diff --git a/go.mod b/go.mod index 0b4b9560..53319ccf 100644 --- a/go.mod +++ b/go.mod @@ -68,12 +68,12 @@ require ( github.com/sergi/go-diff v1.1.0 // indirect github.com/spf13/cobra v1.6.1 // indirect github.com/xanzy/ssh-agent v0.3.0 // indirect - golang.org/x/crypto v0.6.0 // indirect - golang.org/x/net v0.8.0 // indirect + golang.org/x/crypto v0.17.0 // indirect + golang.org/x/net v0.10.0 // indirect golang.org/x/oauth2 v0.0.0-20220411215720-9780585627b5 // indirect - golang.org/x/sys v0.6.0 // indirect - golang.org/x/term v0.6.0 // indirect - golang.org/x/text v0.8.0 // indirect + golang.org/x/sys v0.15.0 // indirect + golang.org/x/term v0.15.0 // indirect + golang.org/x/text v0.14.0 // indirect golang.org/x/time v0.3.0 // indirect golang.org/x/tools v0.7.0 // indirect google.golang.org/appengine v1.6.7 // indirect diff --git a/go.sum b/go.sum index 333aae56..aa345732 100644 --- a/go.sum +++ b/go.sum @@ -351,8 +351,8 @@ golang.org/x/crypto v0.0.0-20191011191535-87dc89f01550/go.mod h1:yigFU9vqHzYiE8U golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto= golang.org/x/crypto v0.0.0-20210322153248-0c34fe9e7dc2/go.mod h1:T9bdIzuCu7OtxOm1hfPfRQxPLYneinmdGuTeoZ9dtd4= golang.org/x/crypto v0.0.0-20210421170649-83a5a9bb288b/go.mod h1:T9bdIzuCu7OtxOm1hfPfRQxPLYneinmdGuTeoZ9dtd4= -golang.org/x/crypto v0.6.0 h1:qfktjS5LUO+fFKeJXZ+ikTRijMmljikvG68fpMMruSc= -golang.org/x/crypto v0.6.0/go.mod h1:OFC/31mSvZgRz0V1QTNCzfAI1aIRzbiufJtkMIlEp58= +golang.org/x/crypto v0.17.0 h1:r8bRNjWL3GshPW3gkd+RpvzWrZAwPS49OmTGZ/uhM4k= +golang.org/x/crypto v0.17.0/go.mod h1:gCAAfMLgwOJRpTjQ2zCCt2OcSfYMTeZVSRtQlPC7Nq4= golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20190306152737-a1d7652674e8/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20190510132918-efd6b22b2522/go.mod h1:ZjyILWgesfNpC6sMxTJOJm9Kp84zZh5NQWvqDGG3Qr8= @@ -422,8 +422,8 @@ golang.org/x/net v0.0.0-20210326060303-6b1517762897/go.mod h1:uSPa2vr4CLtc/ILN5o golang.org/x/net v0.0.0-20210525063256-abc453219eb5/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y= golang.org/x/net v0.0.0-20220127200216-cd36cc0744dd/go.mod h1:CfG3xpIq0wQ8r1q4Su4UZFWDARRcnwPjda9FqA0JpMk= golang.org/x/net v0.0.0-20220225172249-27dd8689420f/go.mod h1:CfG3xpIq0wQ8r1q4Su4UZFWDARRcnwPjda9FqA0JpMk= -golang.org/x/net v0.8.0 h1:Zrh2ngAOFYneWTAIAPethzeaQLuHwhuBkuV6ZiRnUaQ= -golang.org/x/net v0.8.0/go.mod h1:QVkue5JL9kW//ek3r6jTKnTFis1tRmNAW2P1shuFdJc= +golang.org/x/net v0.10.0 h1:X2//UzNDwYmtCLn7To6G58Wr6f5ahEAQgKNzv9Y951M= +golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg= golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U= golang.org/x/oauth2 v0.0.0-20190226205417-e64efc72b421/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= @@ -493,12 +493,12 @@ golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBc golang.org/x/sys v0.0.0-20211216021012-1d35b9e2eb4e/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220114195835-da31bd327af9/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220908164124-27713097b956/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.6.0 h1:MVltZSvRTcU2ljQOhs94SXPftV6DCNnZViHeQps87pQ= -golang.org/x/sys v0.6.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.15.0 h1:h48lPFYpsTvQJZF4EKyI4aLHaev3CxivZmv7yZig9pc= +golang.org/x/sys v0.15.