '65.276', '66.277', '67.278', '68.279', '69.280', '70.281', '71.282', '72.283', '73.284', '74.285', '75.286', '76.287', '77.288', '78.289', '79.290', '80.291', '81.292', '82.293', '83.294', '84.295', '85.296', '86.297', '87.298', '88.299', '89.300', '90.301', '91.302', '92.303', '93.304', '94.305', '95.306', '96.307', '97.308', '98.309', '99.310', '100.311', '101.312', '102.313', '103.314', '104.315', '105.316', '106.317', '107.318', '108.319', '109.320', '110.321', '111.322', '112.323', '113.324', '114.325', '115.326', '116.327', '117.328', '118.329', '119.330', '120.331', '121.332', '122.333', '123.334', '124.335', '125.336', '126.337', '127.338', '128.339', '129.340', '130.341', '131.342', '132.343', '133.344', '134.345', '135.346', '136.347', '137.348', '138.349', '139.350', '140.351', '141.352', '142.353', '143.354', '144.355', '145.356', '146.357', '147.358', '148.359', '149.360', '150.361', '151.362', '152.363', '153.364', '154.365', '155.366', '156.367', '157.368', '158.369', '159.370', '160.371', '161.372', '162.373', '163.374', '164.375', '165.376', '166.377', '167.378', '168.379', '169.380', '170.381', '171.382', '172.383', '173.384', '174.385', '175.386', '176.387', '177.388', '178.389', '179.390', '180.391', '181.392', '182.393', '183.394', '184.395', '185.396', '186.397', '187.398', '188.399', '189.400', '190.401', '191.402', '192.403', '193.404', '194.405', '195.406', '196.407', '197.408', '198.409', '199.410', '200.411', '201.412', '202.413', '203.414', '204.415', '205.416', '206.417', '207.418', '208.419', '209.420', '210.421', '211.422', '212.423', '213.424', '214.425', '215.426', '216.427', '217.428', '218.429', '219.430', '220.431', '221.432', '222.433', '223.434', '224.435', '225.436', '226.437', '227.438', '228.439', '229.440', '230.441', '231', '232', '233.442', '234.443', '235.444', '236.445', '237.446', '237.447', '238.448', '239.449', '240.450', '241.451', '242', '243', '243.452', '243.453', '243.454', '243.455', '243.456', '243.457', '243.458', '243.459', '243.460', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486', '254.487', '254.488', '254.489', '254.490', '254.491', '254.492', '254.493']), StandardNumbering(id='standardnumbering5', reference_id='BAH60832.1', numbered_id='AQZ18344.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9.212', '10.213', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222.425', '223.426', '224.427', '225.428', '226.429', '227.430', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.431', '238', '239', '240', '241', '242', '243', '243.432', '243.433', '243.434', '243.435', '243.436', '243.437', '243.438', '243.439', '243.440', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473']), StandardNumbering(id='standardnumbering6', reference_id='BAH60832.1', numbered_id='XP_002495560.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1.181', '2.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '3.195', '4.196', '5.197', '5.198', '5.199', '5.200', '5.201', '5.202', '6.203', '7.204', '7.205', '7.206', '7.207', '7.208', '7.209', '8', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '8.217', '8.218', '9.219', '10.220', '11.221', '12.222', '13.223', '14.224', '15.225', '16.226', '17.227', '18.228', '19.229', '20.230', '21.231', '22.232', '23.233', '24.234', '25.235', '26.236', '27.237', '28.238', '29.239', '30.240', '31.241', '32.242', '33.243', '34.244', '35.245', '36.246', '37.247', '38.248', '39.249', '40.250', '41.251', '42.252', '43.253', '44.254', '45.255', '46.256', '47.257', '48.258', '49.259', '50.260', '51.261', '52.262', '53.263', '54.264', '55.265', '56.266', '57.267', '58.268', '59.269', '60.270', '61.271', '62.272', '63.273', '64.274', '65.275', '66.276', '67.277', '68.278', '69.279', '70.280', '71.281', '72.282', '73.283', '74.284', '75.285', '76.286', '77.287', '78.288', '79.289', '80.290', '81.291', '82.292', '83.293', '84.294', '85.295', '86.296', '87.297', '88.298', '89.299', '90.300', '91.301', '92.302', '93.303', '94.304', '95.305', '96.306', '97.307', '98.308', '99.309', '100.310', '101.311', '102.312', '103.313', '104.314', '105.315', '106.316', '107.317', '108.318', '109.319', '110.320', '111.321', '112.322', '113.323', '114.324', '115.325', '116.326', '117.327', '118.328', '119.329', '120.330', '121.331', '122.332', '123.333', '124.334', '125.335', '126.336', '127.337', '128.338', '129.339', '130.340', '131.341', '132.342', '133.343', '134.344', '135.345', '136.346', '137.347', '138.348', '139.349', '140.350', '141.351', '142.352', '143.353', '144.354', '145.355', '146.356', '147.357', '148.358', '149.359', '150.360', '151.361', '152.362', '153.363', '154.364', '155.365', '156.366', '157.367', '158.368', '159.369', '160.370', '161.371', '162.372', '163.373', '164.374', '165.375', '166.376', '167.377', '168.378', '169.379', '170.380', '171.381', '172.382', '173.383', '174.384', '175.385', '176.386', '177.387', '178.388', '179.389', '180.390', '181.391', '182.392', '183.393', '184.394', '185.395', '186.396', '187.397', '188.398', '189.399', '190.400', '191.401', '192.402', '193.403', '194.404', '195.405', '196.406', '197.407', '198.408', '199.409', '200.410', '201.411', '202.412', '203.413', '204.414', '205.415', '206.416', '207.417', '208.418', '209.419', '210.420', '211.421', '212.422', '213.423', '214.424', '215.425', '216.426', '217.427', '218.428', '219.429', '220.430', '221.431', '222.432', '223.433', '224.434', '225.435', '226.436', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.437', '238', '239', '240', '241', '242', '243', '243.438', '243.439', '243.440', '243.441', '243.442', '243.443', '243.444', '243.445', '243.446', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479']), StandardNumbering(id='standardnumbering7', reference_id='BAH60832.1', numbered_id='XP_003673548.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9.212', '10.213', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222.425', '223.426', '224.427', '225.428', '226.429', '227.430', '228.431', '229.432', '230.433', '231.434', '232.435', '233.436', '234', '235', '236', '237', '237.437', '238', '239', '240', '241', '242', '243', '243.438', '243.439', '243.440', '243.441', '243.442', '243.443', '243.444', '243.445', '243.446', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479']), StandardNumbering(id='standardnumbering8', reference_id='BAH60832.1', numbered_id='XP_003958955.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9.212', '10.213', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222.425', '223.426', '224.427', '225.428', '226.429', '227.430', '228.431', '229.432', '230.433', '231.434', '232.435', '233.436', '234.437', '235', '236.438', '237.439', '237.440', '238', '239', '240', '241', '242', '243', '243.441', '243.442', '243.443', '243.444', '243.445', '243.446', '243.447', '243.448', '243.449', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482']), StandardNumbering(id='standardnumbering9', reference_id='BAH60832.1', numbered_id='XP_001644471.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14', '15.212', '16.213', '17.214', '18.215', '19.216', '20.217', '21.218', '22.219', '23.220', '24.221', '25.222', '26.223', '27.224', '28.225', '29.226', '30.227', '31.228', '32.229', '33.230', '34.231', '35.232', '36.233', '37.234', '38.235', '39.236', '40.237', '41.238', '42.239', '43.240', '44.241', '45.242', '46.243', '47.244', '48.245', '49.246', '50.247', '51.248', '52.249', '53.250', '54.251', '55.252', '56.253', '57.254', '58.255', '59.256', '60.257', '61.258', '62.259', '63.260', '64.261', '65.262', '66.263', '67.264', '68.265', '69.266', '70.267', '71.268', '72.269', '73.270', '74.271', '75.272', '76.273', '77.274', '78.275', '79.276', '80.277', '81.278', '82.279', '83.280', '84.281', '85.282', '86.283', '87.284', '88.285', '89.286', '90.287', '91.288', '92.289', '93.290', '94.291', '95.292', '96.293', '97.294', '98.295', '99.296', '100.297', '101.298', '102.299', '103.300', '104.301', '105.302', '106.303', '107.304', '108.305', '109.306', '110.307', '111.308', '112.309', '113.310', '114.311', '115.312', '116.313', '117.314', '118.315', '119.316', '120.317', '121.318', '122.319', '123.320', '124.321', '125.322', '126.323', '127.324', '128.325', '129.326', '130.327', '131.328', '132.329', '133.330', '134.331', '135.332', '136.333', '137.334', '138.335', '139.336', '140.337', '141.338', '142.339', '143.340', '144.341', '145.342', '146.343', '147.344', '148.345', '149.346', '150.347', '151.348', '152.349', '153.350', '154.351', '155.352', '156.353', '157.354', '158.355', '159.356', '160.357', '161.358', '162.359', '163.360', '164.361', '165.362', '166.363', '167.364', '168.365', '169.366', '170.367', '171.368', '172.369', '173.370', '174.371', '175.372', '176.373', '177.374', '178.375', '179.376', '180.377', '181.378', '182.379', '183.380', '184.381', '185.382', '186.383', '187.384', '188.385', '189.386', '190.387', '191.388', '192.389', '193.390', '194.391', '195.392', '196.393', '197.394', '198.395', '199.396', '200.397', '201.398', '202.399', '203.400', '204.401', '205.402', '206.403', '207.404', '208.405', '209.406', '210.407', '211.408', '212.409', '213.410', '214.411', '215.412', '216.413', '217.414', '218.415', '219.416', '220.417', '221.418', '222.419', '223.420', '224.421', '225.422', '226.423', '227.424', '228.425', '229.426', '230', '231', '232.427', '233.428', '234.429', '235', '236', '237', '237.430', '238', '239', '240', '241.431', '242', '243', '243.432', '243.433', '243.434', '243.435', '243.436', '243.437', '243.438', '243.439', '243.440', '244', '245', '246', '247', '248', '249', '250', '251', '252.441', '253.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476']), StandardNumbering(id='standardnumbering10', reference_id='BAH60832.1', numbered_id='XP_003684279.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1.181', '2.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '3.195', '4.196', '5.197', '5.198', '5.199', '5.200', '5.201', '5.202', '6.203', '7.204', '7.205', '7.206', '7.207', '7.208', '7.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '8.217', '8.218', '8.219', '9.220', '10', '11.221', '12.222', '13.223', '14.224', '15.225', '16.226', '17.227', '18.228', '19.229', '20.230', '21.231', '22.232', '23.233', '24.234', '25.235', '26.236', '27.237', '28.238', '29.239', '30.240', '31.241', '32.242', '33.243', '34.244', '35.245', '36.246', '37.247', '38.248', '39.249', '40.250', '41.251', '42.252', '43.253', '44.254', '45.255', '46.256', '47.257', '48.258', '49.259', '50.260', '51.261', '52.262', '53.263', '54.264', '55.265', '56.266', '57.267', '58.268', '59.269', '60.270', '61.271', '62.272', '63.273', '64.274', '65.275', '66.276', '67.277', '68.278', '69.279', '70.280', '71.281', '72.282', '73.283', '74.284', '75.285', '76.286', '77.287', '78.288', '79.289', '80.290', '81.291', '82.292', '83.293', '84.294', '85.295', '86.296', '87.297', '88.298', '89.299', '90.300', '91.301', '92.302', '93.303', '94.304', '95.305', '96.306', '97.307', '98.308', '99.309', '100.310', '101.311', '102.312', '103.313', '104.314', '105.315', '106.316', '107.317', '108.318', '109.319', '110.320', '111.321', '112.322', '113.323', '114.324', '115.325', '116.326', '117.327', '118.328', '119.329', '120.330', '121.331', '122.332', '123.333', '124.334', '125.335', '126.336', '127.337', '128.338', '129.339', '130.340', '131.341', '132.342', '133.343', '134.344', '135.345', '136.346', '137.347', '138.348', '139.349', '140.350', '141.351', '142.352', '143.353', '144.354', '145.355', '146.356', '147.357', '148.358', '149.359', '150.360', '151.361', '152.362', '153.363', '154.364', '155.365', '156.366', '157.367', '158.368', '159.369', '160.370', '161.371', '162.372', '163.373', '164.374', '165.375', '166.376', '167.377', '168.378', '169.379', '170.380', '171.381', '172.382', '173.383', '174.384', '175.385', '176.386', '177.387', '178.388', '179.389', '180.390', '181.391', '182.392', '183.393', '184.394', '185.395', '186.396', '187.397', '188.398', '189.399', '190.400', '191.401', '192.402', '193.403', '194.404', '195.405', '196.406', '197.407', '198.408', '199.409', '200.410', '201.411', '202.412', '203.413', '204.414', '205.415', '206.416', '207.417', '208.418', '209.419', '210.420', '211.421', '212.422', '213.423', '214.424', '215.425', '216.426', '217.427', '218.428', '219.429', '220.430', '221.431', '222.432', '223.433', '224.434', '225.435', '226.436', '227.437', '228.438', '229.439', '230.440', '231.441', '232.442', '233.443', '234.444', '235.445', '236.446', '237.447', '237.448', '238.449', '239.450', '240.451', '241.452', '242.453', '243.454', '243.455', '243.456', '243.457', '243.458', '243.459', '243.460', '243.461', '243.462', '243.463', '244.464', '245.465', '246.466', '247.467', '248.468', '249.469', '250.470', '251.471', '252.472', '253.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486', '254.487', '254.488', '254.489', '254.490', '254.491', '254.492', '254.493', '254.494', '254.495', '254.496', '254.497', '254.498', '254.499', '254.500', '254.501', '254.502', '254.503', '254.504', '254.505', '254.506', '254.507']), StandardNumbering(id='standardnumbering11', reference_id='BAH60832.1', numbered_id='SMN18735.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10.212', '11.213', '12.214', '13.215', '14.216', '15.217', '16.218', '17.219', '18.220', '19.221', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217.419', '218.420', '219.421', '220.422', '221.423', '222.424', '223.425', '224.426', '225.427', '226.428', '227.429', '228.430', '229.431', '230.432', '231.433', '232.434', '233.435', '234.436', '235.437', '236.438', '237.439', '237.440', '238', '239', '240.441', '241.442', '242.443', '243.444', '243.445', '243.446', '243.447', '243.448', '243.449', '243.450', '243.451', '243.452', '243.453', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486']), StandardNumbering(id='standardnumbering12', reference_id='BAH60832.1', numbered_id='CAD1779387.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10.212', '11.213', '12.214', '13.215', '14.216', '15.217', '16.218', '17.219', '18.220', '19.221', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217.419', '218.420', '219.421', '220.422', '221.423', '222.424', '223.425', '224.426', '225.427', '226.428', '227.429', '228.430', '229.431', '230.432', '231.433', '232.434', '233.435', '234.436', '235.437', '236.438', '237.439', '237.440', '238', '239', '240.441', '241.442', '242.443', '243.444', '243.445', '243.446', '243.447', '243.448', '243.449', '243.450', '243.451', '243.452', '243.453', '244.454', '245.455', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486', '254.487', '254.488']), StandardNumbering(id='standardnumbering13', reference_id='BAH60832.1', numbered_id='KAG0666170.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10.212', '11.213', '12.214', '13.215', '14.216', '15.217', '16.218', '17.219', '18.220', '19.221', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217.419', '218.420', '219.421', '220.422', '221.423', '222.424', '223.425', '224.426', '225.427', '226.428', '227.429', '228.430', '229.431', '230.432', '231.433', '232.434', '233.435', '234.436', '235.437', '236.438', '237.439', '237.440', '238.441', '239.442', '240.443', '241.444', '242.445', '243.446', '243.447', '243.448', '243.449', '243.450', '243.451', '243.452', '243.453', '243.454', '243.455', '244.456', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486', '254.487', '254.488', '254.489']), StandardNumbering(id='standardnumbering14', reference_id='BAH60832.1', numbered_id='XP_022464898.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10.212', '11.213', '12.214', '13.215', '14.216', '15.217', '16.218', '17.219', '18.220', '19.221', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217.419', '218.420', '219.421', '220.422', '221.423', '222.424', '223.425', '224.426', '225.427', '226.428', '227.429', '228.430', '229.431', '230.432', '231.433', '232.434', '233.435', '234.436', '235.437', '236.438', '237.439', '237.440', '238.441', '239.442', '240.443', '241.444', '242.445', '243.446', '243.447', '243.448', '243.449', '243.450', '243.451', '243.452', '243.453', '243.454', '243.455', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486', '254.487', '254.488']), StandardNumbering(id='standardnumbering15', reference_id='BAH60832.1', numbered_id='XP_003669861.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9.212', '10.213', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222.425', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.426', '238', '239', '240', '241', '242', '243', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468']), StandardNumbering(id='standardnumbering16', reference_id='BAH60832.1', numbered_id='XP_003678517.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217.422', '218.423', '219.424', '220.425', '221.426', '222.427', '223.428', '224.429', '225.430', '226.431', '227.432', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.433', '238', '239', '240', '241', '242', '243', '243.434', '243.435', '243.436', '243.437', '243.438', '243.439', '243.440', '243.441', '243.442', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475']), StandardNumbering(id='standardnumbering17', reference_id='BAH60832.1', numbered_id='KAG0659075.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9.212', '10.213', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222.425', '223.426', '224.427', '225.428', '226.429', '227.430', '228.431', '229.432', '230.433', '231.434', '232.435', '233.436', '234.437', '235.438', '236.439', '237.440', '237.441', '238.442', '239', '240', '241', '242', '243', '243.443', '243.444', '243.445', '243.446', '243.447', '243.448', '243.449', '243.450', '243.451', '244.452', '245.453', '246.454', '247.455', '248.456', '249.457', '250.458', '251.459', '252.460', '253.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486', '254.487', '254.488', '254.489', '254.490', '254.491', '254.492', '254.493', '254.494', '254.495']), StandardNumbering(id='standardnumbering18', reference_id='BAH60832.1', numbered_id='XP_451758.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13.212', '14.213', '15.214', '16.215', '17.216', '18.217', '19.218', '20.219', '21.220', '22.221', '23.222', '24.223', '25.224', '26.225', '27.226', '28.227', '29.228', '30.229', '31.230', '32.231', '33.232', '34.233', '35.234', '36.235', '37.236', '38.237', '39.238', '40.239', '41.240', '42.241', '43.242', '44.243', '45.244', '46.245', '47.246', '48.247', '49.248', '50.249', '51.250', '52.251', '53.252', '54.253', '55.254', '56.255', '57.256', '58.257', '59.258', '60.259', '61.260', '62.261', '63.262', '64.263', '65.264', '66.265', '67.266', '68.267', '69.268', '70.269', '71.270', '72.271', '73.272', '74.273', '75.274', '76.275', '77.276', '78.277', '79.278', '80.279', '81.280', '82.281', '83.282', '84.283', '85.284', '86.285', '87.286', '88.287', '89.288', '90.289', '91.290', '92.291', '93.292', '94.293', '95.294', '96.295', '97.296', '98.297', '99.298', '100.299', '101.300', '102.301', '103.302', '104.303', '105.304', '106.305', '107.306', '108.307', '109.308', '110.309', '111.310', '112.311', '113.312', '114.313', '115.314', '116.315', '117.316', '118.317', '119.318', '120.319', '121.320', '122.321', '123.322', '124.323', '125.324', '126.325', '127.326', '128.327', '129.328', '130.329', '131.330', '132.331', '133.332', '134.333', '135.334', '136.335', '137.336', '138.337', '139.338', '140.339', '141.340', '142.341', '143.342', '144.343', '145.344', '146.345', '147.346', '148.347', '149.348', '150.349', '151.350', '152.351', '153.352', '154.353', '155.354', '156.355', '157.356', '158.357', '159.358', '160.359', '161.360', '162.361', '163.362', '164.363', '165.364', '166.365', '167.366', '168.367', '169.368', '170.369', '171.370', '172.371', '173.372', '174.373', '175.374', '176.375', '177.376', '178.377', '179.378', '180.379', '181.380', '182.381', '183.382', '184.383', '185.384', '186.385', '187.386', '188.387', '189.388', '190.389', '191.390', '192.391', '193.392', '194.393', '195.394', '196.395', '197.396', '198.397', '199.398', '200.399', '201.400', '202.401', '203.402', '204.403', '205.404', '206.405', '207.406', '208.407', '209.408', '210.409', '211.410', '212.411', '213.412', '214.413', '215.414', '216.415', '217.416', '218.417', '219.418', '220.419', '221.420', '222.421', '223.422', '224.423', '225', '226.424', '227.425', '228.426', '229.427', '230.428', '231', '232', '233', '234', '235', '236.429', '237.430', '237.431', '238.432', '239.433', '240.434', '241', '242', '243', '243.435', '243.436', '243.437', '243.438', '243.439', '243.440', '243.441', '243.442', '243.443', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476']), StandardNumbering(id='standardnumbering19', reference_id='BAH60832.1', numbered_id='NP_984991.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14.212', '15.213', '16.214', '17.215', '18.216', '19.217', '20.218', '21.219', '22.220', '23.221', '24.222', '25.223', '26.224', '27.225', '28.226', '29.227', '30.228', '31.229', '32.230', '33.231', '34.232', '35.233', '36.234', '37.235', '38.236', '39.237', '40.238', '41.239', '42.240', '43.241', '44.242', '45.243', '46.244', '47.245', '48.246', '49.247', '50.248', '51.249', '52.250', '53.251', '54.252', '55.253', '56.254', '57.255', '58.256', '59.257', '60.258', '61.259', '62.260', '63.261', '64.262', '65.263', '66.264', '67.265', '68.266', '69.267', '70.268', '71.269', '72.270', '73.271', '74.272', '75.273', '76.274', '77.275', '78.276', '79.277', '80.278', '81.279', '82.280', '83.281', '84.282', '85.283', '86.284', '87.285', '88.286', '89.287', '90.288', '91.289', '92.290', '93.291', '94.292', '95.293', '96.294', '97.295', '98.296', '99.297', '100.298', '101.299', '102.300', '103.301', '104.302', '105.303', '106.304', '107.305', '108.306', '109.307', '110.308', '111.309', '112.310', '113.311', '114.312', '115.313', '116.314', '117.315', '118.316', '119.317', '120.318', '121.319', '122.320', '123.321', '124.322', '125.323', '126.324', '127.325', '128.326', '129.327', '130.328', '131.329', '132.330', '133.331', '134.332', '135.333', '136.334', '137.335', '138.336', '139.337', '140.338', '141.339', '142.340', '143.341', '144.342', '145.343', '146.344', '147.345', '148.346', '149.347', '150.348', '151.349', '152.350', '153.351', '154.352', '155.353', '156.354', '157.355', '158.356', '159.357', '160.358', '161.359', '162.360', '163.361', '164.362', '165.363', '166.364', '167.365', '168.366', '169.367', '170.368', '171.369', '172.370', '173.371', '174.372', '175.373', '176.374', '177.375', '178.376', '179.377', '180.378', '181.379', '182.380', '183.381', '184.382', '185.383', '186.384', '187.385', '188.386', '189.387', '190.388', '191.389', '192.390', '193.391', '194.392', '195.393', '196.394', '197.395', '198.396', '199.397', '200.398', '201.399', '202.400', '203.401', '204.402', '205.403', '206.404', '207.405', '208.406', '209.407', '210.408', '211.409', '212.410', '213.411', '214.412', '215.413', '216.414', '217.415', '218.416', '219.417', '220.418', '221.419', '222.420', '223.421', '224.422', '225.423', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.424', '238', '239', '240', '241', '242', '243', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '244.434', '245.435', '246.436', '247.437', '248.438', '249.439', '250.440', '251.441', '252', '253', '254', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474']), StandardNumbering(id='standardnumbering20', reference_id='BAH60832.1', numbered_id='XP_017989070.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14.212', '15.213', '16.214', '17.215', '18.216', '19.217', '20.218', '21.219', '22.220', '23.221', '24.222', '25.223', '26.224', '27.225', '28.226', '29.227', '30.228', '31.229', '32.230', '33.231', '34.232', '35.233', '36.234', '37.235', '38.236', '39.237', '40.238', '41.239', '42.240', '43.241', '44.242', '45.243', '46.244', '47.245', '48.246', '49.247', '50.248', '51.249', '52.250', '53.251', '54.252', '55.253', '56.254', '57.255', '58.256', '59.257', '60.258', '61.259', '62.260', '63.261', '64.262', '65.263', '66.264', '67.265', '68.266', '69.267', '70.268', '71.269', '72.270', '73.271', '74.272', '75.273', '76.274', '77.275', '78.276', '79.277', '80.278', '81.279', '82.280', '83.281', '84.282', '85.283', '86.284', '87.285', '88.286', '89.287', '90.288', '91.289', '92.290', '93.291', '94.292', '95.293', '96.294', '97.295', '98.296', '99.297', '100.298', '101.299', '102.300', '103.301', '104.302', '105.303', '106.304', '107.305', '108.306', '109.307', '110.308', '111.309', '112.310', '113.311', '114.312', '115.313', '116.314', '117.315', '118.316', '119.317', '120.318', '121.319', '122.320', '123.321', '124.322', '125.323', '126.324', '127.325', '128.326', '129.327', '130.328', '131.329', '132.330', '133.331', '134.332', '135.333', '136.334', '137.335', '138.336', '139.337', '140.338', '141.339', '142.340', '143.341', '144.342', '145.343', '146.344', '147.345', '148.346', '149.347', '150.348', '151.349', '152.350', '153.351', '154.352', '155.353', '156.354', '157.355', '158.356', '159.357', '160.358', '161.359', '162.360', '163.361', '164.362', '165.363', '166.364', '167.365', '168.366', '169.367', '170.368', '171.369', '172.370', '173.371', '174.372', '175.373', '176.374', '177.375', '178.376', '179.377', '180.378', '181.379', '182.380', '183.381', '184.382', '185.383', '186.384', '187.385', '188.386', '189.387', '190.388', '191.389', '192.390', '193.391', '194.392', '195.393', '196.394', '197.395', '198.396', '199.397', '200.398', '201.399', '202.400', '203.401', '204.402', '205.403', '206.404', '207.405', '208.406', '209.407', '210.408', '211.409', '212.410', '213.411', '214.412', '215.413', '216.414', '217.415', '218.416', '219.417', '220.418', '221.419', '222.420', '223.421', '224.422', '225.423', '226.424', '227.425', '228.426', '229.427', '230.428', '231', '232', '233', '234', '235', '236.429', '237.430', '237.431', '238.432', '239.433', '240.434', '241.435', '242.436', '243.437', '243.438', '243.439', '243.440', '243.441', '243.442', '243.443', '243.444', '243.445', '243.446', '244.447', '245.448', '246.449', '247.450', '248.451', '249.452', '250.453', '251.454', '252', '253', '254', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483', '254.484', '254.485', '254.486', '254.487']), StandardNumbering(id='standardnumbering21', reference_id='BAH60832.1', numbered_id='KAG0673910.