Fixing zip command issue in Google Colab.

[gmihaila]

When running the Google Colab notebook implementation cell 5. Run AlphaFold and download prediction is throwing the following error:

NotImplementedError                       Traceback (most recent call last)
[<ipython-input-1-bc0091fa34e2>](https://localhost:8080/#) in <module>()
    577 sequence = 'AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQDAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL'  #@param {type:"string"}
    578 
--> 579 run_prediction(sequence)

3 frames
[/usr/local/lib/python3.7/dist-packages/google/colab/_system_commands.py](https://localhost:8080/#) in _run_command(cmd, clear_streamed_output)
    166   if locale_encoding != _ENCODING:
    167     raise NotImplementedError(
--> 168         'A UTF-8 locale is required. Got {}'.format(locale_encoding))
    169 
    170   parent_pty, child_pty = pty.openpty()

NotImplementedError: A UTF-8 locale is required. Got ANSI_X3.4-1968

As discussed in the issue: #483

This is more of a Google Colab issue when trying to create theoutput_dir zip file from theoutput_dir folder. I solved this by usingshutil to create the zip file.

I simply replace the line of code !zip -q -r {output_dir}.zip {output_dir} from cell 5. Run AlphaFold and download prediction with shutil.make_archive(output_dir, 'zip', output_dir)
I also made sure to add import shutil at the first cell.

This will create the zip file without using any terminal commands. This fix should not cause any issues in the future since we don't rely on the Google Colab terminal commands anymore.

[google-cla]

Thanks for your pull request! It looks like this may be your first contribution to a Google open source project. Before we can look at your pull request, you'll need to sign a Contributor License Agreement (CLA).

View this failed invocation of the CLA check for more information.

For the most up to date status, view the checks section at the bottom of the pull request.

[gmihaila]

Added my CLA.

[Augustin-Zidek]

Fixed in 0d9a24b. Thanks for reporting!