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= -golang.org/x/term v0.6.0 h1:clScbb1cHjoCkyRbWwBEUZ5H/tIFu5TAXIqaZD0Gcjw= -golang.org/x/term v0.6.0/go.mod h1:m6U89DPEgQRMq3DNkDClhWw02AUbt2daBVO4cn4Hv9U= +golang.org/x/term v0.15.0 h1:y/Oo/a/q3IXu26lQgl04j/gjuBDOBlx7X6Om1j2CPW4= +golang.org/x/term v0.15.0/go.mod h1:BDl952bC7+uMoWR75FIrCDx79TPU9oHkTZ9yRbYOrX0= golang.org/x/text v0.0.0-20170915032832-14c0d48ead0c/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.1-0.20180807135948-17ff2d5776d2/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= @@ -506,8 +506,8 @@ golang.org/x/text v0.3.2/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ= -golang.org/x/text v0.8.0 h1:57P1ETyNKtuIjB4SRd15iJxuhj8Gc416Y78H3qgMh68= -golang.org/x/text v0.8.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8= +golang.org/x/text v0.14.0 h1:ScX5w1eTa3QqT8oi6+ziP7dTV1S2+ALU0bI+0zXKWiQ= +golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU= golang.org/x/time v0.0.0-20181108054448-85acf8d2951c/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20190308202827-9d24e82272b4/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20191024005414-555d28b269f0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= diff --git a/vendor/golang.org/x/crypto/chacha20/chacha_arm64.go b/vendor/golang.org/x/crypto/chacha20/chacha_arm64.go index 94c71ac1..661ea132 100644 --- a/vendor/golang.org/x/crypto/chacha20/chacha_arm64.go +++ b/vendor/golang.org/x/crypto/chacha20/chacha_arm64.go @@ -2,8 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build go1.11 && gc && !purego -// +build go1.11,gc,!purego +//go:build gc && !purego package chacha20 diff --git a/vendor/golang.org/x/crypto/chacha20/chacha_arm64.s b/vendor/golang.org/x/crypto/chacha20/chacha_arm64.s index 63cae9e6..7dd2638e 100644 --- a/vendor/golang.org/x/crypto/chacha20/chacha_arm64.s +++ b/vendor/golang.org/x/crypto/chacha20/chacha_arm64.s @@ -2,8 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build go1.11 && gc && !purego -// +build go1.11,gc,!purego +//go:build gc && !purego #include "textflag.h" diff --git a/vendor/golang.org/x/crypto/chacha20/chacha_noasm.go b/vendor/golang.org/x/crypto/chacha20/chacha_noasm.go index 025b4989..db42e667 100644 --- a/vendor/golang.org/x/crypto/chacha20/chacha_noasm.go +++ b/vendor/golang.org/x/crypto/chacha20/chacha_noasm.go @@ -2,8 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build (!arm64 && !s390x && !ppc64le) || (arm64 && !go1.11) || !gc || purego -// +build !arm64,!s390x,!ppc64le arm64,!go1.11 !gc purego +//go:build (!arm64 && !s390x && !ppc64le) || !gc || purego package chacha20 diff --git a/vendor/golang.org/x/crypto/chacha20/chacha_ppc64le.go b/vendor/golang.org/x/crypto/chacha20/chacha_ppc64le.go index da420b2e..3a4287f9 100644 --- a/vendor/golang.org/x/crypto/chacha20/chacha_ppc64le.go +++ b/vendor/golang.org/x/crypto/chacha20/chacha_ppc64le.