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14', '15.212', '16.213', '17.214', '18.215', '19.216', '20.217', '21.218', '22.219', '23.220', '24.221', '25.222', '26.223', '27.224', '28.225', '29.226', '30.227', '31.228', '32.229', '33.230', '34.231', '35.232', '36.233', '37.234', '38.235', '39.236', '40.237', '41.238', '42.239', '43.240', '44.241', '45.242', '46.243', '47.244', '48.245', '49.246', '50.247', '51.248', '52.249', '53.250', '54.251', '55.252', '56.253', '57.254', '58.255', '59.256', '60.257', '61.258', '62.259', '63.260', '64.261', '65.262', '66.263', '67.264', '68.265', '69.266', '70.267', '71.268', '72.269', '73.270', '74.271', '75.272', '76.273', '77.274', '78.275', '79.276', '80.277', '81.278', '82.279', '83.280', '84.281', '85.282', '86.283', '87.284', '88.285', '89.286', '90.287', '91.288', '92.289', '93.290', '94.291', '95.292', '96.293', '97.294', '98.295', '99.296', '100.297', '101.298', '102.299', '103.300', '104.301', '105.302', '106.303', '107.304', '108.305', '109.306', '110.307', '111.308', '112.309', '113.310', '114.311', '115.312', '116.313', '117.314', '118.315', '119.316', '120.317', '121.318', '122.319', '123.320', '124.321', '125.322', '126.323', '127.324', '128.325', '129.326', '130.327', '131.328', '132.329', '133.330', '134.331', '135.332', '136.333', '137.334', '138.335', '139.336', '140.337', '141.338', '142.339', '143.340', '144.341', '145.342', '146.343', '147.344', '148.345', '149.346', '150.347', '151.348', '152.349', '153.350', '154.351', '155.352', '156.353', '157.354', '158.355', '159.356', '160.357', '161.358', '162.359', '163.360', '164.361', '165.362', '166.363', '167.364', '168.365', '169.366', '170.367', '171.368', '172.369', '173.370', '174.371', '175.372', '176.373', '177.374', '178.375', '179.376', '180.377', '181.378', '182.379', '183.380', '184.381', '185.382', '186.383', '187.384', '188.385', '189.386', '190.387', '191.388', '192.389', '193.390', '194.391', '195.392', '196.393', '197.394', '198.395', '199.396', '200.397', '201.398', '202.399', '203.400', '204.401', '205.402', '206.403', '207.404', '208.405', '209.406', '210.407', '211.408', '212.409', '213.410', '214.411', '215.412', '216.413', '217.414', '218.415', '219.416', '220.417', '221.418', '222.419', '223.420', '224.421', '225.422', '226.423', '227.424', '228.425', '229.426', '230.427', '231', '232', '233', '234', '235', '236.428', '237.429', '237.430', '238.431', '239.432', '240.433', '241', '242', '243', '243.434', '243.435', '243.436', '243.437', '243.438', '243.439', '243.440', '243.441', '243.442', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475']), StandardNumbering(id='standardnumbering22', reference_id='BAH60832.1', numbered_id='SMN21971.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10.212', '11.213', '12.214', '13.215', '14', '15', '16', '17', '18.216', '19.217', '20.218', '21.219', '22.220', '23.221', '24.222', '25.223', '26.224', '27.225', '28.226', '29.227', '30.228', '31.229', '32.230', '33.231', '34.232', '35.233', '36.234', '37.235', '38.236', '39.237', '40.238', '41.239', '42.240', '43.241', '44.242', '45.243', '46.244', '47.245', '48.246', '49.247', '50.248', '51.249', '52.250', '53.251', '54.252', '55.253', '56.254', '57.255', '58.256', '59.257', '60.258', '61.259', '62.260', '63.261', '64.262', '65.263', '66.264', '67.265', '68.266', '69.267', '70.268', '71.269', '72.270', '73.271', '74.272', '75.273', '76.274', '77.275', '78.276', '79.277', '80.278', '81.279', '82.280', '83.281', '84.282', '85.283', '86.284', '87.285', '88.286', '89.287', '90.288', '91.289', '92.290', '93.291', '94.292', '95.293', '96.294', '97.295', '98.296', '99.297', '100.298', '101.299', '102.300', '103.301', '104.302', '105.303', '106.304', '107.305', '108.306', '109.307', '110.308', '111.309', '112.310', '113.311', '114.312', '115.313', '116.314', '117.315', '118.316', '119.317', '120.318', '121.319', '122.320', '123.321', '124.322', '125.323', '126.324', '127.325', '128.326', '129.327', '130.328', '131.329', '132.330', '133.331', '134.332', '135.333', '136.334', '137.335', '138.336', '139.337', '140.338', '141.339', '142.340', '143.341', '144.342', '145.343', '146.344', '147.345', '148.346', '149.347', '150.348', '151.349', '152.350', '153.351', '154.352', '155.353', '156.354', '157.355', '158.356', '159.357', '160.358', '161.359', '162.360', '163.361', '164.362', '165.363', '166.364', '167.365', '168.366', '169.367', '170.368', '171.369', '172.370', '173.371', '174.372', '175.373', '176.374', '177.375', '178.376', '179.377', '180.378', '181.379', '182.380', '183.381', '184.382', '185.383', '186.384', '187.385', '188.386', '189.387', '190.388', '191.389', '192.390', '193.391', '194.392', '195.393', '196.394', '197.395', '198.396', '199.397', '200.398', '201.399', '202.400', '203.401', '204.402', '205.403', '206.404', '207.405', '208.406', '209.407', '210.408', '211.409', '212.410', '213.411', '214.412', '215.413', '216.414', '217.415', '218.416', '219.417', '220.418', '221.419', '222.420', '223.421', '224.422', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.423', '238', '239', '240', '241', '242', '243', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465']), StandardNumbering(id='standardnumbering23', reference_id='BAH60832.1', numbered_id='KAG0661436.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10.212', '11.213', '12.214', '13.215', '14.216', '15.217', '16.218', '17.219', '18.220', '19.221', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217.419', '218.420', '219.421', '220.422', '221.423', '222.424', '223.425', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.426', '238', '239', '240', '241', '242', '243', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468']), StandardNumbering(id='standardnumbering24', reference_id='BAH60832.1', numbered_id='SCV02624.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13.212', '14.213', '15.214', '16.215', '17.216', '18.217', '19.218', '20.219', '21.220', '22.221', '23.222', '24.223', '25.224', '26.225', '27.226', '28.227', '29.228', '30.229', '31.230', '32.231', '33.232', '34.233', '35.234', '36.235', '37.236', '38.237', '39.238', '40.239', '41.240', '42.241', '43.242', '44.243', '45.244', '46.245', '47.246', '48.247', '49.248', '50.249', '51.250', '52.251', '53.252', '54.253', '55.254', '56.255', '57.256', '58.257', '59.258', '60.259', '61.260', '62.261', '63.262', '64.263', '65.264', '66.265', '67.266', '68.267', '69.268', '70.269', '71.270', '72.271', '73.272', '74.273', '75.274', '76.275', '77.276', '78.277', '79.278', '80.279', '81.280', '82.281', '83.282', '84.283', '85.284', '86.285', '87.286', '88.287', '89.288', '90.289', '91.290', '92.291', '93.292', '94.293', '95.294', '96.295', '97.296', '98.297', '99.298', '100.299', '101.300', '102.301', '103.302', '104.303', '105.304', '106.305', '107.306', '108.307', '109.308', '110.309', '111.310', '112.311', '113.312', '114.313', '115.314', '116.315', '117.316', '118.317', '119.318', '120.319', '121.320', '122.321', '123.322', '124.323', '125.324', '126.325', '127.326', '128.327', '129.328', '130.329', '131.330', '132.331', '133.332', '134.333', '135.334', '136.335', '137.336', '138.337', '139.338', '140.339', '141.340', '142.341', '143.342', '144.343', '145.344', '146.345', '147.346', '148.347', '149.348', '150.349', '151.350', '152.351', '153.352', '154.353', '155.354', '156.355', '157.356', '158.357', '159.358', '160.359', '161.360', '162.361', '163.362', '164.363', '165.364', '166.365', '167.366', '168.367', '169.368', '170.369', '171.370', '172.371', '173.372', '174.373', '175.374', '176.375', '177.376', '178.377', '179.378', '180.379', '181.380', '182.381', '183.382', '184.383', '185.384', '186.385', '187.386', '188.387', '189.388', '190.389', '191.390', '192.391', '193.392', '194.393', '195.394', '196.395', '197.396', '198.397', '199.398', '200.399', '201.400', '202.401', '203.402', '204.403', '205.404', '206.405', '207.406', '208.407', '209.408', '210.409', '211.410', '212.411', '213.412', '214.413', '215.414', '216.415', '217.416', '218.417', '219.418', '220.419', '221.420', '222.421', '223.422', '224.423', '225.424', '226.425', '227.426', '228.427', '229.428', '230.429', '231.430', '232.431', '233.432', '234.433', '235', '236.434', '237.435', '237.436', '238.437', '239.438', '240.439', '241.440', '242.441', '243', '243.442', '243.443', '243.444', '243.445', '243.446', '243.447', '243.448', '243.449', '243.450', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477', '254.478', '254.479', '254.480', '254.481', '254.482', '254.483']), StandardNumbering(id='standardnumbering25', reference_id='BAH60832.1', numbered_id='SCV99388.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13.212', '14.213', '15.214', '16.215', '17.216', '18.217', '19.218', '20.219', '21.220', '22.221', '23.222', '24.223', '25.224', '26.225', '27.226', '28.227', '29.228', '30.229', '31.230', '32.231', '33.232', '34.233', '35.234', '36.235', '37.236', '38.237', '39.238', '40.239', '41.240', '42.241', '43.242', '44.243', '45.244', '46.245', '47.246', '48.247', '49.248', '50.249', '51.250', '52.251', '53.252', '54.253', '55.254', '56.255', '57.256', '58.257', '59.258', '60.259', '61.260', '62.261', '63.262', '64.263', '65.264', '66.265', '67.266', '68.267', '69.268', '70.269', '71.270', '72.271', '73.272', '74.273', '75.274', '76.275', '77.276', '78.277', '79.278', '80.279', '81.280', '82.281', '83.282', '84.283', '85.284', '86.285', '87.286', '88.287', '89.288', '90.289', '91.290', '92.291', '93.292', '94.293', '95.294', '96.295', '97.296', '98.297', '99.298', '100.299', '101.300', '102.301', '103.302', '104.303', '105.304', '106.305', '107.306', '108.307', '109.308', '110.309', '111.310', '112.311', '113.312', '114.313', '115.314', '116.315', '117.316', '118.317', '119.318', '120.319', '121.320', '122.321', '123.322', '124.323', '125.324', '126.325', '127.326', '128.327', '129.328', '130.329', '131.330', '132.331', '133.332', '134.333', '135.334', '136.335', '137.336', '138.337', '139.338', '140.339', '141.340', '142.341', '143.342', '144.343', '145.344', '146.345', '147.346', '148.347', '149.348', '150.349', '151.350', '152.351', '153.352', '154.353', '155.354', '156.355', '157.356', '158.357', '159.358', '160.359', '161.360', '162.361', '163.362', '164.363', '165.364', '166.365', '167.366', '168.367', '169.368', '170.369', '171.370', '172.371', '173.372', '174.373', '175.374', '176.375', '177.376', '178.377', '179.378', '180.379', '181.380', '182.381', '183.382', '184.383', '185.384', '186.385', '187.386', '188.387', '189.388', '190.389', '191.390', '192.391', '193.392', '194.393', '195.394', '196.395', '197.396', '198.397', '199.398', '200.399', '201.400', '202.401', '203.402', '204.403', '205.404', '206.405', '207.406', '208.407', '209.408', '210.409', '211.410', '212.411', '213.412', '214.413', '215.414', '216.415', '217.416', '218.417', '219.418', '220.419', '221.420', '222.421', '223.422', '224.423', '225.424', '226.425', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.426', '238', '239', '240', '241', '242', '243', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468']), StandardNumbering(id='standardnumbering26', reference_id='BAH60832.1', numbered_id='CUS20182.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13.212', '14.213', '15.214', '16.215', '17.216', '18.217', '19.218', '20.219', '21.220', '22.221', '23.222', '24.223', '25.224', '26.225', '27.226', '28.227', '29.228', '30.229', '31.230', '32.231', '33.232', '34.233', '35.234', '36.235', '37.236', '38.237', '39.238', '40.239', '41.240', '42.241', '43.242', '44.243', '45.244', '46.245', '47.246', '48.247', '49.248', '50.249', '51.250', '52.251', '53.252', '54.253', '55.254', '56.255', '57.256', '58.257', '59.258', '60.259', '61.260', '62.261', '63.262', '64.263', '65.264', '66.265', '67.266', '68.267', '69.268', '70.269', '71.270', '72.271', '73.272', '74.273', '75.274', '76.275', '77.276', '78.277', '79.278', '80.279', '81.280', '82.281', '83.282', '84.283', '85.284', '86.285', '87.286', '88.287', '89.288', '90.289', '91.290', '92.291', '93.292', '94.293', '95.294', '96.295', '97.296', '98.297', '99.298', '100.299', '101.300', '102.301', '103.302', '104.303', '105.304', '106.305', '107.306', '108.307', '109.308', '110.309', '111.310', '112.311', '113.312', '114.313', '115.314', '116.315', '117.316', '118.317', '119.318', '120.319', '121.320', '122.321', '123.322', '124.323', '125.324', '126.325', '127.326', '128.327', '129.328', '130.329', '131.330', '132.331', '133.332', '134.333', '135.334', '136.335', '137.336', '138.337', '139.338', '140.339', '141.340', '142.341', '143.342', '144.343', '145.344', '146.345', '147.346', '148.347', '149.348', '150.349', '151.350', '152.351', '153.352', '154.353', '155.354', '156.355', '157.356', '158.357', '159.358', '160.359', '161.360', '162.361', '163.362', '164.363', '165.364', '166.365', '167.366', '168.367', '169.368', '170.369', '171.370', '172.371', '173.372', '174.373', '175.374', '176.375', '177.376', '178.377', '179.378', '180.379', '181.380', '182.381', '183.382', '184.383', '185.384', '186.385', '187.386', '188.387', '189.388', '190.389', '191.390', '192.391', '193.392', '194.393', '195.394', '196.395', '197.396', '198.397', '199.398', '200.399', '201.400', '202.401', '203.402', '204.403', '205.404', '206.405', '207.406', '208.407', '209.408', '210.409', '211.410', '212.411', '213.412', '214.413', '215.414', '216.415', '217.416', '218.417', '219.418', '220.419', '221.420', '222.421', '223.422', '224.423', '225.424', '226.425', '227.426', '228.427', '229.428', '230.429', '231.430', '232.431', '233.432', '234', '235', '236', '237', '237.433', '238', '239', '240', '241', '242', '243', '243.434', '243.435', '243.436', '243.437', '243.438', '243.439', '243.440', '243.441', '243.442', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475']), StandardNumbering(id='standardnumbering27', reference_id='BAH60832.1', numbered_id='XP_045933944.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1.181', '2.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '3.195', '4.196', '5.197', '5.198', '5.199', '5.200', '5.201', '5.202', '6.203', '7.204', '7.205', '7.206', '7.207', '7.208', '7.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '8.217', '8.218', '8.219', '9', '10', '11', '12', '13.220', '14.221', '15.222', '16.223', '17.224', '18.225', '19.226', '20.227', '21.228', '22.229', '23.230', '24.231', '25.232', '26.233', '27.234', '28.235', '29.236', '30.237', '31.238', '32.239', '33.240', '34.241', '35.242', '36.243', '37.244', '38.245', '39.246', '40.247', '41.248', '42.249', '43.250', '44.251', '45.252', '46.253', '47.254', '48.255', '49.256', '50.257', '51.258', '52.259', '53.260', '54.261', '55.262', '56.263', '57.264', '58.265', '59.266', '60.267', '61.268', '62.269', '63.270', '64.271', '65.272', '66.273', '67.274', '68.275', '69.276', '70.277', '71.278', '72.279', '73.280', '74.281', '75.282', '76.283', '77.284', '78.285', '79.286', '80.287', '81.288', '82.289', '83.290', '84.291', '85.292', '86.293', '87.294', '88.295', '89.296', '90.297', '91.298', '92.299', '93.300', '94.301', '95.302', '96.303', '97.304', '98.305', '99.306', '100.307', '101.308', '102.309', '103.310', '104.311', '105.312', '106.313', '107.314', '108.315', '109.316', '110.317', '111.318', '112.319', '113.320', '114.321', '115.322', '116.323', '117.324', '118.325', '119.326', '120.327', '121.328', '122.329', '123.330', '124.331', '125.332', '126.333', '127.334', '128.335', '129.336', '130.337', '131.338', '132.339', '133.340', '134.341', '135.342', '136.343', '137.344', '138.345', '139.346', '140.347', '141.348', '142.349', '143.350', '144.351', '145.352', '146.353', '147.354', '148.355', '149.356', '150.357', '151.358', '152.359', '153.360', '154.361', '155.362', '156.363', '157.364', '158.365', '159.366', '160.367', '161.368', '162.369', '163.370', '164.371', '165.372', '166.373', '167.374', '168.375', '169.376', '170.377', '171.378', '172.379', '173.380', '174.381', '175.382', '176.383', '177.384', '178.385', '179.386', '180.387', '181.388', '182.389', '183.390', '184.391', '185.392', '186.393', '187.394', '188.395', '189.396', '190.397', '191.398', '192.399', '193.400', '194.401', '195.402', '196.403', '197.404', '198.405', '199.406', '200.407', '201.408', '202.409', '203.410', '204.411', '205.412', '206.413', '207.414', '208.415', '209.416', '210.417', '211.418', '212.419', '213.420', '214.421', '215.422', '216.423', '217.424', '218.425', '219.426', '220.427', '221.428', '222.429', '223.430', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.431', '238', '239', '240', '241', '242', '243', '243.432', '243.433', '243.434', '243.435', '243.436', '243.437', '243.438', '243.439', '243.440', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473']), StandardNumbering(id='standardnumbering28', reference_id='BAH60832.1', numbered_id='KAA8901327.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '4', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11', '12', '13', '14', '15.214', '16.215', '17.216', '18.217', '19.218', '20.219', '21.220', '22.221', '23.222', '24.223', '25.224', '26.225', '27.226', '28.227', '29.228', '30.229', '31.230', '32.231', '33.232', '34.233', '35.234', '36.235', '37.236', '38.237', '39.238', '40.239', '41.240', '42.241', '43.242', '44.243', '45.244', '46.245', '47.246', '48.247', '49.248', '50.249', '51.250', '52.251', '53.252', '54.253', '55.254', '56.255', '57.256', '58.257', '59.258', '60.259', '61.260', '62.261', '63.262', '64.263', '65.264', '66.265', '67.266', '68.267', '69.268', '70.269', '71.270', '72.271', '73.272', '74.273', '75.274', '76.275', '77.276', '78.277', '79.278', '80.279', '81.280', '82.281', '83.282', '84.283', '85.284', '86.285', '87.286', '88.287', '89.288', '90.289', '91.290', '92.291', '93.292', '94.293', '95.294', '96.295', '97.296', '98.297', '99.298', '100.299', '101.300', '102.301', '103.302', '104.303', '105.304', '106.305', '107.306', '108.307', '109.308', '110.309', '111.310', '112.311', '113.312', '114.313', '115.314', '116.315', '117.316', '118.317', '119.318', '120.319', '121.320', '122.321', '123.322', '124.323', '125.324', '126.325', '127.326', '128.327', '129.328', '130.329', '131.330', '132.331', '133.332', '134.333', '135.334', '136.335', '137.336', '138.337', '139.338', '140.339', '141.340', '142.341', '143.342', '144.343', '145.344', '146.345', '147.346', '148.347', '149.348', '150.349', '151.350', '152.351', '153.352', '154.353', '155.354', '156.355', '157.356', '158.357', '159.358', '160.359', '161.360', '162.361', '163.362', '164.363', '165.364', '166.365', '167.366', '168.367', '169.368', '170.369', '171.370', '172.371', '173.372', '174.373', '175.374', '176.375', '177.376', '178.377', '179.378', '180.379', '181.380', '182.381', '183.382', '184.383', '185.384', '186.385', '187.386', '188.387', '189.388', '190.389', '191.390', '192.391', '193.392', '194.393', '195.394', '196.395', '197.396', '198.397', '199.398', '200.399', '201.400', '202.401', '203.402', '204.403', '205.404', '206.405', '207.406', '208.407', '209.408', '210.409', '211.410', '212.411', '213.412', '214.413', '215.414', '216.415', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.416', '238', '239', '240', '241', '242', '243', '243.417', '243.418', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458']), StandardNumbering(id='standardnumbering29', reference_id='BAH60832.1', numbered_id='KAF8417303.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11', '12.214', '13.215', '14.216', '15.217', '16.218', '17.219', '18.220', '19.221', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.419', '238', '239', '240', '241', '242', '243', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461']), StandardNumbering(id='standardnumbering30', reference_id='BAH60832.1', numbered_id='KAF3929277.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21', '22.226', '23.227', '24.228', '25.229', '26.230', '27.231', '28.232', '29.233', '30.234', '31.235', '32.236', '33.237', '34.238', '35.239', '36.240', '37.241', '38.242', '39.243', '40.244', '41.245', '42.246', '43.247', '44.248', '45.249', '46.250', '47.251', '48.252', '49.253', '50.254', '51.255', '52.256', '53.257', '54.258', '55.259', '56.260', '57.261', '58.262', '59.263', '60.264', '61.265', '62.266', '63.267', '64.268', '65.269', '66.270', '67.271', '68.272', '69.273', '70.274', '71.275', '72.276', '73.277', '74.278', '75.279', '76.280', '77.281', '78.282', '79.283', '80.284', '81.285', '82.286', '83.287', '84.288', '85.289', '86.290', '87.291', '88.292', '89.293', '90.294', '91.295', '92.296', '93.297', '94.298', '95.299', '96.300', '97.301', '98.302', '99.303', '100.304', '101.305', '102.306', '103.307', '104.308', '105.309', '106.310', '107.311', '108.312', '109.313', '110.314', '111.315', '112.316', '113.317', '114.318', '115.319', '116.320', '117.321', '118.322', '119.323', '120.324', '121.325', '122.326', '123.327', '124.328', '125.329', '126.330', '127.331', '128.332', '129.333', '130.334', '131.335', '132.336', '133.337', '134.338', '135.339', '136.340', '137.341', '138.342', '139.343', '140.344', '141.345', '142.346', '143.347', '144.348', '145.349', '146.350', '147.351', '148.352', '149.353', '150.354', '151.355', '152.356', '153.357', '154.358', '155.359', '156.360', '157.361', '158.362', '159.363', '160.364', '161.365', '162.366', '163.367', '164.368', '165.369', '166.370', '167.371', '168.372', '169.373', '170.374', '171.375', '172.376', '173.377', '174.378', '175.379', '176.380', '177.381', '178.382', '179.383', '180.384', '181.385', '182.386', '183.387', '184.388', '185.389', '186.390', '187.391', '188.392', '189.393', '190.394', '191.395', '192.396', '193.397', '194.398', '195.399', '196.400', '197.401', '198.402', '199.403', '200.404', '201.405', '202.406', '203.407', '204.408', '205.409', '206.410', '207.411', '208.412', '209.413', '210.414', '211.415', '212.416', '213.417', '214.418', '215.419', '216.420', '217.421', '218.422', '219.423', '220.424', '221.425', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.426', '238', '239', '240', '241', '242', '243', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468']), StandardNumbering(id='standardnumbering31', reference_id='BAH60832.1', numbered_id='OEJ86227.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6.200', '7.201', '7.202', '7.203', '7.204', '7.205', '7.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '9', '10', '11', '12', '13.217', '14.218', '15.219', '16.220', '17.221', '18.222', '19.223', '20.224', '21.225', '22.226', '23.227', '24.228', '25.229', '26.230', '27.231', '28.232', '29.233', '30.234', '31.235', '32.236', '33.237', '34.238', '35.239', '36.240', '37.241', '38.242', '39.243', '40.244', '41.245', '42.246', '43.247', '44.248', '45.249', '46.250', '47.251', '48.252', '49.253', '50.254', '51.255', '52.256', '53.257', '54.258', '55.259', '56.260', '57.261', '58.262', '59.263', '60.264', '61.265', '62.266', '63.267', '64.268', '65.269', '66.270', '67.271', '68.272', '69.273', '70.274', '71.275', '72.276', '73.277', '74.278', '75.279', '76.280', '77.281', '78.282', '79.283', '80.284', '81.285', '82.286', '83.287', '84.288', '85.289', '86.290', '87.291', '88.292', '89.293', '90.294', '91.295', '92.296', '93.297', '94.298', '95.299', '96.300', '97.301', '98.302', '99.303', '100.304', '101.305', '102.306', '103.307', '104.308', '105.309', '106.310', '107.311', '108.312', '109.313', '110.314', '111.315', '112.316', '113.317', '114.318', '115.319', '116.320', '117.321', '118.322', '119.323', '120.324', '121.325', '122.326', '123.327', '124.328', '125.329', '126.330', '127.331', '128.332', '129.333', '130.334', '131.335', '132.336', '133.337', '134.338', '135.339', '136.340', '137.341', '138.342', '139.343', '140.344', '141.345', '142.346', '143.347', '144.348', '145.349', '146.350', '147.351', '148.352', '149.353', '150.354', '151.355', '152.356', '153.357', '154.358', '155.359', '156.360', '157.361', '158.362', '159.363', '160.364', '161.365', '162.366', '163.367', '164.368', '165.369', '166.370', '167.371', '168.372', '169.373', '170.374', '171.375', '172.376', '173.377', '174.378', '175.379', '176.380', '177.381', '178.382', '179.383', '180.384', '181.385', '182.386', '183.387', '184.388', '185.389', '186.390', '187.391', '188.392', '189.393', '190.394', '191.395', '192.396', '193.397', '194.398', '195.399', '196.400', '197.401', '198.402', '199.403', '200.404', '201.405', '202.406', '203.407', '204.408', '205.409', '206.410', '207.411', '208.412', '209.413', '210.414', '211.415', '212.416', '213.417', '214.418', '215.419', '216.420', '217.421', '218.422', '219.423', '220.424', '221.425', '222.426', '223.427', '224.428', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.429', '238', '239', '240', '241', '242', '243', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '243.436', '243.437', '243.438', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471']), StandardNumbering(id='standardnumbering32', reference_id='BAH60832.1', numbered_id='XP_046060918.