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc && !purego -// +build gc,!purego package chacha20 diff --git a/vendor/golang.org/x/crypto/chacha20/chacha_ppc64le.s b/vendor/golang.org/x/crypto/chacha20/chacha_ppc64le.s index 5c0fed26..66aebae2 100644 --- a/vendor/golang.org/x/crypto/chacha20/chacha_ppc64le.s +++ b/vendor/golang.org/x/crypto/chacha20/chacha_ppc64le.s @@ -20,7 +20,6 @@ // due to the calling conventions and initialization of constants. //go:build gc && !purego -// +build gc,!purego #include "textflag.h" diff --git a/vendor/golang.org/x/crypto/chacha20/chacha_s390x.go b/vendor/golang.org/x/crypto/chacha20/chacha_s390x.go index 4652247b..683ccfd1 100644 --- a/vendor/golang.org/x/crypto/chacha20/chacha_s390x.go +++ b/vendor/golang.org/x/crypto/chacha20/chacha_s390x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc && !purego -// +build gc,!purego package chacha20 diff --git a/vendor/golang.org/x/crypto/chacha20/chacha_s390x.s b/vendor/golang.org/x/crypto/chacha20/chacha_s390x.s index f3ef5a01..1eda91a3 100644 --- a/vendor/golang.org/x/crypto/chacha20/chacha_s390x.s +++ b/vendor/golang.org/x/crypto/chacha20/chacha_s390x.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc && !purego -// +build gc,!purego #include "go_asm.h" #include "textflag.h" diff --git a/vendor/golang.org/x/crypto/curve25519/curve25519.go b/vendor/golang.org/x/crypto/curve25519/curve25519.go index bc62161d..00f963ea 100644 --- a/vendor/golang.org/x/crypto/curve25519/curve25519.go +++ b/vendor/golang.org/x/crypto/curve25519/curve25519.go @@ -5,71 +5,18 @@ // Package curve25519 provides an implementation of the X25519 function, which // performs scalar multiplication on the elliptic curve known as Curve25519. // See RFC 7748. +// +// Starting in Go 1.20, this package is a wrapper for the X25519 implementation +// in the crypto/ecdh package. package curve25519 // import "golang.org/x/crypto/curve25519" -import ( - "crypto/subtle" - "errors" - "strconv" - - "golang.org/x/crypto/curve25519/internal/field" -) - // ScalarMult sets dst to the product scalar * point. // // Deprecated: when provided a low-order point, ScalarMult will set dst to all // zeroes, irrespective of the scalar. Instead, use the X25519 function, which // will return an error. func ScalarMult(dst, scalar, point *[32]byte) { - var e [32]byte - - copy(e[:], scalar[:]) - e[0] &= 248 - e[31] &= 127 - e[31] |= 64 - - var x1, x2, z2, x3, z3, tmp0, tmp1 field.Element - x1.SetBytes(point[:]) - x2.One() - x3.Set(&x1) - z3.One() - - swap := 0 - for pos := 254; pos >= 0; pos-- { - b := e[pos/8] >> uint(pos&7) - b &= 1 - swap ^= int(b) - x2.Swap(&x3, swap) - z2.Swap(&z3, swap) - swap = int(b) - - tmp0.Subtract(&x3, &z3) - tmp1.Subtract(&x2, &z2) - x2.Add(&x2, &z2) - z2.Add(&x3, &z3) - z3.Multiply(&tmp0, &x2) - z2.Multiply(&z2, &tmp1) - tmp0.Square(&tmp1) - tmp1.Square(&x2) - x3.Add(&z3, &z2) - z2.Subtract(&z3, &z2) - x2.Multiply(&tmp1, &tmp0) - tmp1.Subtract(&tmp1, &tmp0) - z2.Square(&z2) - - z3.Mult32(&tmp1, 121666) - x3.Square(&x3) - tmp0.Add(&tmp0, &z3) - z3.Multiply(&x1, &z2) - z2.Multiply(&tmp1, &tmp0) - } - - x2.Swap(&x3, swap) - z2.Swap(&z3, swap) - - z2.Invert(&z2) - x2.Multiply(&x2, &z2) - copy(dst[:], x2.Bytes()) + scalarMult(dst, scalar, point) } // ScalarBaseMult sets dst to the product scalar * base where base is the @@ -78,7 +25,7 @@ func ScalarMult(dst, scalar, point *[32]byte) { // It is recommended to use the X25519 function with Basepoint instead, as // copying into fixed size arrays can lead to unexpected bugs. func ScalarBaseMult(dst, scalar *[32]byte) { - ScalarMult(dst, scalar, &basePoint) + scalarBaseMult(dst, scalar) } const ( @@ -91,21 +38,10 @@ const ( // Basepoint is the canonical Curve25519 generator. var