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14', '15', '16', '17', '18', '19', '20', '21', '22.212', '23.213', '24.214', '25.215', '26.216', '27.217', '28.218', '29.219', '30.220', '31.221', '32.222', '33.223', '34.224', '35.225', '36.226', '37.227', '38.228', '39.229', '40.230', '41.231', '42.232', '43.233', '44.234', '45.235', '46.236', '47.237', '48.238', '49.239', '50.240', '51.241', '52.242', '53.243', '54.244', '55.245', '56.246', '57.247', '58.248', '59.249', '60.250', '61.251', '62.252', '63.253', '64.254', '65.255', '66.256', '67.257', '68.258', '69.259', '70.260', '71.261', '72.262', '73.263', '74.264', '75.265', '76.266', '77.267', '78.268', '79.269', '80.270', '81.271', '82.272', '83.273', '84.274', '85.275', '86.276', '87.277', '88.278', '89.279', '90.280', '91.281', '92.282', '93.283', '94.284', '95.285', '96.286', '97.287', '98.288', '99.289', '100.290', '101.291', '102.292', '103.293', '104.294', '105.295', '106.296', '107.297', '108.298', '109.299', '110.300', '111.301', '112.302', '113.303', '114.304', '115.305', '116.306', '117.307', '118.308', '119.309', '120.310', '121.311', '122.312', '123.313', '124.314', '125.315', '126.316', '127.317', '128.318', '129.319', '130.320', '131.321', '132.322', '133.323', '134.324', '135.325', '136.326', '137.327', '138.328', '139.329', '140.330', '141.331', '142.332', '143.333', '144.334', '145.335', '146.336', '147.337', '148.338', '149.339', '150.340', '151.341', '152.342', '153.343', '154.344', '155.345', '156.346', '157.347', '158.348', '159.349', '160.350', '161.351', '162.352', '163.353', '164.354', '165.355', '166.356', '167.357', '168.358', '169.359', '170.360', '171.361', '172.362', '173.363', '174.364', '175.365', '176.366', '177.367', '178.368', '179.369', '180.370', '181.371', '182.372', '183.373', '184.374', '185.375', '186.376', '187.377', '188.378', '189.379', '190.380', '191.381', '192.382', '193.383', '194.384', '195.385', '196.386', '197.387', '198.388', '199.389', '200.390', '201.391', '202.392', '203.393', '204.394', '205.395', '206.396', '207.397', '208.398', '209.399', '210.400', '211.401', '212.402', '213.403', '214.404', '215.405', '216.406', '217.407', '218.408', '219.409', '220.410', '221.411', '222.412', '223.413', '224.414', '225.415', '226.416', '227.417', '228.418', '229.419', '230.420', '231.421', '232.422', '233', '234', '235', '236', '237', '237.423', '238', '239', '240', '241', '242', '243', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465']), StandardNumbering(id='standardnumbering33', reference_id='BAH60832.1', numbered_id='EPS36031.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21', '22.226', '23.227', '24.228', '25.229', '26.230', '27.231', '28.232', '29.233', '30.234', '31.235', '32.236', '33.237', '34.238', '35.239', '36.240', '37.241', '38.242', '39.243', '40.244', '41.245', '42.246', '43.247', '44.248', '45.249', '46.250', '47.251', '48.252', '49.253', '50.254', '51.255', '52.256', '53.257', '54.258', '55.259', '56.260', '57.261', '58.262', '59.263', '60.264', '61.265', '62.266', '63.267', '64.268', '65.269', '66.270', '67.271', '68.272', '69.273', '70.274', '71.275', '72.276', '73.277', '74.278', '75.279', '76.280', '77.281', '78.282', '79.283', '80.284', '81.285', '82.286', '83.287', '84.288', '85.289', '86.290', '87.291', '88.292', '89.293', '90.294', '91.295', '92.296', '93.297', '94.298', '95.299', '96.300', '97.301', '98.302', '99.303', '100.304', '101.305', '102.306', '103.307', '104.308', '105.309', '106.310', '107.311', '108.312', '109.313', '110.314', '111.315', '112.316', '113.317', '114.318', '115.319', '116.320', '117.321', '118.322', '119.323', '120.324', '121.325', '122.326', '123.327', '124.328', '125.329', '126.330', '127.331', '128.332', '129.333', '130.334', '131.335', '132.336', '133.337', '134.338', '135.339', '136.340', '137.341', '138.342', '139.343', '140.344', '141.345', '142.346', '143.347', '144.348', '145.349', '146.350', '147.351', '148.352', '149.353', '150.354', '151.355', '152.356', '153.357', '154.358', '155.359', '156.360', '157.361', '158.362', '159.363', '160.364', '161.365', '162.366', '163.367', '164.368', '165.369', '166.370', '167.371', '168.372', '169.373', '170.374', '171.375', '172.376', '173.377', '174.378', '175.379', '176.380', '177.381', '178.382', '179.383', '180.384', '181.385', '182.386', '183.387', '184.388', '185.389', '186.390', '187.391', '188.392', '189.393', '190.394', '191.395', '192.396', '193.397', '194.398', '195.399', '196.400', '197.401', '198.402', '199.403', '200.404', '201.405', '202.406', '203.407', '204.408', '205.409', '206.410', '207.411', '208.412', '209.413', '210.414', '211.415', '212.416', '213.417', '214.418', '215.419', '216.420', '217.421', '218.422', '219.423', '220.424', '221.425', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.426', '238', '239', '240', '241', '242', '243', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468']), StandardNumbering(id='standardnumbering34', reference_id='BAH60832.1', numbered_id='KAI5807151.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '4.194', '5.195', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10.215', '11.216', '12.217', '13', '14.218', '15.219', '16.220', '17.221', '18.222', '19.223', '20.224', '21.225', '22.226', '23.227', '24.228', '25.229', '26.230', '27.231', '28.232', '29.233', '30.234', '31.235', '32.236', '33.237', '34.238', '35.239', '36.240', '37.241', '38.242', '39.243', '40.244', '41.245', '42.246', '43.247', '44.248', '45.249', '46.250', '47.251', '48.252', '49.253', '50.254', '51.255', '52.256', '53.257', '54.258', '55.259', '56.260', '57.261', '58.262', '59.263', '60.264', '61.265', '62.266', '63.267', '64.268', '65.269', '66.270', '67.271', '68.272', '69.273', '70.274', '71.275', '72.276', '73.277', '74.278', '75.279', '76.280', '77.281', '78.282', '79.283', '80.284', '81.285', '82.286', '83.287', '84.288', '85.289', '86.290', '87.291', '88.292', '89.293', '90.294', '91.295', '92.296', '93.297', '94.298', '95.299', '96.300', '97.301', '98.302', '99.303', '100.304', '101.305', '102.306', '103.307', '104.308', '105.309', '106.310', '107.311', '108.312', '109.313', '110.314', '111.315', '112.316', '113.317', '114.318', '115.319', '116.320', '117.321', '118.322', '119.323', '120.324', '121.325', '122.326', '123.327', '124.328', '125.329', '126.330', '127.331', '128.332', '129.333', '130.334', '131.335', '132.336', '133.337', '134.338', '135.339', '136.340', '137.341', '138.342', '139.343', '140.344', '141.345', '142.346', '143.347', '144.348', '145.349', '146.350', '147.351', '148.352', '149.353', '150.354', '151.355', '152.356', '153.357', '154.358', '155.359', '156.360', '157.361', '158.362', '159.363', '160.364', '161.365', '162.366', '163.367', '164.368', '165.369', '166.370', '167.371', '168.372', '169.373', '170.374', '171.375', '172.376', '173.377', '174.378', '175.379', '176.380', '177.381', '178.382', '179.383', '180.384', '181.385', '182.386', '183.387', '184.388', '185.389', '186.390', '187.391', '188.392', '189.393', '190.394', '191.395', '192.396', '193.397', '194.398', '195.399', '196.400', '197.401', '198.402', '199.403', '200.404', '201.405', '202.406', '203.407', '204.408', '205.409', '206.410', '207.411', '208.412', '209.413', '210.414', '211.415', '212.416', '213.417', '214.418', '215.419', '216.420', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.421', '238', '239', '240', '241', '242', '243', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463']), StandardNumbering(id='standardnumbering35', reference_id='BAH60832.1', numbered_id='XP_011117899.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17', '18.222', '19.223', '20.224', '21', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.425', '238', '239', '240', '241', '242', '243', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467']), StandardNumbering(id='standardnumbering36', reference_id='BAH60832.1', numbered_id='KAI1438264.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering37', reference_id='BAH60832.1', numbered_id='XP_022456167.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14', '15', '16', '17', '18', '19', '20', '21.212', '22.213', '23.214', '24.215', '25.216', '26.217', '27.218', '28.219', '29.220', '30.221', '31.222', '32.223', '33.224', '34.225', '35.226', '36.227', '37.228', '38.229', '39.230', '40.231', '41.232', '42.233', '43.234', '44.235', '45.236', '46.237', '47.238', '48.239', '49.240', '50.241', '51.242', '52.243', '53.244', '54.245', '55.246', '56.247', '57.248', '58.249', '59.250', '60.251', '61.252', '62.253', '63.254', '64.255', '65.256', '66.257', '67.258', '68.259', '69.260', '70.261', '71.262', '72.263', '73.264', '74.265', '75.266', '76.267', '77.268', '78.269', '79.270', '80.271', '81.272', '82.273', '83.274', '84.275', '85.276', '86.277', '87.278', '88.279', '89.280', '90.281', '91.282', '92.283', '93.284', '94.285', '95.286', '96.287', '97.288', '98.289', '99.290', '100.291', '101.292', '102.293', '103.294', '104.295', '105.296', '106.297', '107.298', '108.299', '109.300', '110.301', '111.302', '112.303', '113.304', '114.305', '115.306', '116.307', '117.308', '118.309', '119.310', '120.311', '121.312', '122.313', '123.314', '124.315', '125.316', '126.317', '127.318', '128.319', '129.320', '130.321', '131.322', '132.323', '133.324', '134.325', '135.326', '136.327', '137.328', '138.329', '139.330', '140.331', '141.332', '142.333', '143.334', '144.335', '145.336', '146.337', '147.338', '148.339', '149.340', '150.341', '151.342', '152.343', '153.344', '154.345', '155.346', '156.347', '157.348', '158.349', '159.350', '160.351', '161.352', '162.353', '163.354', '164.355', '165.356', '166.357', '167.358', '168.359', '169.360', '170.361', '171.362', '172.363', '173.364', '174.365', '175.366', '176.367', '177.368', '178.369', '179.370', '180.371', '181.372', '182.373', '183.374', '184.375', '185.376', '186.377', '187.378', '188.379', '189.380', '190.381', '191.382', '192.383', '193.384', '194.385', '195.386', '196.387', '197.388', '198.389', '199.390', '200.391', '201.392', '202.393', '203.394', '204.395', '205.396', '206.397', '207.398', '208.399', '209.400', '210.401', '211.402', '212.403', '213.404', '214.405', '215.406', '216.407', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.408', '238', '239', '240', '241', '242', '243', '243.409', '243.410', '243.411', '243.412', '243.413', '243.414', '243.415', '243.416', '243.417', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.418', '254.419', '254.420', '254.421', '254.422', '254.423', '254.424', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450']), StandardNumbering(id='standardnumbering38', reference_id='BAH60832.1', numbered_id='KAF3908940.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17', '18.222', '19.223', '20.224', '21.225', '22.226', '23.227', '24.228', '25.229', '26.230', '27.231', '28.232', '29.233', '30.234', '31.235', '32.236', '33.237', '34.238', '35.239', '36.240', '37.241', '38.242', '39.243', '40.244', '41.245', '42.246', '43.247', '44.248', '45.249', '46.250', '47.251', '48.252', '49.253', '50.254', '51.255', '52.256', '53.257', '54.258', '55.259', '56.260', '57.261', '58.262', '59.263', '60.264', '61.265', '62.266', '63.267', '64.268', '65.269', '66.270', '67.271', '68.272', '69.273', '70.274', '71.275', '72.276', '73.277', '74.278', '75.279', '76.280', '77.281', '78.282', '79.283', '80.284', '81.285', '82.286', '83.287', '84.288', '85.289', '86.290', '87.291', '88.292', '89.293', '90.294', '91.295', '92.296', '93.297', '94.298', '95.299', '96.300', '97.301', '98.302', '99.303', '100.304', '101.305', '102.306', '103.307', '104.308', '105.309', '106.310', '107.311', '108.312', '109.313', '110.314', '111.315', '112.316', '113.317', '114.318', '115.319', '116.320', '117.321', '118.322', '119.323', '120.324', '121.325', '122.326', '123.327', '124.328', '125.329', '126.330', '127.331', '128.332', '129.333', '130.334', '131.335', '132.336', '133.337', '134.338', '135.339', '136.340', '137.341', '138.342', '139.343', '140.344', '141.345', '142.346', '143.347', '144.348', '145.349', '146.350', '147.351', '148.352', '149.353', '150.354', '151.355', '152.356', '153.357', '154.358', '155.359', '156.360', '157.361', '158.362', '159.363', '160.364', '161.365', '162.366', '163.367', '164.368', '165.369', '166.370', '167.371', '168.372', '169.373', '170.374', '171.375', '172.376', '173.377', '174.378', '175.379', '176.380', '177.381', '178.382', '179.383', '180.384', '181.385', '182.386', '183.387', '184.388', '185.389', '186.390', '187.391', '188.392', '189.393', '190.394', '191.395', '192.396', '193.397', '194.398', '195.399', '196.400', '197.401', '198.402', '199.403', '200.404', '201.405', '202.406', '203.407', '204.408', '205.409', '206.410', '207.411', '208.412', '209.413', '210.414', '211.415', '212.416', '213.417', '214.418', '215.419', '216.420', '217.421', '218.422', '219.423', '220.424', '221.425', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.426', '238', '239', '240', '241', '242', '243', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468']), StandardNumbering(id='standardnumbering39', reference_id='BAH60832.1', numbered_id='XP_006693239.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5.196', '5.197', '5.198', '5.199', '5.200', '5.201', '6.202', '7.203', '7.204', '7.205', '7.206', '7.207', '7.208', '8', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '8.217', '9.218', '10.219', '11.220', '12.221', '13.222', '14.223', '15.224', '16.225', '17.226', '18.227', '19.228', '20.229', '21.230', '22.231', '23.232', '24.233', '25.234', '26.235', '27.236', '28.237', '29.238', '30.239', '31.240', '32.241', '33.242', '34.243', '35.244', '36.245', '37.246', '38.247', '39.248', '40.249', '41.250', '42.251', '43.252', '44.253', '45.254', '46.255', '47.256', '48.257', '49.258', '50.259', '51.260', '52.261', '53.262', '54.263', '55.264', '56.265', '57.266', '58.267', '59.268', '60.269', '61.270', '62.271', '63.272', '64.273', '65.274', '66.275', '67.276', '68.277', '69.278', '70.279', '71.280', '72.281', '73.282', '74.283', '75.284', '76.285', '77.286', '78.287', '79.288', '80.289', '81.290', '82.291', '83.292', '84.293', '85.294', '86.295', '87.296', '88.297', '89.298', '90.299', '91.300', '92.301', '93.302', '94.303', '95.304', '96.305', '97.306', '98.307', '99.308', '100.309', '101.310', '102.311', '103.312', '104.313', '105.314', '106.315', '107.316', '108.317', '109.318', '110.319', '111.320', '112.321', '113.322', '114.323', '115.324', '116.325', '117.326', '118.327', '119.328', '120.329', '121.330', '122.331', '123.332', '124.333', '125.334', '126.335', '127.336', '128.337', '129.338', '130.339', '131.340', '132.341', '133.342', '134.343', '135.344', '136.345', '137.346', '138.347', '139.348', '140.349', '141.350', '142.351', '143.352', '144.353', '145.354', '146.355', '147.356', '148.357', '149.358', '150.359', '151.360', '152.361', '153.362', '154.363', '155.364', '156.365', '157.366', '158.367', '159.368', '160.369', '161.370', '162.371', '163.372', '164.373', '165.374', '166.375', '167.376', '168.377', '169.378', '170.379', '171.380', '172.381', '173.382', '174.383', '175.384', '176.385', '177.386', '178.387', '179.388', '180.389', '181.390', '182.391', '183.392', '184.393', '185.394', '186.395', '187.396', '188.397', '189.398', '190.399', '191.400', '192.401', '193.402', '194.403', '195.404', '196.405', '197.406', '198.407', '199.408', '200.409', '201.410', '202.411', '203.412', '204.413', '205.414', '206.415', '207.416', '208.417', '209.418', '210.419', '211.420', '212.421', '213.422', '214.423', '215.424', '216.425', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.426', '238', '239', '240', '241', '242', '243', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468']), StandardNumbering(id='standardnumbering40', reference_id='BAH60832.1', numbered_id='EWC45326.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217.422', '218.423', '219.424', '220.425', '221.426', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.427', '238', '239', '240', '241', '242', '243', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '243.436', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469']), StandardNumbering(id='standardnumbering41', reference_id='BAH60832.1', numbered_id='KAF3930522.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19', '20', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217.420', '218.421', '219.422', '220.423', '221.424', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.425', '238', '239', '240', '241', '242', '243', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467']), StandardNumbering(id='standardnumbering42', reference_id='BAH60832.1', numbered_id='KAF8249497.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5.196', '5.197', '5.198', '5.199', '5.200', '5.201', '6', '7', '7.202', '7.203', '7.204', '7.205', '7.206', '8', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '9', '10', '11', '12', '13', '14', '15.216', '16.217', '17.218', '18.219', '19.220', '20.221', '21.222', '22.223', '23.224', '24.225', '25.226', '26.227', '27.228', '28.229', '29.230', '30.231', '31.232', '32.233', '33.234', '34.235', '35.236', '36.237', '37.238', '38.239', '39.240', '40.241', '41.242', '42.243', '43.244', '44.245', '45.246', '46.247', '47.248', '48.249', '49.250', '50.251', '51.252', '52.253', '53.254', '54.255', '55.256', '56.257', '57.258', '58.259', '59.260', '60.261', '61.262', '62.263', '63.264', '64.265', '65.266', '66.267', '67.268', '68.269', '69.270', '70.271', '71.272', '72.273', '73.274', '74.275', '75.276', '76.277', '77.278', '78.279', '79.280', '80.281', '81.282', '82.283', '83.284', '84.285', '85.286', '86.287', '87.288', '88.289', '89.290', '90.291', '91.292', '92.293', '93.294', '94.295', '95.296', '96.297', '97.298', '98.299', '99.300', '100.301', '101.302', '102.303', '103.304', '104.305', '105.306', '106.307', '107.308', '108.309', '109.310', '110.311', '111.312', '112.313', '113.314', '114.315', '115.316', '116.317', '117.318', '118.319', '119.320', '120.321', '121.322', '122.323', '123.324', '124.325', '125.326', '126.327', '127.328', '128.329', '129.330', '130.331', '131.332', '132.333', '133.334', '134.335', '135.336', '136.337', '137.338', '138.339', '139.340', '140.341', '141.342', '142.343', '143.344', '144.345', '145.346', '146.347', '147.348', '148.349', '149.350', '150.351', '151.352', '152.353', '153.354', '154.355', '155.356', '156.357', '157.358', '158.359', '159.360', '160.361', '161.362', '162.363', '163.364', '164.365', '165.366', '166.367', '167.368', '168.369', '169.370', '170.371', '171.372', '172.373', '173.374', '174.375', '175.376', '176.377', '177.378', '178.379', '179.380', '180.381', '181.382', '182.383', '183.384', '184.385', '185.386', '186.387', '187.388', '188.389', '189.390', '190.391', '191.392', '192.393', '193.394', '194.395', '195.396', '196.397', '197.398', '198.399', '199.400', '200.401', '201.402', '202.403', '203.404', '204.405', '205.406', '206.407', '207.408', '208.409', '209.410', '210.411', '211.412', '212.413', '213.414', '214.415', '215.416', '216.417', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.418', '238', '239', '240', '241', '242', '243', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460']), StandardNumbering(id='standardnumbering43', reference_id='BAH60832.1', numbered_id='XP_002174495.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14', '15', '16', '17', '18', '19.212', '20.213', '21.214', '22.215', '23.216', '24.217', '25.218', '26.219', '27.220', '28.221', '29.222', '30.223', '31.224', '32.225', '33.226', '34.227', '35.228', '36.229', '37.230', '38.231', '39.232', '40.233', '41.234', '42.235', '43.236', '44.237', '45.238', '46.239', '47.240', '48.241', '49.242', '50.243', '51.244', '52.245', '53.246', '54.247', '55.248', '56.249', '57.250', '58.251', '59.252', '60.253', '61.254', '62.255', '63.256', '64.257', '65.258', '66.259', '67.260', '68.261', '69.262', '70.263', '71.264', '72.265', '73.266', '74.267', '75.268', '76.269', '77.270', '78.271', '79.272', '80.273', '81.274', '82.275', '83.276', '84.277', '85.278', '86.279', '87.280', '88.281', '89.282', '90.283', '91.284', '92.285', '93.286', '94.287', '95.288', '96.289', '97.290', '98.291', '99.292', '100.293', '101.294', '102.295', '103.296', '104.297', '105.298', '106.299', '107.300', '108.301', '109.302', '110.303', '111.304', '112.305', '113.306', '114.307', '115.308', '116.309', '117.310', '118.311', '119.312', '120.313', '121.314', '122.315', '123.316', '124.317', '125.318', '126.319', '127.320', '128.321', '129.322', '130.323', '131.324', '132.325', '133.326', '134.327', '135.328', '136.329', '137.330', '138.331', '139.332', '140.333', '141.334', '142.335', '143.336', '144.337', '145.338', '146.339', '147.340', '148.341', '149.342', '150.343', '151.344', '152.345', '153.346', '154.347', '155.348', '156.349', '157.350', '158.351', '159.352', '160.353', '161.354', '162.355', '163.356', '164.357', '165.358', '166.359', '167.360', '168.361', '169.362', '170.363', '171.364', '172.365', '173.366', '174.367', '175.368', '176.369', '177.370', '178.371', '179.372', '180.373', '181.374', '182.375', '183.376', '184.377', '185.378', '186.379', '187.380', '188.381', '189.382', '190.383', '191.384', '192.385', '193.386', '194.387', '195.388', '196.389', '197.390', '198.391', '199.392', '200.393', '201.394', '202.395', '203.396', '204.397', '205.398', '206.399', '207.400', '208.401', '209.402', '210.403', '211.404', '212.405', '213.406', '214.407', '215.408', '216.409', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.410', '238', '239', '240', '241', '242', '243', '243.411', '243.412', '243.413', '243.414', '243.415', '243.416', '243.417', '243.418', '243.419', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.420', '254.421', '254.422', '254.423', '254.424', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452']), StandardNumbering(id='standardnumbering44', reference_id='BAH60832.1', numbered_id='PRP83484.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5.196', '5.197', '5.198', '5.199', '5.200', '5.201', '6', '7', '7.202', '7.203', '7.204', '7.205', '7.206', '8', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '9', '10', '11', '12', '13', '14', '15', '16.216', '17.217', '18.218', '19.219', '20.220', '21.221', '22.222', '23.223', '24.224', '25.225', '26.226', '27.227', '28.228', '29.229', '30.230', '31.231', '32.232', '33.233', '34.234', '35.235', '36.236', '37.237', '38.238', '39.239', '40.240', '41.241', '42.242', '43.243', '44.244', '45.245', '46.246', '47.247', '48.248', '49.249', '50.250', '51.251', '52.252', '53.253', '54.254', '55.255', '56.256', '57.257', '58.258', '59.259', '60.260', '61.261', '62.262', '63.263', '64.264', '65.265', '66.266', '67.267', '68.268', '69.269', '70.270', '71.271', '72.272', '73.273', '74.274', '75.275', '76.276', '77.277', '78.278', '79.279', '80.280', '81.281', '82.282', '83.283', '84.284', '85.285', '86.286', '87.287', '88.288', '89.289', '90.290', '91.291', '92.292', '93.293', '94.294', '95.295', '96.296', '97.297', '98.298', '99.299', '100.300', '101.301', '102.302', '103.303', '104.304', '105.305', '106.306', '107.307', '108.308', '109.309', '110.310', '111.311', '112.312', '113.313', '114.314', '115.315', '116.316', '117.317', '118.318', '119.319', '120.320', '121.321', '122.322', '123.323', '124.324', '125.325', '126.326', '127.327', '128.328', '129.329', '130.330', '131.331', '132.332', '133.333', '134.334', '135.335', '136.336', '137.337', '138.338', '139.339', '140.340', '141.341', '142.342', '143.343', '144.344', '145.345', '146.346', '147.347', '148.348', '149.349', '150.350', '151.351', '152.352', '153.353', '154.354', '155.355', '156.356', '157.357', '158.358', '159.359', '160.360', '161.361', '162.362', '163.363', '164.364', '165.365', '166.366', '167.367', '168.368', '169.369', '170.370', '171.371', '172.372', '173.373', '174.374', '175.375', '176.376', '177.377', '178.378', '179.379', '180.380', '181.381', '182.382', '183.383', '184.384', '185.385', '186.386', '187.387', '188.388', '189.389', '190.390', '191.391', '192.392', '193.393', '194.394', '195.395', '196.396', '197.397', '198.398', '199.399', '200.400', '201.401', '202.402', '203.403', '204.404', '205.405', '206.406', '207.407', '208.408', '209.409', '210.410', '211.411', '212.412', '213.413', '214.414', '215.415', '216.416', '217.417', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.418', '238', '239', '240', '241', '242', '243', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460']), StandardNumbering(id='standardnumbering45', reference_id='BAH60832.1', numbered_id='GAA97202.