Basepoint []byte -var basePoint = [32]byte{9, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0} +var basePoint = [32]byte{9} func init() { Basepoint = basePoint[:] } -func checkBasepoint() { - if subtle.ConstantTimeCompare(Basepoint, []byte{ - 0x09, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - }) != 1 { - panic("curve25519: global Basepoint value was modified") - } -} - // X25519 returns the result of the scalar multiplication (scalar * point), // according to RFC 7748, Section 5. scalar, point and the return value are // slices of 32 bytes. @@ -121,26 +57,3 @@ func X25519(scalar, point []byte) ([]byte, error) { var dst [32]byte return x25519(&dst, scalar, point) } - -func x25519(dst *[32]byte, scalar, point []byte) ([]byte, error) { - var in [32]byte - if l := len(scalar); l != 32 { - return nil, errors.New("bad scalar length: " + strconv.Itoa(l) + ", expected 32") - } - if l := len(point); l != 32 { - return nil, errors.New("bad point length: " + strconv.Itoa(l) + ", expected 32") - } - copy(in[:], scalar) - if &point[0] == &Basepoint[0] { - checkBasepoint() - ScalarBaseMult(dst, &in) - } else { - var base, zero [32]byte - copy(base[:], point) - ScalarMult(dst, &in, &base) - if subtle.ConstantTimeCompare(dst[:], zero[:]) == 1 { - return nil, errors.New("bad input point: low order point") - } - } - return dst[:], nil -} diff --git a/vendor/golang.org/x/crypto/curve25519/curve25519_compat.go b/vendor/golang.org/x/crypto/curve25519/curve25519_compat.go new file mode 100644 index 00000000..ba647e8d --- /dev/null +++ b/vendor/golang.org/x/crypto/curve25519/curve25519_compat.go @@ -0,0 +1,105 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !go1.20 + +package curve25519 + +import ( + "crypto/subtle" + "errors" + "strconv" + + "golang.org/x/crypto/curve25519/internal/field" +) + +func scalarMult(dst, scalar, point *[32]byte) { + var e [32]byte + + copy(e[:], scalar[:]) + e[0] &= 248 + e[31] &= 127 + e[31] |= 64 + + var x1, x2, z2, x3, z3, tmp0, tmp1 field.Element + x1.SetBytes(point[:]) + x2.One() + x3.Set(&x1) + z3.One() + + swap := 0 + for pos := 254; pos >= 0; pos-- { + b := e[pos/8] >> uint(pos&7) + b &= 1 + swap ^= int(b) + x2.Swap(&x3, swap) + z2.Swap(&z3, swap) + swap = int(b) + + tmp0.Subtract(&x3, &z3) + tmp1.Subtract(&x2, &z2) + x2.Add(&x2, &z2) + z2.Add(&x3, &z3) + z3.Multiply(&tmp0, &x2) + z2.Multiply(&z2, &tmp1) + tmp0.Square(&tmp1) + tmp1.Square(&x2) + x3.Add(&z3, &z2) + z2.Subtract(&z3, &z2) + x2.Multiply(&tmp1, &tmp0) + tmp1.Subtract(&tmp1, &tmp0) + z2.Square(&z2) + + z3.Mult32(&tmp1, 121666) + x3.Square(&x3) + tmp0.Add(&tmp0, &z3) + z3.Multiply(&x1, &z2) + z2.Multiply(&tmp1, &tmp0) + } + + x2.Swap(&x3, swap) + z2.Swap(&z3, swap) + + z2.Invert(&z2) + x2.Multiply(&x2, &z2) + copy(dst[:], x2.Bytes()) +} + +func scalarBaseMult(dst, scalar *[32]byte) { + checkBasepoint() + scalarMult(dst, scalar, &basePoint) +} + +func x25519(dst *[32]byte, scalar, point []byte) ([]byte, error) { + var in [32]byte + if l := len(scalar); l != 32 { + return nil, errors.New("bad scalar length: " + strconv.Itoa(l) + ", expected 32") + } + if l := len(point); l != 32 { + return nil, errors.New("bad point length: " + strconv.Itoa(l) + ", expected 32") + } + copy(in[:], scalar) + if &point[0] == &Basepoint[0] { + scalarBaseMult(dst, &in) + } else { + var base, zero [32]byte + copy(base[:], point) + scalarMult(dst, &in, &base) + if subtle.ConstantTimeCompare(dst[:], zero[:]) == 1 { + return nil, errors.New("bad input point: low order point") + } + } + return dst[:], nil +} + +func checkBasepoint() { + if subtle.ConstantTimeCompare(Basepoint, []byte{ + 0x09, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + }) != 1 { + panic("curve25519: global Basepoint value was modified") + } +} diff --git a/vendor/golang.org/x/crypto/curve25519/curve25519_go120.go b/vendor/golang.org/x/crypto/curve25519/curve25519_go120.go new file mode 100644 index 00000000..627df497 --- /dev/null +++ b/vendor/golang.org/x/crypto/curve25519/curve25519_go120.go @@ -0,0 +1,46 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build go1.20 + +package curve25519 + +import "crypto/ecdh" + +func x25519(dst *[32]byte, scalar, point []byte) ([]byte, error) { + curve := ecdh.X25519() + pub, err := curve.NewPublicKey(point) + if err != nil { + return nil, err + } + priv, err := curve.NewPrivateKey(scalar) + if err != nil { + return nil, err + } + out, err := priv.ECDH(pub) + if err != nil { + return nil, err + } + copy(dst[:], out) + return dst[:], nil +} + +func scalarMult(dst, scalar, point *[32]byte) { + if _, err := x25519(dst, scalar[:], point[:]); err != nil { + // The only error condition for x25519 when the inputs are 32 bytes long + // is if the output would have been the all-zero value. + for i := range dst { + dst[i] = 0 + } + } +} + +func scalarBaseMult(dst, scalar *[32]byte) { + curve := ecdh.X25519() + priv, err := curve.NewPrivateKey(scalar[:]) + if err != nil { + panic("curve25519: internal error: scalarBaseMult was not 32 bytes") + } + copy(dst[:], priv.PublicKey().Bytes()) +} diff --git a/vendor/golang.org/x/crypto/curve25519/internal/field/fe_amd64.go b/vendor/golang.org/x/crypto/curve25519/internal/field/fe_amd64.go index edcf163c..70c54169 100644 --- a/vendor/golang.org/x/crypto/curve25519/internal/field/fe_amd64.go +++ b/vendor/golang.org/x/crypto/curve25519/internal/field/fe_amd64.go @@ -1,7 +1,6 @@ // Code generated by command: go run fe_amd64_asm.go -out ../fe_amd64.s -stubs ../fe_amd64.go -pkg field. DO NOT EDIT. //go:build amd64 && gc && !purego -// +build amd64,gc,!purego package field diff --git a/vendor/golang.org/x/crypto/curve25519/internal/field/fe_amd64.s b/vendor/golang.org/x/crypto/curve25519/internal/field/fe_amd64.s index 293f013c..60817acc 100644 --- a/vendor/golang.org/x/crypto/curve25519/internal/field/fe_amd64.s +++ b/vendor/golang.org/x/crypto/curve25519/internal/field/fe_amd64.s @@ -1,7 +1,6 @@ // Code generated by command: go run fe_amd64_asm.go -out ../fe_amd64.s -stubs ../fe_amd64.go -pkg field. DO NOT EDIT. //go:build amd64 && gc && !purego -// +build amd64,gc,!purego #include "textflag.h" diff --git a/vendor/golang.org/x/crypto/curve25519/internal/field/fe_amd64_noasm.go b/vendor/golang.org/x/crypto/curve25519/internal/field/fe_amd64_noasm.go index ddb6c9b8..9da280d1 100644 --- a/vendor/golang.org/x/crypto/curve25519/internal/field/fe_amd64_noasm.go +++ b/vendor/golang.org/x/crypto/curve25519/internal/field/fe_amd64_noasm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !amd64 || !gc || purego -// +build !amd64 !gc purego package field diff --git