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10.214', '11.215', '12.216', '13', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.420', '238', '239', '240', '241', '242', '243', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462']), StandardNumbering(id='standardnumbering46', reference_id='BAH60832.1', numbered_id='OBA26219.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1.181', '2.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '3.195', '4', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6.201', '7.202', '7.203', '7.204', '7.205', '7.206', '7.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '8.217', '9.218', '10.219', '11.220', '12.221', '13.222', '14.223', '15.224', '16.225', '17.226', '18.227', '19.228', '20.229', '21.230', '22.231', '23.232', '24.233', '25.234', '26.235', '27.236', '28.237', '29.238', '30.239', '31.240', '32.241', '33.242', '34.243', '35.244', '36.245', '37.246', '38.247', '39.248', '40.249', '41.250', '42.251', '43.252', '44.253', '45.254', '46.255', '47.256', '48.257', '49.258', '50.259', '51.260', '52.261', '53.262', '54.263', '55.264', '56.265', '57.266', '58.267', '59.268', '60.269', '61.270', '62.271', '63.272', '64.273', '65.274', '66.275', '67.276', '68.277', '69.278', '70.279', '71.280', '72.281', '73.282', '74.283', '75.284', '76.285', '77.286', '78.287', '79.288', '80.289', '81.290', '82.291', '83.292', '84.293', '85.294', '86.295', '87.296', '88.297', '89.298', '90.299', '91.300', '92.301', '93.302', '94.303', '95.304', '96.305', '97.306', '98.307', '99.308', '100.309', '101.310', '102.311', '103.312', '104.313', '105.314', '106.315', '107.316', '108.317', '109.318', '110.319', '111.320', '112.321', '113.322', '114.323', '115.324', '116.325', '117.326', '118.327', '119.328', '120.329', '121.330', '122.331', '123.332', '124.333', '125.334', '126.335', '127.336', '128.337', '129.338', '130.339', '131.340', '132.341', '133.342', '134.343', '135.344', '136.345', '137.346', '138.347', '139.348', '140.349', '141.350', '142.351', '143.352', '144.353', '145.354', '146.355', '147.356', '148.357', '149.358', '150.359', '151.360', '152.361', '153.362', '154.363', '155.364', '156.365', '157.366', '158.367', '159.368', '160.369', '161.370', '162.371', '163.372', '164.373', '165.374', '166.375', '167.376', '168.377', '169.378', '170.379', '171.380', '172.381', '173.382', '174.383', '175.384', '176.385', '177.386', '178.387', '179.388', '180.389', '181.390', '182.391', '183.392', '184.393', '185.394', '186.395', '187.396', '188.397', '189.398', '190.399', '191.400', '192.401', '193.402', '194.403', '195.404', '196.405', '197.406', '198.407', '199.408', '200.409', '201.410', '202.411', '203.412', '204.413', '205.414', '206.415', '207.416', '208.417', '209.418', '210.419', '211.420', '212.421', '213.422', '214.423', '215.424', '216.425', '217.426', '218.427', '219.428', '220.429', '221.430', '222.431', '223.432', '224.433', '225.434', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.435', '238', '239', '240', '241', '242', '243', '243.436', '243.437', '243.438', '243.439', '243.440', '243.441', '243.442', '243.443', '243.444', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469', '254.470', '254.471', '254.472', '254.473', '254.474', '254.475', '254.476', '254.477']), StandardNumbering(id='standardnumbering47', reference_id='BAH60832.1', numbered_id='KAI1823332.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering48', reference_id='BAH60832.1', numbered_id='CDO57487.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5.196', '5.197', '5.198', '5.199', '5.200', '5.201', '6', '7', '7.202', '7.203', '7.204', '7.205', '7.206', '8', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '9', '10', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering49', reference_id='BAH60832.1', numbered_id='KAI2629167.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.419', '238', '239', '240', '241', '242', '243', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461']), StandardNumbering(id='standardnumbering50', reference_id='BAH60832.1', numbered_id='KAI5811198.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9.215', '10.216', '11.217', '12.218', '13.219', '14.220', '15.221', '16.222', '17.223', '18.224', '19.225', '20.226', '21.227', '22.228', '23.229', '24.230', '25.231', '26.232', '27.233', '28.234', '29.235', '30.236', '31.237', '32.238', '33.239', '34.240', '35.241', '36.242', '37.243', '38.244', '39.245', '40.246', '41.247', '42.248', '43.249', '44.250', '45.251', '46.252', '47.253', '48.254', '49.255', '50.256', '51.257', '52.258', '53.259', '54.260', '55.261', '56.262', '57.263', '58.264', '59.265', '60.266', '61.267', '62.268', '63.269', '64.270', '65.271', '66.272', '67.273', '68.274', '69.275', '70.276', '71.277', '72.278', '73.279', '74.280', '75.281', '76.282', '77.283', '78.284', '79.285', '80.286', '81.287', '82.288', '83.289', '84.290', '85.291', '86.292', '87.293', '88.294', '89.295', '90.296', '91.297', '92.298', '93.299', '94.300', '95.301', '96.302', '97.303', '98.304', '99.305', '100.306', '101.307', '102.308', '103.309', '104.310', '105.311', '106.312', '107.313', '108.314', '109.315', '110.316', '111.317', '112.318', '113.319', '114.320', '115.321', '116.322', '117.323', '118.324', '119.325', '120.326', '121.327', '122.328', '123.329', '124.330', '125.331', '126.332', '127.333', '128.334', '129.335', '130.336', '131.337', '132.338', '133.339', '134.340', '135.341', '136.342', '137.343', '138.344', '139.345', '140.346', '141.347', '142.348', '143.349', '144.350', '145.351', '146.352', '147.353', '148.354', '149.355', '150.356', '151.357', '152.358', '153.359', '154.360', '155.361', '156.362', '157.363', '158.364', '159.365', '160.366', '161.367', '162.368', '163.369', '164.370', '165.371', '166.372', '167.373', '168.374', '169.375', '170.376', '171.377', '172.378', '173.379', '174.380', '175.381', '176.382', '177.383', '178.384', '179.385', '180.386', '181.387', '182.388', '183.389', '184.390', '185.391', '186.392', '187.393', '188.394', '189.395', '190.396', '191.397', '192.398', '193.399', '194.400', '195.401', '196.402', '197.403', '198.404', '199.405', '200.406', '201.407', '202.408', '203.409', '204.410', '205.411', '206.412', '207.413', '208.414', '209.415', '210.416', '211.417', '212.418', '213.419', '214.420', '215.421', '216.422', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.423', '238', '239', '240', '241', '242', '243', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465']), StandardNumbering(id='standardnumbering51', reference_id='BAH60832.1', numbered_id='KAG9017701.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10.214', '11.215', '12.216', '13', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.420', '238', '239', '240', '241', '242', '243', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462']), StandardNumbering(id='standardnumbering52', reference_id='BAH60832.1', numbered_id='OTA67948.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.419', '238', '239', '240', '241', '242', '243', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461']), StandardNumbering(id='standardnumbering53', reference_id='BAH60832.1', numbered_id='KAH6626466.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6.201', '7.202', '7.203', '7.204', '7.205', '7.206', '7.207', '8', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '9', '10', '11.217', '12.218', '13.219', '14.220', '15.221', '16.222', '17.223', '18.224', '19.225', '20.226', '21.227', '22.228', '23.229', '24.230', '25.231', '26.232', '27.233', '28.234', '29.235', '30.236', '31.237', '32.238', '33.239', '34.240', '35.241', '36.242', '37.243', '38.244', '39.245', '40.246', '41.247', '42.248', '43.249', '44.250', '45.251', '46.252', '47.253', '48.254', '49.255', '50.256', '51.257', '52.258', '53.259', '54.260', '55.261', '56.262', '57.263', '58.264', '59.265', '60.266', '61.267', '62.268', '63.269', '64.270', '65.271', '66.272', '67.273', '68.274', '69.275', '70.276', '71.277', '72.278', '73.279', '74.280', '75.281', '76.282', '77.283', '78.284', '79.285', '80.286', '81.287', '82.288', '83.289', '84.290', '85.291', '86.292', '87.293', '88.294', '89.295', '90.296', '91.297', '92.298', '93.299', '94.300', '95.301', '96.302', '97.303', '98.304', '99.305', '100.306', '101.307', '102.308', '103.309', '104.310', '105.311', '106.312', '107.313', '108.314', '109.315', '110.316', '111.317', '112.318', '113.319', '114.320', '115.321', '116.322', '117.323', '118.324', '119.325', '120.326', '121.327', '122.328', '123.329', '124.330', '125.331', '126.332', '127.333', '128.334', '129.335', '130.336', '131.337', '132.338', '133.339', '134.340', '135.341', '136.342', '137.343', '138.344', '139.345', '140.346', '141.347', '142.348', '143.349', '144.350', '145.351', '146.352', '147.353', '148.354', '149.355', '150.356', '151.357', '152.358', '153.359', '154.360', '155.361', '156.362', '157.363', '158.364', '159.365', '160.366', '161.367', '162.368', '163.369', '164.370', '165.371', '166.372', '167.373', '168.374', '169.375', '170.376', '171.377', '172.378', '173.379', '174.380', '175.381', '176.382', '177.383', '178.384', '179.385', '180.386', '181.387', '182.388', '183.389', '184.390', '185.391', '186.392', '187.393', '188.394', '189.395', '190.396', '191.397', '192.398', '193.399', '194.400', '195.401', '196.402', '197.403', '198.404', '199.405', '200.406', '201.407', '202.408', '203.409', '204.410', '205.411', '206.412', '207.413', '208.414', '209.415', '210.416', '211.417', '212.418', '213.419', '214.420', '215.421', '216.422', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.423', '238', '239', '240', '241', '242', '243', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465']), StandardNumbering(id='standardnumbering54', reference_id='BAH60832.1', numbered_id='ORX96310.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14', '15', '16', '17.212', '18.213', '19.214', '20.215', '21.216', '22.217', '23.218', '24.219', '25.220', '26.221', '27.222', '28.223', '29.224', '30.225', '31.226', '32.227', '33.228', '34.229', '35.230', '36.231', '37.232', '38.233', '39.234', '40.235', '41.236', '42.237', '43.238', '44.239', '45.240', '46.241', '47.242', '48.243', '49.244', '50.245', '51.246', '52.247', '53.248', '54.249', '55.250', '56.251', '57.252', '58.253', '59.254', '60.255', '61.256', '62.257', '63.258', '64.259', '65.260', '66.261', '67.262', '68.263', '69.264', '70.265', '71.266', '72.267', '73.268', '74.269', '75.270', '76.271', '77.272', '78.273', '79.274', '80.275', '81.276', '82.277', '83.278', '84.279', '85.280', '86.281', '87.282', '88.283', '89.284', '90.285', '91.286', '92.287', '93.288', '94.289', '95.290', '96.291', '97.292', '98.293', '99.294', '100.295', '101.296', '102.297', '103.298', '104.299', '105.300', '106.301', '107.302', '108.303', '109.304', '110.305', '111.306', '112.307', '113.308', '114.309', '115.310', '116.311', '117.312', '118.313', '119.314', '120.315', '121.316', '122.317', '123.318', '124.319', '125.320', '126.321', '127.322', '128.323', '129.324', '130.325', '131.326', '132.327', '133.328', '134.329', '135.330', '136.331', '137.332', '138.333', '139.334', '140.335', '141.336', '142.337', '143.338', '144.339', '145.340', '146.341', '147.342', '148.343', '149.344', '150.345', '151.346', '152.347', '153.348', '154.349', '155.350', '156.351', '157.352', '158.353', '159.354', '160.355', '161.356', '162.357', '163.358', '164.359', '165.360', '166.361', '167.362', '168.363', '169.364', '170.365', '171.366', '172.367', '173.368', '174.369', '175.370', '176.371', '177.372', '178.373', '179.374', '180.375', '181.376', '182.377', '183.378', '184.379', '185.380', '186.381', '187.382', '188.383', '189.384', '190.385', '191.386', '192.387', '193.388', '194.389', '195.390', '196.391', '197.392', '198.393', '199.394', '200.395', '201.396', '202.397', '203.398', '204.399', '205.400', '206.401', '207.402', '208.403', '209.404', '210.405', '211.406', '212.407', '213.408', '214.409', '215.410', '216.411', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.412', '238', '239', '240', '241', '242', '243', '243.413', '243.414', '243.415', '243.416', '243.417', '243.418', '243.419', '243.420', '243.421', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.422', '254.423', '254.424', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454']), StandardNumbering(id='standardnumbering55', reference_id='BAH60832.1', numbered_id='XP_028477951.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '4', '5', '5.194', '5.195', '5.196', '5.197', '5.198', '6', '7', '7.199', '7.200', '7.201', '7.202', '7.203', '8', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '9.213', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.420', '238', '239', '240', '241', '242', '243', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462']), StandardNumbering(id='standardnumbering56', reference_id='BAH60832.1', numbered_id='XP_024666830.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11.212', '12.213', '13.214', '14.215', '15.216', '16.217', '17.218', '18.219', '19.220', '20.221', '21.222', '22.223', '23.224', '24.225', '25.226', '26.227', '27.228', '28.229', '29.230', '30.231', '31.232', '32.233', '33.234', '34.235', '35.236', '36.237', '37.238', '38.239', '39.240', '40.241', '41.242', '42.243', '43.244', '44.245', '45.246', '46.247', '47.248', '48.249', '49.250', '50.251', '51.252', '52.253', '53.254', '54.255', '55.256', '56.257', '57.258', '58.259', '59.260', '60.261', '61.262', '62.263', '63.264', '64.265', '65.266', '66.267', '67.268', '68.269', '69.270', '70.271', '71.272', '72.273', '73.274', '74.275', '75.276', '76.277', '77.278', '78.279', '79.280', '80.281', '81.282', '82.283', '83.284', '84.285', '85.286', '86.287', '87.288', '88.289', '89.290', '90.291', '91.292', '92.293', '93.294', '94.295', '95.296', '96.297', '97.298', '98.299', '99.300', '100.301', '101.302', '102.303', '103.304', '104.305', '105.306', '106.307', '107.308', '108.309', '109.310', '110.311', '111.312', '112.313', '113.314', '114.315', '115.316', '116.317', '117.318', '118.319', '119.320', '120.321', '121.322', '122.323', '123.324', '124.325', '125.326', '126.327', '127.328', '128.329', '129.330', '130.331', '131.332', '132.333', '133.334', '134.335', '135.336', '136.337', '137.338', '138.339', '139.340', '140.341', '141.342', '142.343', '143.344', '144.345', '145.346', '146.347', '147.348', '148.349', '149.350', '150.351', '151.352', '152.353', '153.354', '154.355', '155.356', '156.357', '157.358', '158.359', '159.360', '160.361', '161.362', '162.363', '163.364', '164.365', '165.366', '166.367', '167.368', '168.369', '169.370', '170.371', '171.372', '172.373', '173.374', '174.375', '175.376', '176.377', '177.378', '178.379', '179.380', '180.381', '181.382', '182.383', '183.384', '184.385', '185.386', '186.387', '187.388', '188.389', '189.390', '190.391', '191.392', '192.393', '193.394', '194.395', '195.396', '196.397', '197.398', '198.399', '199.400', '200.401', '201.402', '202.403', '203.404', '204.405', '205.406', '206.407', '207.408', '208.409', '209.410', '210.411', '211.412', '212.413', '213.414', '214.415', '215.416', '216.417', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.418', '238', '239', '240', '241', '242', '243', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460']), StandardNumbering(id='standardnumbering57', reference_id='BAH60832.1', numbered_id='KAI0099584.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.419', '238', '239', '240', '241', '242', '243', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461']), StandardNumbering(id='standardnumbering58', reference_id='BAH60832.1', numbered_id='KAI1801530.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.419', '238', '239', '240', '241', '242', '243', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461']), StandardNumbering(id='standardnumbering59', reference_id='BAH60832.1', numbered_id='KAF9351078.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14', '15.212', '16.213', '17.214', '18.215', '19.216', '20.217', '21.218', '22.219', '23.220', '24.221', '25.222', '26.223', '27.224', '28.225', '29.226', '30.227', '31.228', '32.229', '33.230', '34.231', '35.232', '36.233', '37.234', '38.235', '39.236', '40.237', '41.238', '42.239', '43.240', '44.241', '45.242', '46.243', '47.244', '48.245', '49.246', '50.247', '51.248', '52.249', '53.250', '54.251', '55.252', '56.253', '57.254', '58.255', '59.256', '60.257', '61.258', '62.259', '63.260', '64.261', '65.262', '66.263', '67.264', '68.265', '69.266', '70.267', '71.268', '72.269', '73.270', '74.271', '75.272', '76.273', '77.274', '78.275', '79.276', '80.277', '81.278', '82.279', '83.280', '84.281', '85.282', '86.283', '87.284', '88.285', '89.286', '90.287', '91.288', '92.289', '93.290', '94.291', '95.292', '96.293', '97.294', '98.295', '99.296', '100.297', '101.298', '102.299', '103.300', '104.301', '105.302', '106.303', '107.304', '108.305', '109.306', '110.307', '111.308', '112.309', '113.310', '114.311', '115.312', '116.313', '117.314', '118.315', '119.316', '120.317', '121.318', '122.319', '123.320', '124.321', '125.322', '126.323', '127.324', '128.325', '129.326', '130.327', '131.328', '132.329', '133.330', '134.331', '135.332', '136.333', '137.334', '138.335', '139.336', '140.337', '141.338', '142.339', '143.340', '144.341', '145.342', '146.343', '147.344', '148.345', '149.346', '150.347', '151.348', '152.349', '153.350', '154.351', '155.352', '156.353', '157.354', '158.355', '159.356', '160.357', '161.358', '162.359', '163.360', '164.361', '165.362', '166.363', '167.364', '168.365', '169.366', '170.367', '171.368', '172.369', '173.370', '174.371', '175.372', '176.373', '177.374', '178.375', '179.376', '180.377', '181.378', '182.379', '183.380', '184.381', '185.382', '186.383', '187.384', '188.385', '189.386', '190.387', '191.388', '192.389', '193.390', '194.391', '195.392', '196.393', '197.394', '198.395', '199.396', '200.397', '201.398', '202.399', '203.400', '204.401', '205.402', '206.403', '207.404', '208.405', '209.406', '210.407', '211.408', '212.409', '213.410', '214.411', '215.412', '216.413', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.414', '238', '239', '240', '241', '242', '243', '243.415', '243.416', '243.417', '243.418', '243.419', '243.420', '243.421', '243.422', '243.423', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.424', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456']), StandardNumbering(id='standardnumbering60', reference_id='BAH60832.1', numbered_id='KAF9160900.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11', '12', '13', '14', '15', '16', '17', '18.214', '19.215', '20', '21', '22.216', '23.217', '24.218', '25.219', '26.220', '27.221', '28.222', '29.223', '30.224', '31.225', '32.226', '33.227', '34.228', '35.229', '36.230', '37.231', '38.232', '39.233', '40.234', '41.235', '42.236', '43.237', '44.238', '45.239', '46.240', '47.241', '48.242', '49.243', '50.244', '51.245', '52.246', '53.247', '54.248', '55.249', '56.250', '57.251', '58.252', '59.253', '60.254', '61.255', '62.256', '63.257', '64.258', '65.259', '66.260', '67.261', '68.262', '69.263', '70.264', '71.265', '72.266', '73.267', '74.268', '75.269', '76.270', '77.271', '78.272', '79.273', '80.274', '81.275', '82.276', '83.277', '84.278', '85.279', '86.280', '87.281', '88.282', '89.283', '90.284', '91.285', '92.286', '93.287', '94.288', '95.289', '96.290', '97.291', '98.292', '99.293', '100.294', '101.295', '102.296', '103.297', '104.298', '105.299', '106.300', '107.301', '108.302', '109.303', '110.304', '111.305', '112.306', '113.307', '114.308', '115.309', '116.310', '117.311', '118.312', '119.313', '120.314', '121.315', '122.316', '123.317', '124.318', '125.319', '126.320', '127.321', '128.322', '129.323', '130.324', '131.325', '132.326', '133.327', '134.328', '135.329', '136.330', '137.331', '138.332', '139.333', '140.334', '141.335', '142.336', '143.337', '144.338', '145.339', '146.340', '147.341', '148.342', '149.343', '150.344', '151.345', '152.346', '153.347', '154.348', '155.349', '156.350', '157.351', '158.352', '159.353', '160.354', '161.355', '162.356', '163.357', '164.358', '165.359', '166.360', '167.361', '168.362', '169.363', '170.364', '171.365', '172.366', '173.367', '174.368', '175.369', '176.370', '177.371', '178.372', '179.373', '180.374', '181.375', '182.376', '183.377', '184.378', '185.379', '186.380', '187.381', '188.382', '189.383', '190.384', '191.385', '192.386', '193.387', '194.388', '195.389', '196.390', '197.391', '198.392', '199.393', '200.394', '201.395', '202.396', '203.397', '204.398', '205.399', '206.400', '207.401', '208.402', '209.403', '210.404', '211.405', '212.406', '213.407', '214.408', '215.409', '216.410', '217.411', '218.412', '219.413', '220.414', '221.415', '222.416', '223.417', '224.418', '225.419', '226.420', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.421', '238', '239', '240', '241', '242', '243', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463']), StandardNumbering(id='standardnumbering61', reference_id='BAH60832.1', numbered_id='KAG0263740.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11', '12', '13', '14', '15.214', '16.215', '17.216', '18.217', '19.218', '20', '21', '22.219', '23.220', '24.221', '25.222', '26.223', '27.224', '28.225', '29.226', '30.227', '31.228', '32.229', '33.230', '34.231', '35.232', '36.233', '37.234', '38.235', '39.236', '40.237', '41.238', '42.239', '43.240', '44.241', '45.242', '46.243', '47.244', '48.245', '49.246', '50.247', '51.248', '52.249', '53.250', '54.251', '55.252', '56.253', '57.254', '58.255', '59.256', '60.257', '61.258', '62.259', '63.260', '64.261', '65.262', '66.263', '67.264', '68.265', '69.266', '70.267', '71.268', '72.269', '73.270', '74.271', '75.272', '76.273', '77.274', '78.275', '79.276', '80.277', '81.278', '82.279', '83.280', '84.281', '85.282', '86.283', '87.284', '88.285', '89.286', '90.287', '91.288', '92.289', '93.290', '94.291', '95.292', '96.293', '97.294', '98.295', '99.296', '100.297', '101.298', '102.299', '103.300', '104.301', '105.302', '106.303', '107.304', '108.305', '109.306', '110.307', '111.308', '112.309', '113.310', '114.311', '115.312', '116.313', '117.314', '118.315', '119.316', '120.317', '121.318', '122.319', '123.320', '124.321', '125.322', '126.323', '127.324', '128.325', '129.326', '130.327', '131.328', '132.329', '133.330', '134.331', '135.332', '136.333', '137.334', '138.335', '139.336', '140.337', '141.338', '142.339', '143.340', '144.341', '145.342', '146.343', '147.344', '148.345', '149.346', '150.347', '151.348', '152.349', '153.350', '154.351', '155.352', '156.353', '157.354', '158.355', '159.356', '160.357', '161.358', '162.359', '163.360', '164.361', '165.362', '166.363', '167.364', '168.365', '169.366', '170.367', '171.368', '172.369', '173.370', '174.371', '175.372', '176.373', '177.374', '178.375', '179.376', '180.377', '181.378', '182.379', '183.380', '184.381', '185.382', '186.383', '187.384', '188.385', '189.386', '190.387', '191.388', '192.389', '193.390', '194.391', '195.392', '196.393', '197.394', '198.395', '199.396', '200.397', '201.398', '202.399', '203.400', '204.401', '205.402', '206.403', '207.404', '208.405', '209.406', '210.407', '211.408', '212.409', '213.410', '214.411', '215.412', '216.413', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.414', '238', '239', '240', '241', '242', '243', '243.415', '243.416', '243.417', '243.418', '243.419', '243.420', '243.421', '243.422', '243.423', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.424', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456']), StandardNumbering(id='standardnumbering62', reference_id='BAH60832.1', numbered_id='KAI1135662.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.419', '238', '239', '240', '241', '242', '243', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461']), StandardNumbering(id='standardnumbering63', reference_id='BAH60832.1', numbered_id='XP_045969802.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11', '12', '13', '14.214', '15.215', '16.216', '17.217', '18.218', '19.219', '20.220', '21.221', '22.222', '23.223', '24.224', '25.225', '26.226', '27.227', '28.228', '29.229', '30.230', '31.231', '32.232', '33.233', '34.234', '35.235', '36.236', '37.237', '38.238', '39.239', '40.240', '41.241', '42.242', '43.243', '44.244', '45.245', '46.246', '47.247', '48.248', '49.249', '50.250', '51.251', '52.252', '53.253', '54.254', '55.255', '56.256', '57.257', '58.258', '59.259', '60.260', '61.261', '62.262', '63.263', '64.264', '65.265', '66.266', '67.267', '68.268', '69.269', '70.270', '71.271', '72.272', '73.273', '74.274', '75.275', '76.276', '77.277', '78.278', '79.279', '80.280', '81.281', '82.282', '83.283', '84.284', '85.285', '86.286', '87.287', '88.288', '89.289', '90.290', '91.291', '92.292', '93.293', '94.294', '95.295', '96.296', '97.297', '98.298', '99.299', '100.300', '101.301', '102.302', '103.303', '104.304', '105.305', '106.306', '107.307', '108.308', '109.309', '110.310', '111.311', '112.312', '113.313', '114.314', '115.315', '116.316', '117.317', '118.318', '119.319', '120.320', '121.321', '122.322', '123.323', '124.324', '125.325', '126.326', '127.327', '128.328', '129.329', '130.330', '131.331', '132.332', '133.333', '134.334', '135.335', '136.336', '137.337', '138.338', '139.339', '140.340', '141.341', '142.342', '143.343', '144.344', '145.345', '146.346', '147.347', '148.348', '149.349', '150.350', '151.351', '152.352', '153.353', '154.354', '155.355', '156.356', '157.357', '158.358', '159.359', '160.360', '161.361', '162.362', '163.363', '164.364', '165.365', '166.366', '167.367', '168.368', '169.369', '170.370', '171.371', '172.372', '173.373', '174.374', '175.375', '176.376', '177.377', '178.378', '179.379', '180.380', '181.381', '182.382', '183.383', '184.384', '185.385', '186.386', '187.387', '188.388', '189.389', '190.390', '191.391', '192.392', '193.393', '194.394', '195.395', '196.396', '197.397', '198.398', '199.399', '200.400', '201.401', '202.402', '203.403', '204.404', '205.405', '206.406', '207.407', '208.408', '209.409', '210.410', '211.411', '212.412', '213.413', '214.414', '215.415', '216.416', '217.417', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.418', '238', '239', '240', '241', '242', '243', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460']), StandardNumbering(id='standardnumbering64', reference_id='BAH60832.1', numbered_id='KAI1414505.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.419', '238', '239', '240', '241', '242', '243', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461']), StandardNumbering(id='standardnumbering65', reference_id='BAH60832.1', numbered_id='KAG0239750.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11', '12', '13', '14', '15.214', '16.215', '17.216', '18.217', '19.218', '20.219', '21.220', '22.221', '23.222', '24.223', '25.224', '26.225', '27.226', '28.227', '29.228', '30.229', '31.230', '32.231', '33.232', '34.233', '35.234', '36.235', '37.236', '38.237', '39.238', '40.239', '41.240', '42.241', '43.242', '44.243', '45.244', '46.245', '47.246', '48.247', '49.248', '50.249', '51.250', '52.251', '53.252', '54.253', '55.254', '56.255', '57.256', '58.257', '59.258', '60.259', '61.260', '62.261', '63.262', '64.263', '65.264', '66.265', '67.266', '68.267', '69.268', '70.269', '71.270', '72.271', '73.272', '74.273', '75.274', '76.275', '77.276', '78.277', '79.278', '80.279', '81.280', '82.281', '83.282', '84.283', '85.284', '86.285', '87.286', '88.287', '89.288', '90.289', '91.290', '92.291', '93.292', '94.293', '95.294', '96.295', '97.296', '98.297', '99.298', '100.299', '101.300', '102.301', '103.302', '104.303', '105.304', '106.305', '107.306', '108.307', '109.308', '110.309', '111.310', '112.311', '113.312', '114.313', '115.314', '116.315', '117.316', '118.317', '119.318', '120.319', '121.320', '122.321', '123.322', '124.323', '125.324', '126.325', '127.326', '128.327', '129.328', '130.329', '131.330', '132.331', '133.332', '134.333', '135.334', '136.335', '137.336', '138.337', '139.338', '140.339', '141.340', '142.341', '143.342', '144.343', '145.344', '146.345', '147.346', '148.347', '149.348', '150.349', '151.350', '152.351', '153.352', '154.353', '155.354', '156.355', '157.356', '158.357', '159.358', '160.359', '161.360', '162.361', '163.362', '164.363', '165.364', '166.365', '167.366', '168.367', '169.368', '170.369', '171.370', '172.371', '173.372', '174.373', '175.374', '176.375', '177.376', '178.377', '179.378', '180.379', '181.380', '182.381', '183.382', '184.383', '185.384', '186.385', '187.386', '188.387', '189.388', '190.389', '191.390', '192.391', '193.392', '194.393', '195.394', '196.395', '197.396', '198.397', '199.398', '200.399', '201.400', '202.401', '203.402', '204.403', '205.404', '206.405', '207.406', '208.407', '209.408', '210.409', '211.410', '212.411', '213.412', '214.413', '215.414', '216.415', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.416', '238', '239', '240', '241', '242', '243', '243.417', '243.418', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458']), StandardNumbering(id='standardnumbering66', reference_id='BAH60832.1', numbered_id='XP_044688071.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11', '12', '13', '14.214', '15.215', '16.216', '17.217', '18.218', '19.219', '20.220', '21.221', '22.222', '23.223', '24.224', '25.225', '26.226', '27.227', '28.228', '29.229', '30.230', '31.231', '32.232', '33.233', '34.234', '35.235', '36.236', '37.237', '38.238', '39.239', '40.240', '41.241', '42.242', '43.243', '44.244', '45.245', '46.246', '47.247', '48.248', '49.249', '50.250', '51.251', '52.252', '53.253', '54.254', '55.255', '56.256', '57.257', '58.258', '59.259', '60.260', '61.261', '62.262', '63.263', '64.264', '65.265', '66.266', '67.267', '68.268', '69.269', '70.270', '71.271', '72.272', '73.273', '74.274', '75.275', '76.276', '77.277', '78.278', '79.279', '80.280', '81.281', '82.282', '83.283', '84.284', '85.285', '86.286', '87.287', '88.288', '89.289', '90.290', '91.291', '92.292', '93.293', '94.294', '95.295', '96.296', '97.297', '98.298', '99.299', '100.300', '101.301', '102.302', '103.303', '104.304', '105.305', '106.306', '107.307', '108.308', '109.309', '110.310', '111.311', '112.312', '113.313', '114.314', '115.315', '116.316', '117.317', '118.318', '119.319', '120.320', '121.321', '122.322', '123.323', '124.324', '125.325', '126.326', '127.327', '128.328', '129.329', '130.330', '131.331', '132.332', '133.333', '134.334', '135.335', '136.336', '137.337', '138.338', '139.339', '140.340', '141.341', '142.342', '143.343', '144.344', '145.345', '146.346', '147.347', '148.348', '149.349', '150.350', '151.351', '152.352', '153.353', '154.354', '155.355', '156.356', '157.357', '158.358', '159.359', '160.360', '161.361', '162.362', '163.363', '164.364', '165.365', '166.366', '167.367', '168.368', '169.369', '170.370', '171.371', '172.372', '173.373', '174.374', '175.375', '176.376', '177.377', '178.378', '179.379', '180.380', '181.381', '182.382', '183.383', '184.384', '185.385', '186.386', '187.387', '188.388', '189.389', '190.390', '191.391', '192.392', '193.393', '194.394', '195.395', '196.396', '197.397', '198.398', '199.399', '200.400', '201.401', '202.402', '203.403', '204.404', '205.405', '206.406', '207.407', '208.408', '209.409', '210.410', '211.411', '212.412', '213.413', '214.414', '215.415', '216.416', '217.417', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.418', '238', '239', '240', '241', '242', '243', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460']), StandardNumbering(id='standardnumbering67', reference_id='BAH60832.1', numbered_id='RPB01516.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '4.194', '5.195', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10', '11', '12', '13', '14', '15', '16.215', '17.216', '18.217', '19.218', '20.219', '21.220', '22.221', '23.222', '24.223', '25.224', '26.225', '27.226', '28.227', '29.228', '30.229', '31.230', '32.231', '33.232', '34.233', '35.234', '36.235', '37.236', '38.237', '39.238', '40.239', '41.240', '42.241', '43.242', '44.243', '45.244', '46.245', '47.246', '48.247', '49.248', '50.249', '51.250', '52.251', '53.252', '54.253', '55.254', '56.255', '57.256', '58.257', '59.258', '60.259', '61.260', '62.261', '63.262', '64.263', '65.264', '66.265', '67.266', '68.267', '69.268', '70.269', '71.270', '72.271', '73.272', '74.273', '75.274', '76.275', '77.276', '78.277', '79.278', '80.279', '81.280', '82.281', '83.282', '84.283', '85.284', '86.285', '87.286', '88.287', '89.288', '90.289', '91.290', '92.291', '93.292', '94.293', '95.294', '96.295', '97.296', '98.297', '99.298', '100.299', '101.300', '102.301', '103.302', '104.303', '105.304', '106.305', '107.306', '108.307', '109.308', '110.309', '111.310', '112.311', '113.312', '114.313', '115.314', '116.315', '117.316', '118.317', '119.318', '120.319', '121.320', '122.321', '123.322', '124.323', '125.324', '126.325', '127.326', '128.327', '129.328', '130.329', '131.330', '132.331', '133.332', '134.333', '135.334', '136.335', '137.336', '138.337', '139.338', '140.339', '141.340', '142.341', '143.342', '144.343', '145.344', '146.345', '147.346', '148.347', '149.348', '150.349', '151.350', '152.351', '153.352', '154.353', '155.354', '156.355', '157.356', '158.357', '159.358', '160.359', '161.360', '162.361', '163.362', '164.363', '165.364', '166.365', '167.366', '168.367', '169.368', '170.369', '171.370', '172.371', '173.372', '174.373', '175.374', '176.375', '177.376', '178.377', '179.378', '180.379', '181.380', '182.381', '183.382', '184.383', '185.384', '186.385', '187.386', '188.387', '189.388', '190.389', '191.390', '192.391', '193.392', '194.393', '195.394', '196.395', '197.396', '198.397', '199.398', '200.399', '201.400', '202.401', '203.402', '204.403', '205.404', '206.405', '207.406', '208.407', '209.408', '210.409', '211.410', '212.411', '213.412', '214.413', '215.414', '216.415', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.416', '238', '239', '240', '241', '242', '243', '243.417', '243.418', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458']), StandardNumbering(id='standardnumbering68', reference_id='BAH60832.1', numbered_id='KAG0236582.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11', '12', '13', '14', '15', '16.214', '17.215', '18.216', '19.217', '20', '21', '22.218', '23.219', '24.220', '25.221', '26.222', '27.223', '28.224', '29.225', '30.226', '31.227', '32.228', '33.229', '34.230', '35.231', '36.232', '37.233', '38.234', '39.235', '40.236', '41.237', '42.238', '43.239', '44.240', '45.241', '46.242', '47.243', '48.244', '49.245', '50.246', '51.247', '52.248', '53.249', '54.250', '55.251', '56.252', '57.253', '58.254', '59.255', '60.256', '61.257', '62.258', '63.259', '64.260', '65.261', '66.262', '67.263', '68.264', '69.265', '70.266', '71.267', '72.268', '73.269', '74.270', '75.271', '76.272', '77.273', '78.274', '79.275', '80.276', '81.277', '82.278', '83.279', '84.280', '85.281', '86.282', '87.283', '88.284', '89.285', '90.286', '91.287', '92.288', '93.289', '94.290', '95.291', '96.292', '97.293', '98.294', '99.295', '100.296', '101.297', '102.298', '103.299', '104.300', '105.301', '106.302', '107.303', '108.304', '109.305', '110.306', '111.307', '112.308', '113.309', '114.310', '115.311', '116.312', '117.313', '118.314', '119.315', '120.316', '121.317', '122.318', '123.319', '124.320', '125.321', '126.322', '127.323', '128.324', '129.325', '130.326', '131.327', '132.328', '133.329', '134.330', '135.331', '136.332', '137.333', '138.334', '139.335', '140.336', '141.337', '142.338', '143.339', '144.340', '145.341', '146.342', '147.343', '148.344', '149.345', '150.346', '151.347', '152.348', '153.349', '154.350', '155.351', '156.352', '157.353', '158.354', '159.355', '160.356', '161.357', '162.358', '163.359', '164.360', '165.361', '166.362', '167.363', '168.364', '169.365', '170.366', '171.367', '172.368', '173.369', '174.370', '175.371', '176.372', '177.373', '178.374', '179.375', '180.376', '181.377', '182.378', '183.379', '184.380', '185.381', '186.382', '187.383', '188.384', '189.385', '190.386', '191.387', '192.388', '193.389', '194.390', '195.391', '196.392', '197.393', '198.394', '199.395', '200.396', '201.397', '202.398', '203.399', '204.400', '205.401', '206.402', '207.403', '208.404', '209.405', '210.406', '211.407', '212.408', '213.409', '214.410', '215.411', '216', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.412', '238', '239', '240', '241', '242', '243', '243.413', '243.414', '243.415', '243.416', '243.417', '243.418', '243.419', '243.420', '243.421', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.422', '254.423', '254.424', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454']), StandardNumbering(id='standardnumbering69', reference_id='BAH60832.1', numbered_id='KAH6640987.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6.201', '7.202', '7.203', '7.204', '7.205', '7.206', '7.207', '8', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '9', '10', '11.217', '12.218', '13.219', '14.220', '15.221', '16.222', '17.223', '18.224', '19.225', '20.226', '21.227', '22.228', '23.229', '24.230', '25.231', '26.232', '27.233', '28.234', '29.235', '30.236', '31.237', '32.238', '33.239', '34.240', '35.241', '36.242', '37.243', '38.244', '39.245', '40.246', '41.247', '42.248', '43.249', '44.250', '45.251', '46.252', '47.253', '48.254', '49.255', '50.256', '51.257', '52.258', '53.259', '54.260', '55.261', '56.262', '57.263', '58.264', '59.265', '60.266', '61.267', '62.268', '63.269', '64.270', '65.271', '66.272', '67.273', '68.274', '69.275', '70.276', '71.277', '72.278', '73.279', '74.280', '75.281', '76.282', '77.283', '78.284', '79.285', '80.286', '81.287', '82.288', '83.289', '84.290', '85.291', '86.292', '87.293', '88.294', '89.295', '90.296', '91.297', '92.298', '93.299', '94.300', '95.301', '96.302', '97.303', '98.304', '99.305', '100.306', '101.307', '102.308', '103.309', '104.310', '105.311', '106.312', '107.313', '108.314', '109.315', '110.316', '111.317', '112.318', '113.319', '114.320', '115.321', '116.322', '117.323', '118.324', '119.325', '120.326', '121.327', '122.328', '123.329', '124.330', '125.331', '126.332', '127.333', '128.334', '129.335', '130.336', '131.337', '132.338', '133.339', '134.340', '135.341', '136.342', '137.343', '138.344', '139.345', '140.346', '141.347', '142.348', '143.349', '144.350', '145.351', '146.352', '147.353', '148.354', '149.355', '150.356', '151.357', '152.358', '153.359', '154.360', '155.361', '156.362', '157.363', '158.364', '159.365', '160.366', '161.367', '162.368', '163.369', '164.370', '165.371', '166.372', '167.373', '168.374', '169.375', '170.376', '171.377', '172.378', '173.379', '174.380', '175.381', '176.382', '177.383', '178.384', '179.385', '180.386', '181.387', '182.388', '183.389', '184.390', '185.391', '186.392', '187.393', '188.394', '189.395', '190.396', '191.397', '192.398', '193.399', '194.400', '195.401', '196.402', '197.403', '198.404', '199.405', '200.406', '201.407', '202.408', '203.409', '204.410', '205.411', '206.412', '207.413', '208.414', '209.415', '210.416', '211.417', '212.418', '213.419', '214.420', '215.421', '216.422', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.423', '238', '239', '240', '241', '242', '243', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465']), StandardNumbering(id='standardnumbering70', reference_id='BAH60832.1', numbered_id='XP_002493958.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.420', '238', '239', '240', '241', '242', '243', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462']), StandardNumbering(id='standardnumbering71', reference_id='BAH60832.1', numbered_id='KAA8914877.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5.196', '5.197', '5.198', '5.199', '5.200', '5.201', '6', '7', '7.202', '7.203', '7.204', '7.205', '7.206', '8', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '9', '10.216', '11.217', '12.218', '13', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering72', reference_id='BAH60832.1', numbered_id='XP_018701974.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5.196', '5.197', '5.198', '5.199', '5.200', '5.201', '6.202', '7.203', '7.204', '7.205', '7.206', '7.207', '7.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '8.217', '8.218', '9.219', '10.220', '11.221', '12.222', '13.223', '14.224', '15.225', '16.226', '17.227', '18.228', '19.229', '20.230', '21.231', '22.232', '23.233', '24.234', '25.235', '26.236', '27.237', '28.238', '29.239', '30.240', '31.241', '32.242', '33.243', '34.244', '35.245', '36.246', '37.247', '38.248', '39.249', '40.250', '41.251', '42.252', '43.253', '44.254', '45.255', '46.256', '47.257', '48.258', '49.259', '50.260', '51.261', '52.262', '53.263', '54.264', '55.265', '56.266', '57.267', '58.268', '59.269', '60.270', '61.271', '62.272', '63.273', '64.274', '65.275', '66.276', '67.277', '68.278', '69.279', '70.280', '71.281', '72.282', '73.283', '74.284', '75.285', '76.286', '77.287', '78.288', '79.289', '80.290', '81.291', '82.292', '83.293', '84.294', '85.295', '86.296', '87.297', '88.298', '89.299', '90.300', '91.301', '92.302', '93.303', '94.304', '95.305', '96.306', '97.307', '98.308', '99.309', '100.310', '101.311', '102.312', '103.313', '104.314', '105.315', '106.316', '107.317', '108.318', '109.319', '110.320', '111.321', '112.322', '113.323', '114.324', '115.325', '116.326', '117.327', '118.328', '119.329', '120.330', '121.331', '122.332', '123.333', '124.334', '125.335', '126.336', '127.337', '128.338', '129.339', '130.340', '131.341', '132.342', '133.343', '134.344', '135.345', '136.346', '137.347', '138.348', '139.349', '140.350', '141.351', '142.352', '143.353', '144.354', '145.355', '146.356', '147.357', '148.358', '149.359', '150.360', '151.361', '152.362', '153.363', '154.364', '155.365', '156.366', '157.367', '158.368', '159.369', '160.370', '161.371', '162.372', '163.373', '164.374', '165.375', '166.376', '167.377', '168.378', '169.379', '170.380', '171.381', '172.382', '173.383', '174.384', '175.385', '176.386', '177.387', '178.388', '179.389', '180.390', '181.391', '182.392', '183.393', '184.394', '185.395', '186.396', '187.397', '188.398', '189.399', '190.400', '191.401', '192.402', '193.403', '194.404', '195.405', '196.406', '197.407', '198.408', '199.409', '200.410', '201.411', '202.412', '203.413', '204.414', '205.415', '206.416', '207.417', '208.418', '209.419', '210.420', '211.421', '212.422', '213.423', '214.424', '215.425', '216.426', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.427', '238', '239', '240', '241', '242', '243', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '243.435', '243.436', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467', '254.468', '254.469']), StandardNumbering(id='standardnumbering73', reference_id='BAH60832.1', numbered_id='KAI2643608.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering74', reference_id='BAH60832.1', numbered_id='KAG0125076.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '4.194', '5.195', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10', '11', '12', '13', '14', '15', '16.215', '17.216', '18.217', '19.218', '20.219', '21.220', '22.221', '23.222', '24.223', '25.224', '26.225', '27.226', '28.227', '29.228', '30.229', '31.230', '32.231', '33.232', '34.233', '35.234', '36.235', '37.236', '38.237', '39.238', '40.239', '41.240', '42.241', '43.242', '44.243', '45.244', '46.245', '47.246', '48.247', '49.248', '50.249', '51.250', '52.251', '53.252', '54.253', '55.254', '56.255', '57.256', '58.257', '59.258', '60.259', '61.260', '62.261', '63.262', '64.263', '65.264', '66.265', '67.266', '68.267', '69.268', '70.269', '71.270', '72.271', '73.272', '74.273', '75.274', '76.275', '77.276', '78.277', '79.278', '80.279', '81.280', '82.281', '83.282', '84.283', '85.284', '86.285', '87.286', '88.287', '89.288', '90.289', '91.290', '92.291', '93.292', '94.293', '95.294', '96.295', '97.296', '98.297', '99.298', '100.299', '101.300', '102.301', '103.302', '104.303', '105.304', '106.305', '107.306', '108.307', '109.308', '110.309', '111.310', '112.311', '113.312', '114.313', '115.314', '116.315', '117.316', '118.317', '119.318', '120.319', '121.320', '122.321', '123.322', '124.323', '125.324', '126.325', '127.326', '128.327', '129.328', '130.329', '131.330', '132.331', '133.332', '134.333', '135.334', '136.335', '137.336', '138.337', '139.338', '140.339', '141.340', '142.341', '143.342', '144.343', '145.344', '146.345', '147.346', '148.347', '149.348', '150.349', '151.350', '152.351', '153.352', '154.353', '155.354', '156.355', '157.356', '158.357', '159.358', '160.359', '161.360', '162.361', '163.362', '164.363', '165.364', '166.365', '167.366', '168.367', '169.368', '170.369', '171.370', '172.371', '173.372', '174.373', '175.374', '176.375', '177.376', '178.377', '179.378', '180.379', '181.380', '182.381', '183.382', '184.383', '185.384', '186.385', '187.386', '188.387', '189.388', '190.389', '191.390', '192.391', '193.392', '194.393', '195.394', '196.395', '197.396', '198.397', '199.398', '200.399', '201.400', '202.401', '203.402', '204.403', '205.404', '206.405', '207.406', '208.407', '209.408', '210.409', '211.410', '212.411', '213.412', '214.413', '215.414', '216.415', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.416', '238', '239', '240', '241', '242', '243', '243.417', '243.418', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458']), StandardNumbering(id='standardnumbering75', reference_id='BAH60832.1', numbered_id='KAH9904989.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5.196', '5.197', '5.198', '5.199', '5.200', '5.201', '6', '7', '7.202', '7.203', '7.204', '7.205', '7.206', '8', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '9', '10.216', '11.217', '12.218', '13', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering76', reference_id='BAH60832.1', numbered_id='VEU24358.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1.181', '2.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '3.195', '4.196', '5.197', '5.198', '5.199', '5.200', '5.201', '5.202', '6', '7', '7.203', '7.204', '7.205', '7.206', '7.207', '8', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '9.217', '10.218', '11.219', '12.220', '13.221', '14.222', '15.223', '16.224', '17.225', '18.226', '19.227', '20.228', '21.229', '22.230', '23.231', '24.232', '25.233', '26.234', '27.235', '28.236', '29.237', '30.238', '31.239', '32.240', '33.241', '34.242', '35.243', '36.244', '37.245', '38.246', '39.247', '40.248', '41.249', '42.250', '43.251', '44.252', '45.253', '46.254', '47.255', '48.256', '49.257', '50.258', '51.259', '52.260', '53.261', '54.262', '55.263', '56.264', '57.265', '58.266', '59.267', '60.268', '61.269', '62.270', '63.271', '64.272', '65.273', '66.274', '67.275', '68.276', '69.277', '70.278', '71.279', '72.280', '73.281', '74.282', '75.283', '76.284', '77.285', '78.286', '79.287', '80.288', '81.289', '82.290', '83.291', '84.292', '85.293', '86.294', '87.295', '88.296', '89.297', '90.298', '91.299', '92.300', '93.301', '94.302', '95.303', '96.304', '97.305', '98.306', '99.307', '100.308', '101.309', '102.310', '103.311', '104.312', '105.313', '106.314', '107.315', '108.316', '109.317', '110.318', '111.319', '112.320', '113.321', '114.322', '115.323', '116.324', '117.325', '118.326', '119.327', '120.328', '121.329', '122.330', '123.331', '124.332', '125.333', '126.334', '127.335', '128.336', '129.337', '130.338', '131.339', '132.340', '133.341', '134.342', '135.343', '136.344', '137.345', '138.346', '139.347', '140.348', '141.349', '142.350', '143.351', '144.352', '145.353', '146.354', '147.355', '148.356', '149.357', '150.358', '151.359', '152.360', '153.361', '154.362', '155.363', '156.364', '157.365', '158.366', '159.367', '160.368', '161.369', '162.370', '163.371', '164.372', '165.373', '166.374', '167.375', '168.376', '169.377', '170.378', '171.379', '172.380', '173.381', '174.382', '175.383', '176.384', '177.385', '178.386', '179.387', '180.388', '181.389', '182.390', '183.391', '184.392', '185.393', '186.394', '187.395', '188.396', '189.397', '190.398', '191.399', '192.400', '193.401', '194.402', '195.403', '196.404', '197.405', '198.406', '199.407', '200.408', '201.409', '202.410', '203.411', '204.412', '205.413', '206.414', '207.415', '208.416', '209.417', '210.418', '211.419', '212.420', '213.421', '214.422', '215.423', '216.424', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.425', '238', '239', '240', '241', '242', '243', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '243.433', '243.434', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465', '254.466', '254.467']), StandardNumbering(id='standardnumbering77', reference_id='BAH60832.1', numbered_id='KAI1283572.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering78', reference_id='BAH60832.1', numbered_id='KAI1500557.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering79', reference_id='BAH60832.1', numbered_id='KAI2623093.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.419', '238', '239', '240', '241', '242', '243', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461']), StandardNumbering(id='standardnumbering80', reference_id='BAH60832.1', numbered_id='NP_593285.