a/vendor/golang.org/x/crypto/curve25519/internal/field/fe_arm64.go b/vendor/golang.org/x/crypto/curve25519/internal/field/fe_arm64.go index af459ef5..075fe9b9 100644 --- a/vendor/golang.org/x/crypto/curve25519/internal/field/fe_arm64.go +++ b/vendor/golang.org/x/crypto/curve25519/internal/field/fe_arm64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm64 && gc && !purego -// +build arm64,gc,!purego package field diff --git a/vendor/golang.org/x/crypto/curve25519/internal/field/fe_arm64.s b/vendor/golang.org/x/crypto/curve25519/internal/field/fe_arm64.s index 5c91e458..3126a434 100644 --- a/vendor/golang.org/x/crypto/curve25519/internal/field/fe_arm64.s +++ b/vendor/golang.org/x/crypto/curve25519/internal/field/fe_arm64.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm64 && gc && !purego -// +build arm64,gc,!purego #include "textflag.h" diff --git a/vendor/golang.org/x/crypto/curve25519/internal/field/fe_arm64_noasm.go b/vendor/golang.org/x/crypto/curve25519/internal/field/fe_arm64_noasm.go index 234a5b2e..fc029ac1 100644 --- a/vendor/golang.org/x/crypto/curve25519/internal/field/fe_arm64_noasm.go +++ b/vendor/golang.org/x/crypto/curve25519/internal/field/fe_arm64_noasm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !arm64 || !gc || purego -// +build !arm64 !gc purego package field diff --git a/vendor/golang.org/x/crypto/internal/alias/alias.go b/vendor/golang.org/x/crypto/internal/alias/alias.go index 69c17f82..551ff0c3 100644 --- a/vendor/golang.org/x/crypto/internal/alias/alias.go +++ b/vendor/golang.org/x/crypto/internal/alias/alias.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !purego -// +build !purego // Package alias implements memory aliasing tests. package alias diff --git a/vendor/golang.org/x/crypto/internal/alias/alias_purego.go b/vendor/golang.org/x/crypto/internal/alias/alias_purego.go index 4775b0a4..6fe61b5c 100644 --- a/vendor/golang.org/x/crypto/internal/alias/alias_purego.go +++ b/vendor/golang.org/x/crypto/internal/alias/alias_purego.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build purego -// +build purego // Package alias implements memory aliasing tests. package alias diff --git a/vendor/golang.org/x/crypto/internal/poly1305/bits_compat.go b/vendor/golang.org/x/crypto/internal/poly1305/bits_compat.go index 45b5c966..d33c8890 100644 --- a/vendor/golang.org/x/crypto/internal/poly1305/bits_compat.go +++ b/vendor/golang.org/x/crypto/internal/poly1305/bits_compat.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !go1.13 -// +build !go1.13 package poly1305 diff --git a/vendor/golang.org/x/crypto/internal/poly1305/bits_go1.13.go b/vendor/golang.org/x/crypto/internal/poly1305/bits_go1.13.go index ed52b341..495c1fa6 100644 --- a/vendor/golang.org/x/crypto/internal/poly1305/bits_go1.13.go +++ b/vendor/golang.org/x/crypto/internal/poly1305/bits_go1.13.