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14', '15', '16', '17', '18', '19.212', '20.213', '21.214', '22.215', '23.216', '24.217', '25.218', '26.219', '27.220', '28.221', '29.222', '30.223', '31.224', '32.225', '33.226', '34.227', '35.228', '36.229', '37.230', '38.231', '39.232', '40.233', '41.234', '42.235', '43.236', '44.237', '45.238', '46.239', '47.240', '48.241', '49.242', '50.243', '51.244', '52.245', '53.246', '54.247', '55.248', '56.249', '57.250', '58.251', '59.252', '60.253', '61.254', '62.255', '63.256', '64.257', '65.258', '66.259', '67.260', '68.261', '69.262', '70.263', '71.264', '72.265', '73.266', '74.267', '75.268', '76.269', '77.270', '78.271', '79.272', '80.273', '81.274', '82.275', '83.276', '84.277', '85.278', '86.279', '87.280', '88.281', '89.282', '90.283', '91.284', '92.285', '93.286', '94.287', '95.288', '96.289', '97.290', '98.291', '99.292', '100.293', '101.294', '102.295', '103.296', '104.297', '105.298', '106.299', '107.300', '108.301', '109.302', '110.303', '111.304', '112.305', '113.306', '114.307', '115.308', '116.309', '117.310', '118.311', '119.312', '120.313', '121.314', '122.315', '123.316', '124.317', '125.318', '126.319', '127.320', '128.321', '129.322', '130.323', '131.324', '132.325', '133.326', '134.327', '135.328', '136.329', '137.330', '138.331', '139.332', '140.333', '141.334', '142.335', '143.336', '144.337', '145.338', '146.339', '147.340', '148.341', '149.342', '150.343', '151.344', '152.345', '153.346', '154.347', '155.348', '156.349', '157.350', '158.351', '159.352', '160.353', '161.354', '162.355', '163.356', '164.357', '165.358', '166.359', '167.360', '168.361', '169.362', '170.363', '171.364', '172.365', '173.366', '174.367', '175.368', '176.369', '177.370', '178.371', '179.372', '180.373', '181.374', '182.375', '183.376', '184.377', '185.378', '186.379', '187.380', '188.381', '189.382', '190.383', '191.384', '192.385', '193.386', '194.387', '195.388', '196.389', '197.390', '198.391', '199.392', '200.393', '201.394', '202.395', '203.396', '204.397', '205.398', '206.399', '207.400', '208.401', '209.402', '210.403', '211.404', '212.405', '213.406', '214.407', '215.408', '216.409', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.410', '238', '239', '240', '241', '242', '243', '243.411', '243.412', '243.413', '243.414', '243.415', '243.416', '243.417', '243.418', '243.419', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.420', '254.421', '254.422', '254.423', '254.424', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452']), StandardNumbering(id='standardnumbering81', reference_id='BAH60832.1', numbered_id='KAI0431960.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering82', reference_id='BAH60832.1', numbered_id='KAH8926511.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '9.213', '10.214', '11', '12', '13', '14', '15', '16.215', '17.216', '18.217', '19.218', '20.219', '21.220', '22.221', '23.222', '24.223', '25.224', '26.225', '27.226', '28.227', '29.228', '30.229', '31.230', '32.231', '33.232', '34.233', '35.234', '36.235', '37.236', '38.237', '39.238', '40.239', '41.240', '42.241', '43.242', '44.243', '45.244', '46.245', '47.246', '48.247', '49.248', '50.249', '51.250', '52.251', '53.252', '54.253', '55.254', '56.255', '57.256', '58.257', '59.258', '60.259', '61.260', '62.261', '63.262', '64.263', '65.264', '66.265', '67.266', '68.267', '69.268', '70.269', '71.270', '72.271', '73.272', '74.273', '75.274', '76.275', '77.276', '78.277', '79.278', '80.279', '81.280', '82.281', '83.282', '84.283', '85.284', '86.285', '87.286', '88.287', '89.288', '90.289', '91.290', '92.291', '93.292', '94.293', '95.294', '96.295', '97.296', '98.297', '99.298', '100.299', '101.300', '102.301', '103.302', '104.303', '105.304', '106.305', '107.306', '108.307', '109.308', '110.309', '111.310', '112.311', '113.312', '114.313', '115.314', '116.315', '117.316', '118.317', '119.318', '120.319', '121.320', '122.321', '123.322', '124.323', '125.324', '126.325', '127.326', '128.327', '129.328', '130.329', '131.330', '132.331', '133.332', '134.333', '135.334', '136.335', '137.336', '138.337', '139.338', '140.339', '141.340', '142.341', '143.342', '144.343', '145.344', '146.345', '147.346', '148.347', '149.348', '150.349', '151.350', '152.351', '153.352', '154.353', '155.354', '156.355', '157.356', '158.357', '159.358', '160.359', '161.360', '162.361', '163.362', '164.363', '165.364', '166.365', '167.366', '168.367', '169.368', '170.369', '171.370', '172.371', '173.372', '174.373', '175.374', '176.375', '177.376', '178.377', '179.378', '180.379', '181.380', '182.381', '183.382', '184.383', '185.384', '186.385', '187.386', '188.387', '189.388', '190.389', '191.390', '192.391', '193.392', '194.393', '195.394', '196.395', '197.396', '198.397', '199.398', '200.399', '201.400', '202.401', '203.402', '204.403', '205.404', '206.405', '207.406', '208.407', '209.408', '210.409', '211.410', '212.411', '213.412', '214.413', '215.414', '216.415', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.416', '238', '239', '240', '241', '242', '243', '243.417', '243.418', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458']), StandardNumbering(id='standardnumbering83', reference_id='BAH60832.1', numbered_id='RMJ24013.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '4', '5', '5.194', '5.195', '5.196', '5.197', '5.198', '6', '7', '7.199', '7.200', '7.201', '7.202', '7.203', '8', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '9.213', '10.214', '11.215', '12.216', '13.217', '14.218', '15.219', '16.220', '17.221', '18.222', '19.223', '20.224', '21.225', '22.226', '23.227', '24.228', '25.229', '26.230', '27.231', '28.232', '29.233', '30.234', '31.235', '32.236', '33.237', '34.238', '35.239', '36.240', '37.241', '38.242', '39.243', '40.244', '41.245', '42.246', '43.247', '44.248', '45.249', '46.250', '47.251', '48.252', '49.253', '50.254', '51.255', '52.256', '53.257', '54.258', '55.259', '56.260', '57.261', '58.262', '59.263', '60.264', '61.265', '62.266', '63.267', '64.268', '65.269', '66.270', '67.271', '68.272', '69.273', '70.274', '71.275', '72.276', '73.277', '74.278', '75.279', '76.280', '77.281', '78.282', '79.283', '80.284', '81.285', '82.286', '83.287', '84.288', '85.289', '86.290', '87.291', '88.292', '89.293', '90.294', '91.295', '92.296', '93.297', '94.298', '95.299', '96.300', '97.301', '98.302', '99.303', '100.304', '101.305', '102.306', '103.307', '104.308', '105.309', '106.310', '107.311', '108.312', '109.313', '110.314', '111.315', '112.316', '113.317', '114.318', '115.319', '116.320', '117.321', '118.322', '119.323', '120.324', '121.325', '122.326', '123.327', '124.328', '125.329', '126.330', '127.331', '128.332', '129.333', '130.334', '131.335', '132.336', '133.337', '134.338', '135.339', '136.340', '137.341', '138.342', '139.343', '140.344', '141.345', '142.346', '143.347', '144.348', '145.349', '146.350', '147.351', '148.352', '149.353', '150.354', '151.355', '152.356', '153.357', '154.358', '155.359', '156.360', '157.361', '158.362', '159.363', '160.364', '161.365', '162.366', '163.367', '164.368', '165.369', '166.370', '167.371', '168.372', '169.373', '170.374', '171.375', '172.376', '173.377', '174.378', '175.379', '176.380', '177.381', '178.382', '179.383', '180.384', '181.385', '182.386', '183.387', '184.388', '185.389', '186.390', '187.391', '188.392', '189.393', '190.394', '191.395', '192.396', '193.397', '194.398', '195.399', '196.400', '197.401', '198.402', '199.403', '200.404', '201.405', '202.406', '203.407', '204.408', '205.409', '206.410', '207.411', '208.412', '209.413', '210.414', '211.415', '212.416', '213.417', '214.418', '215.419', '216.420', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.421', '238', '239', '240', '241', '242', '243', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463']), StandardNumbering(id='standardnumbering84', reference_id='BAH60832.1', numbered_id='KAF8931046.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4.193', '5.194', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11', '12', '13', '14', '15', '16', '17', '18.214', '19.215', '20', '21', '22.216', '23.217', '24.218', '25.219', '26.220', '27.221', '28.222', '29.223', '30.224', '31.225', '32.226', '33.227', '34.228', '35.229', '36.230', '37.231', '38.232', '39.233', '40.234', '41.235', '42.236', '43.237', '44.238', '45.239', '46.240', '47.241', '48.242', '49.243', '50.244', '51.245', '52.246', '53.247', '54.248', '55.249', '56.250', '57.251', '58.252', '59.253', '60.254', '61.255', '62.256', '63.257', '64.258', '65.259', '66.260', '67.261', '68.262', '69.263', '70.264', '71.265', '72.266', '73.267', '74.268', '75.269', '76.270', '77.271', '78.272', '79.273', '80.274', '81.275', '82.276', '83.277', '84.278', '85.279', '86.280', '87.281', '88.282', '89.283', '90.284', '91.285', '92.286', '93.287', '94.288', '95.289', '96.290', '97.291', '98.292', '99.293', '100.294', '101.295', '102.296', '103.297', '104.298', '105.299', '106.300', '107.301', '108.302', '109.303', '110.304', '111.305', '112.306', '113.307', '114.308', '115.309', '116.310', '117.311', '118.312', '119.313', '120.314', '121.315', '122.316', '123.317', '124.318', '125.319', '126.320', '127.321', '128.322', '129.323', '130.324', '131.325', '132.326', '133.327', '134.328', '135.329', '136.330', '137.331', '138.332', '139.333', '140.334', '141.335', '142.336', '143.337', '144.338', '145.339', '146.340', '147.341', '148.342', '149.343', '150.344', '151.345', '152.346', '153.347', '154.348', '155.349', '156.350', '157.351', '158.352', '159.353', '160.354', '161.355', '162.356', '163.357', '164.358', '165.359', '166.360', '167.361', '168.362', '169.363', '170.364', '171.365', '172.366', '173.367', '174.368', '175.369', '176.370', '177.371', '178.372', '179.373', '180.374', '181.375', '182.376', '183.377', '184.378', '185.379', '186.380', '187.381', '188.382', '189.383', '190.384', '191.385', '192.386', '193.387', '194.388', '195.389', '196.390', '197.391', '198.392', '199.393', '200.394', '201.395', '202.396', '203.397', '204.398', '205.399', '206.400', '207.401', '208.402', '209.403', '210.404', '211.405', '212.406', '213.407', '214.408', '215.409', '216.410', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.411', '238', '239', '240', '241', '242', '243', '243.412', '243.413', '243.414', '243.415', '243.416', '243.417', '243.418', '243.419', '243.420', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.421', '254.422', '254.423', '254.424', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453']), StandardNumbering(id='standardnumbering85', reference_id='BAH60832.1', numbered_id='ODQ76250.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14.212', '15.213', '16.214', '17.215', '18.216', '19.217', '20.218', '21.219', '22.220', '23.221', '24.222', '25.223', '26.224', '27.225', '28.226', '29.227', '30.228', '31.229', '32.230', '33.231', '34.232', '35.233', '36.234', '37.235', '38.236', '39.237', '40.238', '41.239', '42.240', '43.241', '44.242', '45.243', '46.244', '47.245', '48.246', '49.247', '50.248', '51.249', '52.250', '53.251', '54.252', '55.253', '56.254', '57.255', '58.256', '59.257', '60.258', '61.259', '62.260', '63.261', '64.262', '65.263', '66.264', '67.265', '68.266', '69.267', '70.268', '71.269', '72.270', '73.271', '74.272', '75.273', '76.274', '77.275', '78.276', '79.277', '80.278', '81.279', '82.280', '83.281', '84.282', '85.283', '86.284', '87.285', '88.286', '89.287', '90.288', '91.289', '92.290', '93.291', '94.292', '95.293', '96.294', '97.295', '98.296', '99.297', '100.298', '101.299', '102.300', '103.301', '104.302', '105.303', '106.304', '107.305', '108.306', '109.307', '110.308', '111.309', '112.310', '113.311', '114.312', '115.313', '116.314', '117.315', '118.316', '119.317', '120.318', '121.319', '122.320', '123.321', '124.322', '125.323', '126.324', '127.325', '128.326', '129.327', '130.328', '131.329', '132.330', '133.331', '134.332', '135.333', '136.334', '137.335', '138.336', '139.337', '140.338', '141.339', '142.340', '143.341', '144.342', '145.343', '146.344', '147.345', '148.346', '149.347', '150.348', '151.349', '152.350', '153.351', '154.352', '155.353', '156.354', '157.355', '158.356', '159.357', '160.358', '161.359', '162.360', '163.361', '164.362', '165.363', '166.364', '167.365', '168.366', '169.367', '170.368', '171.369', '172.370', '173.371', '174.372', '175.373', '176.374', '177.375', '178.376', '179.377', '180.378', '181.379', '182.380', '183.381', '184.382', '185.383', '186.384', '187.385', '188.386', '189.387', '190.388', '191.389', '192.390', '193.391', '194.392', '195.393', '196.394', '197.395', '198.396', '199.397', '200.398', '201.399', '202.400', '203.401', '204.402', '205.403', '206.404', '207.405', '208.406', '209.407', '210.408', '211.409', '212.410', '213.411', '214.412', '215.413', '216.414', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.415', '238', '239', '240', '241', '242', '243', '243.416', '243.417', '243.418', '243.419', '243.420', '243.421', '243.422', '243.423', '243.424', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457']), StandardNumbering(id='standardnumbering86', reference_id='BAH60832.1', numbered_id='KXJ93426.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5.196', '5.197', '5.198', '5.199', '5.200', '5.201', '6', '7', '7.202', '7.203', '7.204', '7.205', '7.206', '8', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '9', '10.216', '11.217', '12.218', '13.219', '14.220', '15.221', '16.222', '17.223', '18.224', '19.225', '20.226', '21.227', '22.228', '23.229', '24.230', '25.231', '26.232', '27.233', '28.234', '29.235', '30.236', '31.237', '32.238', '33.239', '34.240', '35.241', '36.242', '37.243', '38.244', '39.245', '40.246', '41.247', '42.248', '43.249', '44.250', '45.251', '46.252', '47.253', '48.254', '49.255', '50.256', '51.257', '52.258', '53.259', '54.260', '55.261', '56.262', '57.263', '58.264', '59.265', '60.266', '61.267', '62.268', '63.269', '64.270', '65.271', '66.272', '67.273', '68.274', '69.275', '70.276', '71.277', '72.278', '73.279', '74.280', '75.281', '76.282', '77.283', '78.284', '79.285', '80.286', '81.287', '82.288', '83.289', '84.290', '85.291', '86.292', '87.293', '88.294', '89.295', '90.296', '91.297', '92.298', '93.299', '94.300', '95.301', '96.302', '97.303', '98.304', '99.305', '100.306', '101.307', '102.308', '103.309', '104.310', '105.311', '106.312', '107.313', '108.314', '109.315', '110.316', '111.317', '112.318', '113.319', '114.320', '115.321', '116.322', '117.323', '118.324', '119.325', '120.326', '121.327', '122.328', '123.329', '124.330', '125.331', '126.332', '127.333', '128.334', '129.335', '130.336', '131.337', '132.338', '133.339', '134.340', '135.341', '136.342', '137.343', '138.344', '139.345', '140.346', '141.347', '142.348', '143.349', '144.350', '145.351', '146.352', '147.353', '148.354', '149.355', '150.356', '151.357', '152.358', '153.359', '154.360', '155.361', '156.362', '157.363', '158.364', '159.365', '160.366', '161.367', '162.368', '163.369', '164.370', '165.371', '166.372', '167.373', '168.374', '169.375', '170.376', '171.377', '172.378', '173.379', '174.380', '175.381', '176.382', '177.383', '178.384', '179.385', '180.386', '181.387', '182.388', '183.389', '184.390', '185.391', '186.392', '187.393', '188.394', '189.395', '190.396', '191.397', '192.398', '193.399', '194.400', '195.401', '196.402', '197.403', '198.404', '199.405', '200.406', '201.407', '202.408', '203.409', '204.410', '205.411', '206.412', '207.413', '208.414', '209.415', '210.416', '211.417', '212.418', '213.419', '214.420', '215.421', '216.422', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.423', '238', '239', '240', '241', '242', '243', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465']), StandardNumbering(id='standardnumbering87', reference_id='BAH60832.1', numbered_id='XP_051368163.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.420', '238', '239', '240', '241', '242', '243', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462']), StandardNumbering(id='standardnumbering88', reference_id='BAH60832.1', numbered_id='GES63634.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering89', reference_id='BAH60832.1', numbered_id='RPA74746.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '4', '5', '5.194', '5.195', '5.196', '5.197', '5.198', '6', '7', '7.199', '7.200', '7.201', '7.202', '7.203', '8', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '9', '10', '11.213', '12.214', '13.215', '14.216', '15.217', '16.218', '17.219', '18.220', '19.221', '20.222', '21.223', '22.224', '23.225', '24.226', '25.227', '26.228', '27.229', '28.230', '29.231', '30.232', '31.233', '32.234', '33.235', '34.236', '35.237', '36.238', '37.239', '38.240', '39.241', '40.242', '41.243', '42.244', '43.245', '44.246', '45.247', '46.248', '47.249', '48.250', '49.251', '50.252', '51.253', '52.254', '53.255', '54.256', '55.257', '56.258', '57.259', '58.260', '59.261', '60.262', '61.263', '62.264', '63.265', '64.266', '65.267', '66.268', '67.269', '68.270', '69.271', '70.272', '71.273', '72.274', '73.275', '74.276', '75.277', '76.278', '77.279', '78.280', '79.281', '80.282', '81.283', '82.284', '83.285', '84.286', '85.287', '86.288', '87.289', '88.290', '89.291', '90.292', '91.293', '92.294', '93.295', '94.296', '95.297', '96.298', '97.299', '98.300', '99.301', '100.302', '101.303', '102.304', '103.305', '104.306', '105.307', '106.308', '107.309', '108.310', '109.311', '110.312', '111.313', '112.314', '113.315', '114.316', '115.317', '116.318', '117.319', '118.320', '119.321', '120.322', '121.323', '122.324', '123.325', '124.326', '125.327', '126.328', '127.329', '128.330', '129.331', '130.332', '131.333', '132.334', '133.335', '134.336', '135.337', '136.338', '137.339', '138.340', '139.341', '140.342', '141.343', '142.344', '143.345', '144.346', '145.347', '146.348', '147.349', '148.350', '149.351', '150.352', '151.353', '152.354', '153.355', '154.356', '155.357', '156.358', '157.359', '158.360', '159.361', '160.362', '161.363', '162.364', '163.365', '164.366', '165.367', '166.368', '167.369', '168.370', '169.371', '170.372', '171.373', '172.374', '173.375', '174.376', '175.377', '176.378', '177.379', '178.380', '179.381', '180.382', '181.383', '182.384', '183.385', '184.386', '185.387', '186.388', '187.389', '188.390', '189.391', '190.392', '191.393', '192.394', '193.395', '194.396', '195.397', '196.398', '197.399', '198.400', '199.401', '200.402', '201.403', '202.404', '203.405', '204.406', '205.407', '206.408', '207.409', '208.410', '209.411', '210.412', '211.413', '212.414', '213.415', '214.416', '215.417', '216.418', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.419', '238', '239', '240', '241', '242', '243', '243.420', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461']), StandardNumbering(id='standardnumbering90', reference_id='BAH60832.1', numbered_id='XP_024675402.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9.214', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering91', reference_id='BAH60832.1', numbered_id='KAH6850716.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6.201', '7.202', '7.203', '7.204', '7.205', '7.206', '7.207', '8', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '8.215', '8.216', '9', '10', '11.217', '12.218', '13.219', '14.220', '15.221', '16.222', '17.223', '18.224', '19.225', '20.226', '21.227', '22.228', '23.229', '24.230', '25.231', '26.232', '27.233', '28.234', '29.235', '30.236', '31.237', '32.238', '33.239', '34.240', '35.241', '36.242', '37.243', '38.244', '39.245', '40.246', '41.247', '42.248', '43.249', '44.250', '45.251', '46.252', '47.253', '48.254', '49.255', '50.256', '51.257', '52.258', '53.259', '54.260', '55.261', '56.262', '57.263', '58.264', '59.265', '60.266', '61.267', '62.268', '63.269', '64.270', '65.271', '66.272', '67.273', '68.274', '69.275', '70.276', '71.277', '72.278', '73.279', '74.280', '75.281', '76.282', '77.283', '78.284', '79.285', '80.286', '81.287', '82.288', '83.289', '84.290', '85.291', '86.292', '87.293', '88.294', '89.295', '90.296', '91.297', '92.298', '93.299', '94.300', '95.301', '96.302', '97.303', '98.304', '99.305', '100.306', '101.307', '102.308', '103.309', '104.310', '105.311', '106.312', '107.313', '108.314', '109.315', '110.316', '111.317', '112.318', '113.319', '114.320', '115.321', '116.322', '117.323', '118.324', '119.325', '120.326', '121.327', '122.328', '123.329', '124.330', '125.331', '126.332', '127.333', '128.334', '129.335', '130.336', '131.337', '132.338', '133.339', '134.340', '135.341', '136.342', '137.343', '138.344', '139.345', '140.346', '141.347', '142.348', '143.349', '144.350', '145.351', '146.352', '147.353', '148.354', '149.355', '150.356', '151.357', '152.358', '153.359', '154.360', '155.361', '156.362', '157.363', '158.364', '159.365', '160.366', '161.367', '162.368', '163.369', '164.370', '165.371', '166.372', '167.373', '168.374', '169.375', '170.376', '171.377', '172.378', '173.379', '174.380', '175.381', '176.382', '177.383', '178.384', '179.385', '180.386', '181.387', '182.388', '183.389', '184.390', '185.391', '186.392', '187.393', '188.394', '189.395', '190.396', '191.397', '192.398', '193.399', '194.400', '195.401', '196.402', '197.403', '198.404', '199.405', '200.406', '201.407', '202.408', '203.409', '204.410', '205.411', '206.412', '207.413', '208.414', '209.415', '210.416', '211.417', '212.418', '213.419', '214.420', '215.421', '216.422', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.423', '238', '239', '240', '241', '242', '243', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465']), StandardNumbering(id='standardnumbering92', reference_id='BAH60832.1', numbered_id='PHH71636.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10', '11.215', '12.216', '13.217', '14.218', '15.219', '16.220', '17.221', '18.222', '19.223', '20.224', '21.225', '22.226', '23.227', '24.228', '25.229', '26.230', '27.231', '28.232', '29.233', '30.234', '31.235', '32.236', '33.237', '34.238', '35.239', '36.240', '37.241', '38.242', '39.243', '40.244', '41.245', '42.246', '43.247', '44.248', '45.249', '46.250', '47.251', '48.252', '49.253', '50.254', '51.255', '52.256', '53.257', '54.258', '55.259', '56.260', '57.261', '58.262', '59.263', '60.264', '61.265', '62.266', '63.267', '64.268', '65.269', '66.270', '67.271', '68.272', '69.273', '70.274', '71.275', '72.276', '73.277', '74.278', '75.279', '76.280', '77.281', '78.282', '79.283', '80.284', '81.285', '82.286', '83.287', '84.288', '85.289', '86.290', '87.291', '88.292', '89.293', '90.294', '91.295', '92.296', '93.297', '94.298', '95.299', '96.300', '97.301', '98.302', '99.303', '100.304', '101.305', '102.306', '103.307', '104.308', '105.309', '106.310', '107.311', '108.312', '109.313', '110.314', '111.315', '112.316', '113.317', '114.318', '115.319', '116.320', '117.321', '118.322', '119.323', '120.324', '121.325', '122.326', '123.327', '124.328', '125.329', '126.330', '127.331', '128.332', '129.333', '130.334', '131.335', '132.336', '133.337', '134.338', '135.339', '136.340', '137.341', '138.342', '139.343', '140.344', '141.345', '142.346', '143.347', '144.348', '145.349', '146.350', '147.351', '148.352', '149.353', '150.354', '151.355', '152.356', '153.357', '154.358', '155.359', '156.360', '157.361', '158.362', '159.363', '160.364', '161.365', '162.366', '163.367', '164.368', '165.369', '166.370', '167.371', '168.372', '169.373', '170.374', '171.375', '172.376', '173.377', '174.378', '175.379', '176.380', '177.381', '178.382', '179.383', '180.384', '181.385', '182.386', '183.387', '184.388', '185.389', '186.390', '187.391', '188.392', '189.393', '190.394', '191.395', '192.396', '193.397', '194.398', '195.399', '196.400', '197.401', '198.402', '199.403', '200.404', '201.405', '202.406', '203.407', '204.408', '205.409', '206.410', '207.411', '208.412', '209.413', '210.414', '211.415', '212.416', '213.417', '214.418', '215.419', '216.420', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.421', '238', '239', '240', '241', '242', '243', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463']), StandardNumbering(id='standardnumbering93', reference_id='BAH60832.1', numbered_id='KAJ3562589.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217.422', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.423', '238', '239', '240', '241', '242', '243', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465']), StandardNumbering(id='standardnumbering94', reference_id='BAH60832.1', numbered_id='RDA84390.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.420', '238', '239', '240', '241', '242', '243', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462']), StandardNumbering(id='standardnumbering95', reference_id='BAH60832.1', numbered_id='XP_007413704.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6.198', '7.199', '7.200', '7.201', '7.202', '7.203', '7.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9.215', '10.216', '11.217', '12.218', '13.219', '14.220', '15.221', '16.222', '17.223', '18.224', '19.225', '20.226', '21.227', '22.228', '23.229', '24.230', '25.231', '26.232', '27.233', '28.234', '29.235', '30.236', '31.237', '32.238', '33.239', '34.240', '35.241', '36.242', '37.243', '38.244', '39.245', '40.246', '41.247', '42.248', '43.249', '44.250', '45.251', '46.252', '47.253', '48.254', '49.255', '50.256', '51.257', '52.258', '53.259', '54.260', '55.261', '56.262', '57.263', '58.264', '59.265', '60.266', '61.267', '62.268', '63.269', '64.270', '65.271', '66.272', '67.273', '68.274', '69.275', '70.276', '71.277', '72.278', '73.279', '74.280', '75.281', '76.282', '77.283', '78.284', '79.285', '80.286', '81.287', '82.288', '83.289', '84.290', '85.291', '86.292', '87.293', '88.294', '89.295', '90.296', '91.297', '92.298', '93.299', '94.300', '95.301', '96.302', '97.303', '98.304', '99.305', '100.306', '101.307', '102.308', '103.309', '104.310', '105.311', '106.312', '107.313', '108.314', '109.315', '110.316', '111.317', '112.318', '113.319', '114.320', '115.321', '116.322', '117.323', '118.324', '119.325', '120.326', '121.327', '122.328', '123.329', '124.330', '125.331', '126.332', '127.333', '128.334', '129.335', '130.336', '131.337', '132.338', '133.339', '134.340', '135.341', '136.342', '137.343', '138.344', '139.345', '140.346', '141.347', '142.348', '143.349', '144.350', '145.351', '146.352', '147.353', '148.354', '149.355', '150.356', '151.357', '152.358', '153.359', '154.360', '155.361', '156.362', '157.363', '158.364', '159.365', '160.366', '161.367', '162.368', '163.369', '164.370', '165.371', '166.372', '167.373', '168.374', '169.375', '170.376', '171.377', '172.378', '173.379', '174.380', '175.381', '176.382', '177.383', '178.384', '179.385', '180.386', '181.387', '182.388', '183.389', '184.390', '185.391', '186.392', '187.393', '188.394', '189.395', '190.396', '191.397', '192.398', '193.399', '194.400', '195.401', '196.402', '197.403', '198.404', '199.405', '200.406', '201.407', '202.408', '203.409', '204.410', '205.411', '206.412', '207.413', '208.414', '209.415', '210.416', '211.417', '212.418', '213.419', '214.420', '215.421', '216.422', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.423', '238', '239', '240', '241', '242', '243', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '243.432', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464', '254.465']), StandardNumbering(id='standardnumbering96', reference_id='BAH60832.1', numbered_id='KAI0376630.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4', '5', '5.195', '5.196', '5.197', '5.198', '5.199', '6', '7', '7.200', '7.201', '7.202', '7.203', '7.204', '8', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '9', '10', '11.214', '12.215', '13.216', '14.217', '15.218', '16.219', '17.220', '18.221', '19.222', '20.223', '21.224', '22.225', '23.226', '24.227', '25.228', '26.229', '27.230', '28.231', '29.232', '30.233', '31.234', '32.235', '33.236', '34.237', '35.238', '36.239', '37.240', '38.241', '39.242', '40.243', '41.244', '42.245', '43.246', '44.247', '45.248', '46.249', '47.250', '48.251', '49.252', '50.253', '51.254', '52.255', '53.256', '54.257', '55.258', '56.259', '57.260', '58.261', '59.262', '60.263', '61.264', '62.265', '63.266', '64.267', '65.268', '66.269', '67.270', '68.271', '69.272', '70.273', '71.274', '72.275', '73.276', '74.277', '75.278', '76.279', '77.280', '78.281', '79.282', '80.283', '81.284', '82.285', '83.286', '84.287', '85.288', '86.289', '87.290', '88.291', '89.292', '90.293', '91.294', '92.295', '93.296', '94.297', '95.298', '96.299', '97.300', '98.301', '99.302', '100.303', '101.304', '102.305', '103.306', '104.307', '105.308', '106.309', '107.310', '108.311', '109.312', '110.313', '111.314', '112.315', '113.316', '114.317', '115.318', '116.319', '117.320', '118.321', '119.322', '120.323', '121.324', '122.325', '123.326', '124.327', '125.328', '126.329', '127.330', '128.331', '129.332', '130.333', '131.334', '132.335', '133.336', '134.337', '135.338', '136.339', '137.340', '138.341', '139.342', '140.343', '141.344', '142.345', '143.346', '144.347', '145.348', '146.349', '147.350', '148.351', '149.352', '150.353', '151.354', '152.355', '153.356', '154.357', '155.358', '156.359', '157.360', '158.361', '159.362', '160.363', '161.364', '162.365', '163.366', '164.367', '165.368', '166.369', '167.370', '168.371', '169.372', '170.373', '171.374', '172.375', '173.376', '174.377', '175.378', '176.379', '177.380', '178.381', '179.382', '180.383', '181.384', '182.385', '183.386', '184.387', '185.388', '186.389', '187.390', '188.391', '189.392', '190.393', '191.394', '192.395', '193.396', '194.397', '195.398', '196.399', '197.400', '198.401', '199.402', '200.403', '201.404', '202.405', '203.406', '204.407', '205.408', '206.409', '207.410', '208.411', '209.412', '210.413', '211.414', '212.415', '213.416', '214.417', '215.418', '216.419', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.420', '238', '239', '240', '241', '242', '243', '243.421', '243.422', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462']), StandardNumbering(id='standardnumbering97', reference_id='BAH60832.1', numbered_id='XP_047831721.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '3.193', '3.194', '4.195', '5', '5.196', '5.197', '5.198', '5.199', '5.200', '6', '7', '7.201', '7.202', '7.203', '7.204', '7.205', '8', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '8.212', '8.213', '8.214', '9', '10.215', '11.216', '12.217', '13.218', '14.219', '15.220', '16.221', '17.222', '18.223', '19.224', '20.225', '21.226', '22.227', '23.228', '24.229', '25.230', '26.231', '27.232', '28.233', '29.234', '30.235', '31.236', '32.237', '33.238', '34.239', '35.240', '36.241', '37.242', '38.243', '39.244', '40.245', '41.246', '42.247', '43.248', '44.249', '45.250', '46.251', '47.252', '48.253', '49.254', '50.255', '51.256', '52.257', '53.258', '54.259', '55.260', '56.261', '57.262', '58.263', '59.264', '60.265', '61.266', '62.267', '63.268', '64.269', '65.270', '66.271', '67.272', '68.273', '69.274', '70.275', '71.276', '72.277', '73.278', '74.279', '75.280', '76.281', '77.282', '78.283', '79.284', '80.285', '81.286', '82.287', '83.288', '84.289', '85.290', '86.291', '87.292', '88.293', '89.294', '90.295', '91.296', '92.297', '93.298', '94.299', '95.300', '96.301', '97.302', '98.303', '99.304', '100.305', '101.306', '102.307', '103.308', '104.309', '105.310', '106.311', '107.312', '108.313', '109.314', '110.315', '111.316', '112.317', '113.318', '114.319', '115.320', '116.321', '117.322', '118.323', '119.324', '120.325', '121.326', '122.327', '123.328', '124.329', '125.330', '126.331', '127.332', '128.333', '129.334', '130.335', '131.336', '132.337', '133.338', '134.339', '135.340', '136.341', '137.342', '138.343', '139.344', '140.345', '141.346', '142.347', '143.348', '144.349', '145.350', '146.351', '147.352', '148.353', '149.354', '150.355', '151.356', '152.357', '153.358', '154.359', '155.360', '156.361', '157.362', '158.363', '159.364', '160.365', '161.366', '162.367', '163.368', '164.369', '165.370', '166.371', '167.372', '168.373', '169.374', '170.375', '171.376', '172.377', '173.378', '174.379', '175.380', '176.381', '177.382', '178.383', '179.384', '180.385', '181.386', '182.387', '183.388', '184.389', '185.390', '186.391', '187.392', '188.393', '189.394', '190.395', '191.396', '192.397', '193.398', '194.399', '195.400', '196.401', '197.402', '198.403', '199.404', '200.405', '201.406', '202.407', '203.408', '204.409', '205.410', '206.411', '207.412', '208.413', '209.414', '210.415', '211.416', '212.417', '213.418', '214.419', '215.420', '216.421', '217', '218', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.422', '238', '239', '240', '241', '242', '243', '243.423', '243.424', '243.425', '243.426', '243.427', '243.428', '243.429', '243.430', '243.431', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454', '254.455', '254.456', '254.457', '254.458', '254.459', '254.460', '254.461', '254.462', '254.463', '254.464']), StandardNumbering(id='standardnumbering98', reference_id='BAH60832.1', numbered_id='KAI9294962.1', numbering=['0.1', '0.2', '0.3', '0.4', '0.5', '0.6', '0.7', '0.8', '0.9', '0.10', '0.11', '0.12', '0.13', '0.14', '0.15', '0.16', '0.17', '0.18', '0.19', '0.20', '0.21', '0.22', '0.23', '0.24', '0.25', '0.26', '0.27', '0.28', '0.29', '0.30', '0.31', '0.32', '0.33', '0.34', '0.35', '0.36', '0.37', '0.38', '0.39', '0.40', '0.41', '0.42', '0.43', '0.44', '0.45', '0.46', '0.47', '0.48', '0.49', '0.50', '0.51', '0.52', '0.53', '0.54', '0.55', '0.56', '0.57', '0.58', '0.59', '0.60', '0.61', '0.62', '0.63', '0.64', '0.65', '0.66', '0.67', '0.68', '0.69', '0.70', '0.71', '0.72', '0.73', '0.74', '0.75', '0.76', '0.77', '0.78', '0.79', '0.80', '0.81', '0.82', '0.83', '0.84', '0.85', '0.86', '0.87', '0.88', '0.89', '0.90', '0.91', '0.92', '0.93', '0.94', '0.95', '0.96', '0.97', '0.98', '0.99', '0.100', '0.101', '0.102', '0.103', '0.104', '0.105', '0.106', '0.107', '0.108', '0.109', '0.110', '0.111', '0.112', '0.113', '0.114', '0.115', '0.116', '0.117', '0.118', '0.119', '0.120', '0.121', '0.122', '0.123', '0.124', '0.125', '0.126', '0.127', '0.128', '0.129', '0.130', '0.131', '0.132', '0.133', '0.134', '0.135', '0.136', '0.137', '0.138', '0.139', '0.140', '0.141', '0.142', '0.143', '0.144', '0.145', '0.146', '0.147', '0.148', '0.149', '0.150', '0.151', '0.152', '0.153', '0.154', '0.155', '0.156', '0.157', '0.158', '0.159', '0.160', '0.161', '0.162', '0.163', '0.164', '0.165', '0.166', '0.167', '0.168', '0.169', '0.170', '0.171', '0.172', '0.173', '0.174', '0.175', '0.176', '0.177', '0.178', '0.179', '0.180', '1', '2', '3', '3.181', '3.182', '3.183', '3.184', '3.185', '3.186', '3.187', '3.188', '3.189', '3.190', '3.191', '3.192', '4', '5', '5.193', '5.194', '5.195', '5.196', '5.197', '6', '7', '7.198', '7.199', '7.200', '7.201', '7.202', '8', '8.203', '8.204', '8.205', '8.206', '8.207', '8.208', '8.209', '8.210', '8.211', '9', '10', '11', '12', '13', '14', '15', '16', '17', '18', '19.212', '20.213', '21.214', '22.215', '23.216', '24.217', '25.218', '26.219', '27.220', '28.221', '29.222', '30.223', '31.224', '32.225', '33.226', '34.227', '35.228', '36.229', '37.230', '38.231', '39.232', '40.233', '41.234', '42.235', '43.236', '44.237', '45.238', '46.239', '47.240', '48.241', '49.242', '50.243', '51.244', '52.245', '53.246', '54.247', '55.248', '56.249', '57.250', '58.251', '59.252', '60.253', '61.254', '62.255', '63.256', '64.257', '65.258', '66.259', '67.260', '68.261', '69.262', '70.263', '71.264', '72.265', '73.266', '74.267', '75.268', '76.269', '77.270', '78.271', '79.272', '80.273', '81.274', '82.275', '83.276', '84.277', '85.278', '86.279', '87.280', '88.281', '89.282', '90.283', '91.284', '92.285', '93.286', '94.287', '95.288', '96.289', '97.290', '98.291', '99.292', '100.293', '101.294', '102.295', '103.296', '104.297', '105.298', '106.299', '107.300', '108.301', '109.302', '110.303', '111.304', '112.305', '113.306', '114.307', '115.308', '116.309', '117.310', '118.311', '119.312', '120.313', '121.314', '122.315', '123.316', '124.317', '125.318', '126.319', '127.320', '128.321', '129.322', '130.323', '131.324', '132.325', '133.326', '134.327', '135.328', '136.329', '137.330', '138.331', '139.332', '140.333', '141.334', '142.335', '143.336', '144.337', '145.338', '146.339', '147.340', '148.341', '149.342', '150.343', '151.344', '152.345', '153.346', '154.347', '155.348', '156.349', '157.350', '158.351', '159.352', '160.353', '161.354', '162.355', '163.356', '164.357', '165.358', '166.359', '167.360', '168.361', '169.362', '170.363', '171.364', '172.365', '173.366', '174.367', '175.368', '176.369', '177.370', '178.371', '179.372', '180.373', '181.374', '182.375', '183.376', '184.377', '185.378', '186.379', '187.380', '188.381', '189.382', '190.383', '191.384', '192.385', '193.386', '194.387', '195.388', '196.389', '197.390', '198.391', '199.392', '200.393', '201.394', '202.395', '203.396', '204.397', '205.398', '206.399', '207.400', '208.401', '209.402', '210.403', '211.404', '212.405', '213.406', '214.407', '215.408', '216.409', '217.410', '218.411', '219', '220', '221', '222', '223', '224', '225', '226', '227', '228', '229', '230', '231', '232', '233', '234', '235', '236', '237', '237.412', '238', '239', '240', '241', '242', '243', '243.413', '243.414', '243.415', '243.416', '243.417', '243.418', '243.419', '243.420', '243.421', '244', '245', '246', '247', '248', '249', '250', '251', '252', '253', '254', '254.422', '254.423', '254.424', '254.425', '254.426', '254.427', '254.428', '254.429', '254.430', '254.431', '254.432', '254.433', '254.434', '254.435', '254.436', '254.437', '254.438', '254.439', '254.440', '254.441', '254.442', '254.443', '254.444', '254.445', '254.446', '254.447', '254.448', '254.449', '254.450', '254.451', '254.452', '254.453', '254.454'])])"
- ]
- },
- "execution_count": 9,
- "metadata": {},
- "output_type": "execute_result"
- }
- ],
- "source": [
- "alignment"
- ]
- },
- {
- "cell_type": "code",
- "execution_count": 1,
- "metadata": {},
- "outputs": [],
- "source": []
- },
- {
- "cell_type": "code",
- "execution_count": 1,
- "metadata": {},
- "outputs": [
- {
- "name": "stderr",
- "output_type": "stream",
- "text": [
- "β¬οΈ Fetching protein sequences: 100%|ββββββββββ| 4/4 [00:00<00:00, 1292.84it/s]\n"
- ]
- },
- {
- "name": "stdout",
- "output_type": "stream",
- "text": [
- "π Running CLUSTALO\n"
- ]
- }
- ],
- "source": [
- "from pyeed.core import ProteinInfo, Alignment\n",
- "from pyeed.aligners import ClustalOmega\n",
- "\n",
- "# Get sequences\n",
- "ncbi_accessions = [\"QGC48744.1\", \"AAT46413.1\", \"AAT46414.1\", \"AAT46415.1\"]\n",
- "sequences = ProteinInfo.from_ncbi(ncbi_accessions)\n",
- "\n",
- "# Create and run alignment\n",
- "alignment = Alignment.from_sequences(sequences, aligner=ClustalOmega)"
- ]
- },
- {
- "cell_type": "code",
- "execution_count": 2,
- "metadata": {},
- "outputs": [
- {
- "name": "stderr",
- "output_type": "stream",
- "text": [
- "β¬οΈ Fetching protein sequences: 100%|ββββββββββ| 2/2 [00:00<00:00, 558.68it/s]"
- ]
- },
- {
- "name": "stdout",
- "output_type": "stream",
- "text": [
- "[Sequence(id='sequence8', source_id='QGC48744.1', sequence='ALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'), Sequence(id='sequence9', source_id='AAT46413.1', sequence='MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMLSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDHWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW')]\n"
- ]
- },
- {
- "name": "stderr",
- "output_type": "stream",
- "text": [
- "\n"
- ]
- }
- ],
- "source": [
- "from pyeed.core import ProteinInfo, Alignment\n",
- "from pyeed.aligners import PairwiseAligner\n",
- "\n",
- "# Get sequences\n",
- "ncbi_accessions = [\"QGC48744.1\", \"AAT46413.1\"]\n",
- "sequences = ProteinInfo.from_ncbi(ncbi_accessions)\n",
- "\n",
- "# Create and run alignment\n",
- "alignment = Alignment.from_sequences(sequences, aligner=PairwiseAligner)"
- ]
- }
- ],
- "metadata": {
- "kernelspec": {
- "display_name": "pye",
- "language": "python",
- "name": "python3"
- },
- "language_info": {
- "codemirror_mode": {
- "name": "ipython",
- "version": 3
- },
- "file_extension": ".py",
- "mimetype": "text/x-python",
- "name": "python",
- "nbconvert_exporter": "python",
- "pygments_lexer": "ipython3",
- "version": "3.10.13"
- }
- },
- "nbformat": 4,
- "nbformat_minor": 2
-}
diff --git a/mkdocs.yml b/mkdocs.yml
index 42471fad..8f20defd 100644
--- a/mkdocs.yml
+++ b/mkdocs.yml
@@ -2,26 +2,36 @@ site_name: PyEED Documentation
repo_url: https://github.com/PyEED/pyeed/
repo_name: PyEED/pyeed
site_url: https://pyeed.github.io/pyeed/
+site_author: Max HΓ€uΓler
+
nav:
- π Home: index.md
- β‘οΈ Quick Start:
- - The Sequence objects: examples/basics.md
- - Finding Sequences: examples/blast.md
- - Aligning Sequences: examples/alignments.md
- - Clustering Sequences: examples/clustering.md
- - Creating Sequence Networks: examples/networks.md
+ - quick_start/index.md
+ - The Sequence objects: quick_start/basics.md
+ - Finding Sequences: quick_start/blast.md
+ - Aligning Sequences: quick_start/alignments.md
+ - Clustering Sequences: quick_start/clustering.md
+ - Creating Sequence Networks: quick_start/networks.md
- π Use cases:
- Get an Overview over a Protein Family: usecases/usecase1.md
- β¬οΈ Installation:
- - PIP: installation/pip.md
- - Docker: installation/docker.md
+ - Install PyEED: installation/install_pyeed.md
+ - Setup Local BLAST database: installation/setup_local_blast.md
theme:
name: material
logo: figs/pyeed.png
features:
+ - navigation.instant
+ - navigation.instant.progress
+ - navigation.instant.preview
+ - navigation.indexes
+ - navigation.footer
+
+ - content.action.view
- navigation.tabs
- navigation.sections
- toc.integrate
diff --git a/pyeed/aligners/abstract_aligner.py b/pyeed/aligners/abstract_aligner.py
index 0254da8f..17a65837 100644
--- a/pyeed/aligners/abstract_aligner.py
+++ b/pyeed/aligners/abstract_aligner.py
@@ -1,6 +1,6 @@
from typing import List
from abc import ABC, abstractmethod
-from pydantic import BaseModel, Field, PrivateAttr
+from pydantic import BaseModel, Field
class AbstractAligner(BaseModel, ABC):
diff --git a/pyeed/aligners/clustalo.py b/pyeed/aligners/clustalo.py
index 2a944898..8b82e1b4 100644
--- a/pyeed/aligners/clustalo.py
+++ b/pyeed/aligners/clustalo.py
@@ -48,7 +48,8 @@ def setup_command(self):
Returns:
str: The command to run the ClustalOmega container.
"""
- return "clustalo -i /data/input.fasta -o /data/output.clu --outfmt=clu"
+ threads = os.cpu_count()
+ return f"clustalo -i /data/input.fasta -o /data/output.clu --outfmt=clu --threads={threads}"
def extract_output_data(self) -> MultipleSeqAlignment:
"""
diff --git a/pyeed/aligners/pairwise.py b/pyeed/aligners/pairwise.py
index d1cc57eb..a66adcb0 100644
--- a/pyeed/aligners/pairwise.py
+++ b/pyeed/aligners/pairwise.py
@@ -1,14 +1,14 @@
-from numpy import short
-from pydantic import BaseModel, Field, validator
-import sdRDM
-from typing import Any, List, Optional
-from itertools import combinations
-from Bio.Align import PairwiseAligner as BioPairwiseAligner
-from tqdm import tqdm
+from pydantic import Field, validator
+from typing import TYPE_CHECKING, Any
+
from pyeed.aligners import AbstractAligner
+from Bio.Align import PairwiseAligner as BioPairwiseAligner
+if TYPE_CHECKING:
+ from Bio.Align import Alignment as BioAlignment
+ from Bio.Align.substitution_matrices import Array as BioSubstitutionMatrix
-from joblib import Parallel, delayed, cpu_count
+from pyeed.core.sequence import Sequence
class PairwiseAligner(AbstractAligner):
@@ -61,7 +61,7 @@ def substitution_matrix_validator(cls, substitution_matrix):
return substitution_matrix
- def align(self):
+ def align(self) -> "BioAlignment":
"""
Aligns two sequences using the specified alignment parameters of the `PairwiseAligner` class.
@@ -84,74 +84,16 @@ def align(self):
if self.substitution_matrix != "None":
aligner.substitution_matrix = self._load_substitution_matrix()
- shorter_seq, longer_seq = sorted(self.sequences, key=lambda x: len(x))
-
- alignment_result = aligner.align(shorter_seq, longer_seq)[0]
-
- # aligned_sequences = [
- # Sequence(source_id=shorter_seq.source_id, sequence=alignment_result[0]),
- # Sequence(source_id=longer_seq.source_id, sequence=alignment_result[1]),
- # ]
-
- # gaps = alignment_result.counts().gaps
- # mismatches = alignment_result.counts().mismatches
- # identities = alignment_result.counts().identities
- # identity = identities / len(shorter_seq.sequence)
-
- # standard_numbering = StandardNumbering(
- # reference_id=shorter_seq.source_id,
- # numbered_id=longer_seq.source_id,
- # numbering=Alignment._get_numbering_string(
- # shorter_seq.sequence, longer_seq.sequence
- # ),
- # )
-
- # alignment = PairwiseAlignment(
- # input_sequences=[shorter_seq, longer_seq],
- # method=self.mode,
- # aligned_sequences=aligned_sequences,
- # standard_numberings=[standard_numbering],
- # score=alignment_result.score,
- # identity=identity,
- # gaps=gaps,
- # mismatches=mismatches,
- # )
+ alignment_result = aligner.align(self.sequences[0], self.sequences[1])[0]
return alignment_result
- def _load_substitution_matrix(self) -> Any:
+ def _load_substitution_matrix(self) -> "BioSubstitutionMatrix":
from Bio.Align import substitution_matrices
return substitution_matrices.load(self.substitution_matrix)
-# def multi_pairwise_alignment(
-# protien_infos: List[ProteinInfo],
-# mode: str = "global",
-# match: int = 1,
-# mismatch: int = -1,
-# gap_open: int = -1,
-# gap_extend: int = 0,
-# substitution_matrix: str = "None",
-# n_jobs: int = None,
-# ):
-# pairs = list(combinations(protien_infos, 2))
-
-# if n_jobs is None:
-# n_jobs = cpu_count()
-
-# alignments = Parallel(n_jobs=n_jobs, prefer="processes")(
-# delayed(pairwise_alignment)(
-# reference,
-# query,
-# mode,
-# match,
-# mismatch,
-# gap_open,
-# gap_extend,
-# substitution_matrix,
-# )
-# for reference, query in tqdm(pairs, desc="βοΈ Aligning sequences")
-# )
-
-# return alignments
+if __name__ == "__main__":
+
+ seq1 = Sequence(sequence="wee")
diff --git a/pyeed/containers/abstract_container.py b/pyeed/containers/abstract_container.py
index 5614a10a..1e0795e0 100644
--- a/pyeed/containers/abstract_container.py
+++ b/pyeed/containers/abstract_container.py
@@ -10,8 +10,7 @@
from docker.client import DockerClient
from docker.models.containers import Container
from docker.models.images import Image
-
-from pyeed.ncbi import seq_io
+from docker.errors import DockerException
class ToolImage(Enum):
@@ -62,7 +61,15 @@ def __init__(self, **kwargs):
BaseModel.__init__(self, **kwargs)
super().__init__(**kwargs)
self._tempdir_path = tempfile.mkdtemp()
- self._client = docker.from_env()
+ self._client = self._initialize_docker_client()
+
+ def _initialize_docker_client(self) -> DockerClient:
+ try:
+ client = docker.from_env()
+ client.ping()
+ return client
+ except DockerException as e:
+ print(f"Docker is not running. Start the Docker application. {e}")
def get_image(self) -> Image:
"""Gets the image from Docker Hub. If the image is not found, it will be pulled."""
diff --git a/pyeed/core/alignment.py b/pyeed/core/alignment.py
index d469b853..99bb4a7f 100644
--- a/pyeed/core/alignment.py
+++ b/pyeed/core/alignment.py
@@ -1,23 +1,60 @@
-import re
+from numpy import short
import sdRDM
-
-from typing import List, Optional, Union
+from tqdm import tqdm
+from itertools import combinations
+from typing import List, Optional, Union, Tuple, TYPE_CHECKING
from pydantic import Field, validator
from sdRDM.base.listplus import ListPlus
from sdRDM.base.utils import forge_signature, IDGenerator
+from Bio.Align import Alignment as BioAlignment
+from joblib import Parallel, delayed, cpu_count
-from pyeed.aligners.pairwise import PairwiseAligner
+if TYPE_CHECKING:
+ from pyeed.core.dnainfo import DNAInfo
+ from pyeed.core.proteininfo import ProteinInfo
+ from .abstractsequence import AbstractSequence
+ from pyeed.containers.abstract_container import AbstractContainer
+ from pyeed.aligners.pairwise import PairwiseAligner
-from .abstractsequence import AbstractSequence
-from .sequence import Sequence
-from .standardnumbering import StandardNumbering
-from pyeed.containers.abstract_container import AbstractContainer
+from .standardnumbering import StandardNumbering
+from .sequence import Sequence
+from .abstractsequence import AbstractSequence
@forge_signature
class Alignment(sdRDM.DataModel):
- """"""
+ """
+ Description of the Alignment class.
+
+ Attributes:
+ id (Optional[str]): Unique identifier of the given object.
+ method (Optional[str]): Applied alignment method.
+ consensus (Optional[str]): Consensus sequence of the alignment.
+ input_sequences (List[Sequence]): Sequences of the alignment.
+ aligned_sequences (List[Sequence]): Aligned sequences of the alignment.
+ standard_numberings (List[StandardNumbering]): Standard numbering of the aligned sequences.
+
+ Methods:
+ add_to_input_sequences(source_id: Optional[str] = None, sequence: Optional[str] = None, id: Optional[str] = None) -> None:
+ Adds an object of type 'Sequence' to attribute input_sequences.
+
+ add_to_aligned_sequences(source_id: Optional[str] = None, sequence: Optional[str] = None, id: Optional[str] = None) -> None:
+ Adds an object of type 'Sequence' to attribute aligned_sequences.
+
+ add_to_standard_numberings(reference_id: Optional[str] = None, numbered_id: Optional[str] = None, numbering: List[str] = ListPlus(), id: Optional[str] = None) -> None:
+ Adds an object of type 'StandardNumbering' to attribute standard_numberings.
+
+ align(aligner: Union["AbstractContainer", "PairwiseAligner"], **kwargs):
+ Aligns the input sequences using the specified aligner.
+
+ apply_standard_numbering(reference: Sequence = None):
+ Applies standard numbering to the aligned sequences.
+
+ from_sequences(sequences: List[Union["ProteinInfo", "DNAInfo"]], aligner: Union["AbstractContainer", "PairwiseAligner"] = None, **kwargs):
+ Creates an Alignment object from a list of sequences and optionally aligns them.
+
+ """
id: Optional[str] = Field(
description="Unique identifier of the given object.",
@@ -133,20 +170,46 @@ def add_to_standard_numberings(
self.standard_numberings.append(StandardNumbering(**params))
return self.standard_numberings[-1]
- def align(self, aligner: Union[AbstractContainer, PairwiseAligner], **kwargs):
+ def align(self, aligner: Union["AbstractContainer", "PairwiseAligner"], **kwargs):
+ """
+ Aligns the input sequences using the specified aligner.
+
+ Args:
+ aligner (Union[AbstractContainer, PairwiseAligner]): The aligner object to use for alignment.
+ **kwargs: Additional keyword arguments to pass to the aligner.
+
+ Returns:
+ Alignment or List[PairwiseAlignment]: The aligned sequences. If a Multi sequence aligner is used, an Alignment object will be returned.
+ If a PairwiseAligner is used, a list of PairwiseAlignment object will be returned. If more than two sequences are provided,
+ a list of PairwiseAlignment objects will be returned.
+
+ Raises:
+ ValueError: If the aligner is not an instance of AbstractContainer or PairwiseAligner.
+ """
+
+ from pyeed.containers.abstract_container import AbstractContainer
+ from pyeed.aligners.pairwise import PairwiseAligner
if issubclass(aligner, AbstractContainer):
- self._container_align(aligner, **kwargs)
+ return self._container_align(aligner, **kwargs)
elif issubclass(aligner, PairwiseAligner):
- self._python_align(aligner, **kwargs)
+ return self._python_align(aligner, **kwargs)
else:
raise ValueError(
"aligner must be an instance of AbstractContainer or PairwiseAligner"
)
- def _container_align(self, aligner: AbstractContainer, **kwargs):
+ def _container_align(self, aligner: "AbstractContainer", **kwargs):
+ """Runs alignment using a containerized aligner.
+
+ Args:
+ aligner (AbstractContainer): Containerized aligner to be called.
+
+ Returns:
+ Any: Alignment result
+ """
sequences = [seq.fasta_string() for seq in self.input_sequences]
alignment = aligner().align(sequences=sequences)
@@ -167,38 +230,145 @@ def _container_align(self, aligner: AbstractContainer, **kwargs):
self.apply_standard_numbering()
- def _python_align(self, aligner: PairwiseAligner, **kwargs):
+ return self
+
+ def _map_to_pairwisealignment(self):
+
+ from pyeed.core.pairwisealignment import PairwiseAlignment
+
+ return PairwiseAlignment(
+ input_sequences=self.input_sequences,
+ method=self.method,
+ aligned_sequences=self.aligned_sequences,
+ standard_numberings=self.standard_numberings,
+ )
+
+ def _python_align(self, aligner: "PairwiseAligner", **kwargs):
+ """Runs alignment using a python-based aligner.
+
+ Args:
+ aligner (PairwiseAligner): Python-based aligner to be called.
+
+ Raises:
+ ValueError: If the number of sequences is less than 2.
+
+ Returns:
+ _type_: Alignment result
+ """
+
+ # Pairwise alignment
if len(self.input_sequences) == 2:
- alignment_reuslt = aligner(
+
+ pairwise_aligner = aligner(
sequences=[
self.input_sequences[0].sequence,
self.input_sequences[1].sequence,
],
**kwargs,
- ).align()
+ )
+ alignment_result = pairwise_aligner.align()
+ self.method = pairwise_aligner.mode
+
+ return self._map_pairwise_alignment_results(
+ alignment_result,
+ pair=(
+ self.input_sequences[0],
+ self.input_sequences[1],
+ ),
+ mode=pairwise_aligner.mode,
+ )
+
+ # Multi pairwise alignment
+ elif len(self.input_sequences) > 2:
+ pairs = list(combinations(self.input_sequences, 2))
+
+ aligners = [
+ aligner(sequences=[s.sequence for s in pair], **kwargs)
+ for pair in pairs
+ ]
+
+ alignments = Parallel(n_jobs=cpu_count(), prefer="processes")(
+ delayed(a.align)()
+ for a in tqdm(aligners, desc="βοΈ Running pairwise alignments")
+ )
+
+ return [
+ self._map_pairwise_alignment_results(
+ alignment, pair, mode=aligners[0].mode
+ )
+ for alignment, pair in zip(alignments, pairs)
+ ]
- # self.aligned_sequences = [
- # Sequence(source_id=seq.id, sequence=str(seq.seq))
- # for seq in alignment_reuslt
- # ]
+ else:
+ raise ValueError(
+ f"Alignment Error. Recieved {len(self.input_sequences)} sequences. Expected 2."
+ )
- # TODO: Alignment has no ID attriburte
- # TODO: Map to data model
- return alignment_reuslt
+ def _map_pairwise_alignment_results(
+ self, alignment_result: BioAlignment, pair: Tuple[Sequence, Sequence], mode: str
+ ) -> "PairwiseAlignment":
+ """Maps the results of a pairwise alignment to a PairwiseAlignment object.
+
+ Args:
+ alignment_result (BioAlignment): The result of the pairwise alignment.
+ pair (Tuple[Sequence, Sequence]): The pair of sequences that were aligned.
+ mode (str): The alignment mode used.
+
+ Returns:
+ PairwiseAlignment: PairwiseAlignment object
+ """
+ from pyeed.core.pairwisealignment import PairwiseAlignment
+
+ self.aligned_sequences = [
+ Sequence(source_id=pair[0].source_id, sequence=alignment_result[0]),
+ Sequence(source_id=pair[1].source_id, sequence=alignment_result[1]),
+ ]
+
+ shorter_seq = min(self.input_sequences, key=lambda x: len(x.sequence))
+
+ identities = alignment_result.counts().identities
+ identity = identities / len(shorter_seq.sequence)
+
+ pairwise_alignment = PairwiseAlignment(
+ input_sequences=list(pair),
+ method=mode,
+ aligned_sequences=self.aligned_sequences,
+ score=alignment_result.score,
+ gaps=alignment_result.counts().gaps,
+ identity=identity,
+ mismatches=alignment_result.counts().mismatches,
+ )
+
+ return pairwise_alignment
@classmethod
def from_sequences(
cls,
- sequences: List[AbstractSequence],
- aligner: Union[AbstractContainer, PairwiseAligner] = None,
+ sequences: List[Union["ProteinInfo", "DNAInfo"]],
+ aligner: Union["AbstractContainer", "PairwiseAligner"] = None,
**kwargs,
):
+ """
+ Creates an instance of the Alignment class from a list of sequences.
+ If an aligner is provided, it also aligns the sequences.
+
+ Args:
+ sequences (List[Union["ProteinInfo", "DNAInfo"]]): A list of sequences to be aligned.
+ aligner (Union["AbstractContainer", "PairwiseAligner"], optional): The aligner object to use for alignment.
+ If not provided, the sequences will not be aligned.
+ **kwargs: Additional keyword arguments to pass to the aligner.
+
+ Returns:
+ Alignment: An instance of the Alignment class with the provided sequences.
+ If an aligner was provided, the sequences will be aligned.
+ """
+
alignment = cls(
input_sequences=sequences,
)
if aligner is not None:
- alignment.align(aligner, **kwargs)
+ return alignment.align(aligner, **kwargs)
return alignment
@@ -213,7 +383,6 @@ def _get_numbering_string(reference: str, query: str) -> List[str]:
Returns:
List[str]: A list of pairwise numbering.
-
"""
numbering = []
diff --git a/pyeed/core/dnainfo.py b/pyeed/core/dnainfo.py
index 089f770b..b6d34065 100644
--- a/pyeed/core/dnainfo.py
+++ b/pyeed/core/dnainfo.py
@@ -7,7 +7,6 @@
from .span import Span
from .dnaregiontype import DNARegionType
from .dnaregion import DNARegion
-from ..ncbi.seq_io import get_ncbi_entry, _seqio_to_dna_info
@forge_signature
@@ -63,6 +62,8 @@ def add_to_regions(
@classmethod
def from_ncbi(cls, accession_id: str) -> "DNAInfo":
+ from pyeed.ncbi.seq_io import get_ncbi_entry, _seqio_to_dna_info
+
seq_record = get_ncbi_entry(accession_id=accession_id, database="nucleotide")
return _seqio_to_dna_info(cls, seq_record)
diff --git a/pyeed/core/proteininfo.py b/pyeed/core/proteininfo.py
index d367b39f..4173892d 100644
--- a/pyeed/core/proteininfo.py
+++ b/pyeed/core/proteininfo.py
@@ -14,8 +14,6 @@
from .substrate import Substrate
from .dnaregion import DNARegion
from .proteinsitetype import ProteinSiteType
-from ..ncbi.seq_io import _seqio_to_nucleotide_info, get_ncbi_entry, get_ncbi_entrys
-
from pyeed.containers.abstract_container import Blastp
@@ -162,6 +160,8 @@ def add_to_substrates(
@classmethod
def from_ncbi(cls, accession_id: str) -> "ProteinInfo":
+ from ..ncbi.seq_io import _seqio_to_nucleotide_info, get_ncbi_entry
+
"""
This method creates a 'ProteinInfo' object from a given NCBI ID.
@@ -182,12 +182,16 @@ def from_ncbi(cls, accession_id: str) -> "ProteinInfo":
@classmethod
def _from_seq_record(cls, seq_record) -> "ProteinInfo":
+ from ..ncbi.seq_io import _seqio_to_nucleotide_info
+
return _seqio_to_nucleotide_info(cls, seq_record)
@classmethod
def from_accessions(
cls, accession_ids: List[str], email: str = None, api_key: str = None
) -> List["ProteinInfo"]:
+ from ..ncbi.seq_io import get_ncbi_entrys
+
seq_entries = get_ncbi_entrys(
accession_ids=accession_ids,
database="protein",
@@ -216,6 +220,7 @@ def ncbi_blastp(
Returns:
List[ProteinInfo]: List of 'ProteinInfo' objects that are the result of the blast search.
"""
+ from ..ncbi.seq_io import get_ncbi_entrys
print(f"ππΌββοΈ Running PBLAST")
print(f"βββ protein name: {self.name}")
diff --git a/pyeed/ncbi/seq_io.py b/pyeed/ncbi/seq_io.py
index a8ee324f..5a869431 100644
--- a/pyeed/ncbi/seq_io.py
+++ b/pyeed/ncbi/seq_io.py
@@ -1,14 +1,11 @@
import re
import secrets
-from datetime import datetime
from tqdm import tqdm
from typing import List
from Bio import SeqIO, Entrez
-from pyeed.core.citation import Citation
from pyeed.core.dnaregion import DNARegion
from pyeed.core.dnaregiontype import DNARegionType
from pyeed.core.proteinregion import ProteinRegion
-from pyeed.core.proteinregiontype import ProteinRegionType
from pyeed.core.proteinsitetype import ProteinSiteType
from pyeed.core.site import Site
diff --git a/pyeed/network/__init__.py b/pyeed/network/__init__.py
index 7343b301..f0e0d1ca 100644
--- a/pyeed/network/__init__.py
+++ b/pyeed/network/__init__.py
@@ -1 +1 @@
-from .network import pairwise_network
+from .network import SequenceNetwork
diff --git a/pyeed/network/network.py b/pyeed/network/network.py
index 2b9ba4d9..e5067fa9 100644
--- a/pyeed/network/network.py
+++ b/pyeed/network/network.py
@@ -1,204 +1,344 @@
-from typing import List
+from typing import List, Optional
import networkx as nx
import plotly.graph_objects as go
+import plotly.express as px
+from pydantic import BaseModel, Field
-from pyeed.core.proteininfo import ProteinInfo
-from pyeed.core.alignment import Alignment
-
-
-def pairwise_network(
- alignments: List[Alignment],
- weight: str = "identity",
- cutoff: float = None,
- label: str = "accession_id",
- color: str = "name",
-) -> None:
- """Takes a list of `Alignment`, constructs a network graph,
- whereas the edges of the graph are weighted with an attribute of the
- `Alignment` object. Visualizes the network graph.
-
- Args:
- alignments (List[Alignment]): List of pairwise alignments.
- weight (str, optional): Attribute of `Alignment` to weight the edges.
- Defaults to "identity".
- cutoff (float, optional): Sequences with a weight higher than the cutoff are connected
- in the network. Defaults to None.
- label (str, optional): Node labe in the graph. Defaults to "accession_id".
- color (str, optional): Attribute of `ProteinInfo` co colorize nodes. Defaults to "name".
-
- Raises:
- ValueError: If 'weights' is not one of "identity", "score", "gaps", or "mismatches".
- ValueError: If 'label' is not one of "name", "organism", "ec_number",
- "mol_weight", or "accession_id".
- """
+from pyeed.core.abstractsequence import AbstractSequence
+from pyeed.core.pairwisealignment import PairwiseAlignment
- # Validate weights
- weights = ["identity", "score", "gaps", "mismatches"]
- if weight not in weights:
- raise ValueError(
- f"'weight' to parameterize network must be an alignment property ({weights})"
- )
- # Validate labels
- labels = ["name", "organism", "ec_number", "mol_weight", "accession_id"]
- if label not in labels:
- raise ValueError(
- f"'label' to parameterize network must be an alignment property ({labels})"
- )
+class SequenceNetwork(BaseModel):
+ """
+ A class representing a sequence network.
+
+ The SequenceNetwork class is used to create and visualize a network of sequences. It takes a list of AbstractSequence objects and a list of PairwiseAlignment objects as input. The network can be visualized in 2D or 3D, with nodes representing sequences and edges representing alignments between sequences.
+
+ Attributes:
+ sequences (Optional[List[AbstractSequence]]): A list of AbstractSequence objects to be compared in the network. Default is an empty list.
+ pairwise_alignments (Optional[List[PairwiseAlignment]]): A list of PairwiseAlignment objects representing the pairwise alignments between sequences. Default is an empty list.
+ weight (Optional[str]): The attribute of the Alignment object to weight the edges in the network. Default is "identity".
+ color (Optional[str]): The attribute of the ProteinInfo object to colorize the nodes in the network. Default is "name".
+ threshold (Optional[float]): Sequences with a weight higher than the threshold are connected in the network. Default is None.
+ label (Optional[str]): The node label in the graph. Default is "name".
+ dimensions (Optional[int]): The dimension of the network graph. Default is 3.
+
+ Methods:
+ graph() -> nx.Graph: Maps properties of alignments to a network graph.
+ visualize(): Visualizes the network graph.
+ """
- graph = construct_network(alignments, cutoff=cutoff)
+ sequences: Optional[List[AbstractSequence]] = Field(
+ default=[],
+ description="List of sequences to be compared",
+ )
+
+ pairwise_alignments: Optional[List[PairwiseAlignment]] = Field(
+ default=[],
+ description="List of pairwise alignments",
+ )
- graph = position_nodes_and_edges(graph, weight=weight)
+ weight: Optional[str] = Field(
+ default="identity",
+ description="Attribute of Alignment to weight the edges",
+ )
- visualize_network(graph, label=label, color=color)
+ color: Optional[str] = Field(
+ default="name",
+ description="Attribute of ProteinInfo to colorize nodes",
+ )
+ threshold: Optional[float] = Field(
+ default=None,
+ description="Sequences with a weight higher than the threshold are connected in the network",
+ )
-def construct_network(alignments: List[Alignment], cutoff: float) -> nx.Graph:
- """Maps properties of alignments to a network graph."""
- graph = nx.Graph()
+ label: Optional[str] = Field(
+ default="name",
+ description="Node label in the graph",
+ )
- sequences = _get_unique_sequences(alignments)
+ dimensions: Optional[int] = Field(
+ default=3,
+ description="Dimension of the network graph",
+ )
- # Add nodes and assign node attributes
- for sequence in sequences:
- graph.add_node(
- node_for_adding=sequence.source_id,
- name=sequence.name,
- accession_id=sequence.source_id,
- organism=sequence.organism.name,
- ec_number=sequence.ec_number,
- mol_weight=sequence.mol_weight,
- )
+ @property
+ def graph(self) -> nx.Graph:
+ """
+ Maps properties of alignments to a network graph.
+
+ Returns:
+ nx.Graph: The network graph representing the sequence network.
+
+ Raises:
+ ValueError: If the dimensions of the network graph are greater than 3.
+
+ Notes:
+ - The graph is created using the NetworkX library.
+ - Nodes in the graph represent sequences, and edges represent alignments between sequences.
+ - Node attributes include the sequence name, organism, and taxonomy ID.
+ - Edge attributes include the alignment identity, gaps, mismatches, and score.
+ - The graph can be visualized in 2D or 3D using the visualize() method.
+ """
+ graph = nx.Graph()
+
+ # Add nodes and assign node attributes
+ for sequence in self.sequences:
+ graph.add_node(
+ sequence.source_id,
+ name=sequence.name,
+ organism=sequence.organism,
+ taxonomy_id=sequence.organism.taxonomy_id,
+ )
- # Add edges and assign edge attributes
- if cutoff != None:
- for alignment in alignments:
- if alignment.identity >= cutoff:
+ # Add edges and assign edge attributes
+ if self.threshold != None:
+ for alignment in self.pairwise_alignments:
+ if alignment.identity >= self.threshold:
+ graph.add_edge(
+ alignment.input_sequences[0].source_id,
+ alignment.input_sequences[1].source_id,
+ identity=alignment.identity,
+ gaps=1 / (alignment.gaps + 1),
+ mismatches=1 / (alignment.mismatches + 1),
+ score=alignment.score,
+ )
+ else:
+ for alignment in self.pairwise_alignments:
graph.add_edge(
- alignment.reference_seq.source_id,
- alignment.query_seq.source_id,
+ alignment.input_sequences[0].source_id,
+ alignment.input_sequences[1].source_id,
identity=alignment.identity,
gaps=1 / (alignment.gaps + 1),
mismatches=1 / (alignment.mismatches + 1),
score=alignment.score,
)
- else:
- for alignment in alignments:
- graph.add_edge(
- alignment.reference_seq.source_id,
- alignment.query_seq.source_id,
- identity=alignment.identity,
- gaps=1 / (alignment.gaps + 1),
- mismatches=1 / (alignment.mismatches + 1),
- score=alignment.score,
- )
-
- return graph
-
-
-def visualize_network(graph: nx.Graph, label: str, color: str):
- """Visualizes a network graph."""
- # TODO: Refactor coloration of nodes
- # TODO: Add ability to colorize edges
-
- colors = ["blue", "red", "green", "orange", "purple", "pink", "brown", "yellow"]
- traces = []
- # Add edges
- for edge in graph.edges:
- traces.append(
- go.Scatter(
- x=graph.edges[edge]["x_pos"],
- y=graph.edges[edge]["y_pos"],
- mode="lines",
- line=dict(
- width=1,
- # colorscale="YlGnBu",
- # colorbar=dict(title='Heatmap Colorscale')
- color="rgba(128, 128, 128, 0.1)",
- ),
- hoverinfo="text",
- text=graph.edges[edge]["gaps"],
- )
- )
- # Add nodes
- color_dict = {}
- for _, data in graph.nodes(data=True):
- if data[color] not in color_dict:
- color_dict[data[color]] = colors[len(color_dict)]
-
- traces.append(
- go.Scatter(
- x=[data["x_pos"]],
- y=[data["y_pos"]],
- mode="markers",
- hoverinfo="text",
- marker=dict(
- # showscale=True,
- # colorscale="Viridis",
- size=10,
- # colorbar=dict(thickness=15, title=""),
- color=color_dict[data[color]],
- ),
- text=data[label],
- )
- )
-
- # Plot figure
- fig = go.Figure(
- data=traces,
- layout=go.Layout(
- plot_bgcolor="white",
- showlegend=False,
- hovermode="closest",
- margin=dict(b=0, l=0, r=0, t=0),
- ),
- )
- fig.update_xaxes(visible=False)
- fig.update_yaxes(visible=False)
- print(color_dict)
+ if self.dimensions == 2:
+ return self._2d_position_nodes_and_edges(graph)
+ elif self.dimensions == 3:
+ return self._3d_position_nodes_and_edges(graph)
+ else:
+ if self.dimensions > 3:
+ raise ValueError(
+ f"Bruuuhh chill, u visiting from {self.dimensions}D cyberspace? Dimensions must be 2 or 3"
+ )
- fig.show()
+ return graph
+
+ def visualize(self):
+ """
+ Visualizes the network graph.
+
+ This method visualizes the network graph created by the SequenceNetwork class.
+ It checks the value of the 'dimensions' attribute and calls either the 'visualize_2d_network' or 'visualize_3d_network' method accordingly.
+ If the 'dimensions' attribute is not 2 or 3, it raises a ValueError.
+
+ Returns:
+ None
+
+ Raises:
+ ValueError: If the 'dimensions' attribute is greater than 3.
+
+ Notes:
+ - The visualization is done using the Plotly library.
+ - If the 'dimensions' attribute is 2, the network graph is visualized in 2D.
+ - If the 'dimensions' attribute is 3, the network graph is visualized in 3D.
+ - The visualization includes nodes representing sequences and edges representing alignments between sequences.
+ - The color of the nodes is determined by the 'color' attribute of the SequenceNetwork class.
+ - The hover information for each node includes the sequence name, organism, kingdom, phylum, and source ID.
+ - The visualization is displayed using the Plotly library.
+ """
+
+ if self.dimensions == 2:
+ self.visualize_2d_network()
+ elif self.dimensions == 3:
+ self.visusalize_3d_network()
+ else:
+ if self.dimensions > 3:
+ raise ValueError(
+ f"Dimensions must be 2 or 3 for visualization, not {self.dimensions}"
+ )
+ def _2d_position_nodes_and_edges(self, graph: nx.Graph):
+ """Calculates node positions based on weight metric and
+ adds position information of nodes and edges to the respective
+ entry in the graph."""
+
+ positions = nx.spring_layout(graph, weight=self.weight, dim=2, seed=42)
+
+ # Add node position as coordinates
+ for node in graph.nodes():
+ graph.nodes[node]["x_pos"] = positions[node][0]
+ graph.nodes[node]["y_pos"] = positions[node][1]
+
+ # Add edge positions as coordinates
+ for edge in graph.edges():
+ graph.edges[edge]["x_pos"] = [
+ graph.nodes[edge[0]]["x_pos"],
+ graph.nodes[edge[1]]["x_pos"],
+ ]
+ graph.edges[edge]["y_pos"] = [
+ graph.nodes[edge[0]]["y_pos"],
+ graph.nodes[edge[1]]["y_pos"],
+ ]
+
+ return graph
+
+ def _3d_position_nodes_and_edges(self, graph: nx.Graph):
+ """Calculates node positions based on weight metric and
+ adds position information of nodes and edges to the respective
+ entry in the graph."""
+
+ positions = nx.spring_layout(
+ graph, iterations=25, weight=self.weight, dim=3, seed=42
+ )
-def position_nodes_and_edges(graph: nx.Graph, weight: str) -> nx.Graph:
- """Calculates node positions based on weight metric and
- adds position information of nodes and edges to the respective
- entry in the graph."""
+ # Add node position as coordinates
+ for node in graph.nodes():
+ graph.nodes[node]["x_pos"] = positions[node][0]
+ graph.nodes[node]["y_pos"] = positions[node][1]
+ graph.nodes[node]["z_pos"] = positions[node][2]
+
+ # Add edge positions as coordinates
+ for edge in graph.edges():
+ graph.edges[edge]["x_pos"] = [
+ graph.nodes[edge[0]]["x_pos"],
+ graph.nodes[edge[1]]["x_pos"],
+ ]
+ graph.edges[edge]["y_pos"] = [
+ graph.nodes[edge[0]]["y_pos"],
+ graph.nodes[edge[1]]["y_pos"],
+ ]
+ graph.edges[edge]["z_pos"] = [
+ graph.nodes[edge[0]]["z_pos"],
+ graph.nodes[edge[1]]["z_pos"],
+ ]
+
+ return graph
+
+ def visusalize_3d_network(self):
+ """Visualizes a 3D network graph."""
+
+ traces = []
+ # Add edges
+ # for edge in self.graph.edges:
+ # traces.append(
+ # go.Scatter3d(
+ # x=self.graph.edges[edge]["x_pos"],
+ # y=self.graph.edges[edge]["y_pos"],
+ # z=self.graph.edges[edge]["z_pos"],
+ # mode="lines",
+ # line=dict(
+ # width=1,
+ # color="rgba(128, 128, 128, 0.1)",
+ # ),
+ # hoverinfo="text",
+ # text=self.graph.edges[edge]["gaps"],
+ # )
+ # )
+
+ color_conditions = set([node[self.color] for node in self.graph.nodes.values()])
+ color_dict = dict(
+ zip(color_conditions, self._sample_colorscale(len(color_conditions)))
+ )
- positions = nx.spring_layout(graph, weight=weight)
+ # Add nodes
+ for key, node in self.graph.nodes.items():
+ info = [
+ (
+ node["name"],
+ node["organism"].name,
+ node["organism"].kingdom,
+ node["organism"].phylum,
+ key,
+ )
+ ]
+
+ traces.append(
+ go.Scatter3d(
+ x=[node["x_pos"]],
+ y=[node["y_pos"]],
+ z=[node["z_pos"]],
+ mode="markers",
+ marker=dict(
+ size=7,
+ color=color_dict[node[self.color]],
+ ),
+ text=node["name"],
+ hovertemplate="%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ customdata=list((info)),
+ )
+ )
- # Add node position as coordinates
- for node in graph.nodes():
- graph.nodes[node]["x_pos"] = positions[node][0]
- graph.nodes[node]["y_pos"] = positions[node][1]
+ # Plot figure
+ fig = go.Figure(
+ data=traces,
+ layout=go.Layout(
+ plot_bgcolor="white",
+ showlegend=False,
+ hovermode="closest",
+ margin=dict(b=0, l=0, r=0, t=0),
+ ),
+ )
+ fig.update_xaxes(visible=False)
+ fig.update_yaxes(visible=False)
+ fig.update_scenes(xaxis_visible=False, yaxis_visible=False, zaxis_visible=False)
- # Add edge positions as coordinates
- for edge in graph.edges():
- graph.edges[edge]["x_pos"] = [
- graph.nodes[edge[0]]["x_pos"],
- graph.nodes[edge[1]]["x_pos"],
- ]
- graph.edges[edge]["y_pos"] = [
- graph.nodes[edge[0]]["y_pos"],
- graph.nodes[edge[1]]["y_pos"],
- ]
+ fig.show()
- return graph
+ def visualize_2d_network(self):
+ """Visualizes a 2D network graph."""
+ traces = []
+ # Add nodes
+ color_conditions = set([node[self.color] for node in self.graph.nodes.values()])
+ color_dict = dict(
+ zip(color_conditions, self._sample_colorscale(len(color_conditions)))
+ )
-def _get_unique_sequences(alignments: List[Alignment]) -> List[ProteinInfo]:
- """Gets unique sequences from a list of alignments."""
+ for key, node in self.graph.nodes.items():
+ info = [
+ (
+ node["name"],
+ node["organism"].name,
+ node["organism"].kingdom,
+ node["organism"].phylum,
+ key,
+ )
+ ]
+
+ traces.append(
+ go.Scatter(
+ x=[node["x_pos"]],
+ y=[node["y_pos"]],
+ mode="markers",
+ marker=dict(
+ size=10,
+ color=color_dict[node[self.color]],
+ ),
+ text=node["name"],
+ hovertemplate="%{customdata[0]}
Organism: %{customdata[1]}
Kingdom: %{customdata[2]}
Phylum: %{customdata[3]}
Source ID: %{customdata[4]}",
+ customdata=list((info)),
+ )
+ )
- sequence_infos = []
- added_ids = set()
- for alignment in alignments:
- if alignment.reference_seq.source_id not in added_ids:
- sequence_infos.append(alignment.reference_seq)
- added_ids.add(alignment.reference_seq.source_id)
+ # Plot figure
+ fig = go.Figure(
+ data=traces,
+ layout=go.Layout(
+ plot_bgcolor="white",
+ showlegend=False,
+ hovermode="closest",
+ margin=dict(b=0, l=0, r=0, t=0),
+ ),
+ )
+ fig.update_xaxes(visible=False)
+ fig.update_yaxes(visible=False)
- if alignment.query_seq.source_id not in added_ids:
- sequence_infos.append(alignment.query_seq)
- added_ids.add(alignment.query_seq.source_id)
+ fig.show()
- return sequence_infos
+ @staticmethod
+ def _sample_colorscale(size: int) -> List[str]:
+ return px.colors.sample_colorscale("viridis", [i / size for i in range(size)])