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build go1.13 -// +build go1.13 package poly1305 diff --git a/vendor/golang.org/x/crypto/internal/poly1305/mac_noasm.go b/vendor/golang.org/x/crypto/internal/poly1305/mac_noasm.go index f184b67d..333da285 100644 --- a/vendor/golang.org/x/crypto/internal/poly1305/mac_noasm.go +++ b/vendor/golang.org/x/crypto/internal/poly1305/mac_noasm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build (!amd64 && !ppc64le && !s390x) || !gc || purego -// +build !amd64,!ppc64le,!s390x !gc purego package poly1305 diff --git a/vendor/golang.org/x/crypto/internal/poly1305/sum_amd64.go b/vendor/golang.org/x/crypto/internal/poly1305/sum_amd64.go index 6d522333..164cd47d 100644 --- a/vendor/golang.org/x/crypto/internal/poly1305/sum_amd64.go +++ b/vendor/golang.org/x/crypto/internal/poly1305/sum_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc && !purego -// +build gc,!purego package poly1305 diff --git a/vendor/golang.org/x/crypto/internal/poly1305/sum_amd64.s b/vendor/golang.org/x/crypto/internal/poly1305/sum_amd64.s index 1d74f0f8..e0d3c647 100644 --- a/vendor/golang.org/x/crypto/internal/poly1305/sum_amd64.s +++ b/vendor/golang.org/x/crypto/internal/poly1305/sum_amd64.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc && !purego -// +build gc,!purego #include "textflag.h" diff --git a/vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64le.go b/vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64le.go index 4a069941..4aec4874 100644 --- a/vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64le.go +++ b/vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64le.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc && !purego -// +build gc,!purego package poly1305 diff --git a/vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64le.s b/vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64le.s index 58422aad..d2ca5dee 100644 --- a/vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64le.s +++ b/vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64le.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc && !purego -// +build gc,!purego #include "textflag.h" diff --git a/vendor/golang.org/x/crypto/internal/poly1305/sum_s390x.go b/vendor/golang.org/x/crypto/internal/poly1305/sum_s390x.go index ec959668..e1d033a4 100644 --- a/vendor/golang.org/x/crypto/internal/poly1305/sum_s390x.go +++ b/vendor/golang.org/x/crypto/internal/poly1305/sum_s390x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc && !purego -// +build gc,!purego package poly1305 diff --git a/vendor/golang.org/x/crypto/internal/poly1305/sum_s390x.s b/vendor/golang.org/x/crypto/internal/poly1305/sum_s390x.s index aa9e0494..0fe3a7c2 100644 --- a/vendor/golang.org/x/crypto/internal/poly1305/sum_s390x.s +++ b/vendor/golang.org/x/crypto/internal/poly1305/sum_s390x.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc && !purego -// +build gc,!purego #include "textflag.h" diff --git a/vendor/golang.org/x/crypto/ssh/agent/client.go b/vendor/golang.org/x/crypto/ssh/agent/client.go index c3e112a9..fecba8eb 100644 --- a/vendor/golang.org/x/crypto/ssh/agent/client.go +++ b/vendor/golang.org/x/crypto/ssh/agent/client.go @@ -16,6 +16,7 @@ import ( "bytes" "crypto/dsa" "crypto/ecdsa" + "crypto/ed25519" "crypto/elliptic" "crypto/rsa" "encoding/base64" @@ -26,7 +27,6 @@ import ( "math/big" "sync" - "golang.org/x/crypto/ed25519" "golang.org/x/crypto/ssh" ) @@ -141,9 +141,14 @@ const ( agentAddSmartcardKeyConstrained = 26 // 3.7 Key constraint identifiers - agentConstrainLifetime = 1 - agentConstrainConfirm = 2 - agentConstrainExtension = 3 + agentConstrainLifetime = 1 + agentConstrainConfirm = 2 + // Constraint extension identifier up to version 2 of the protocol. A + // backward incompatible change will be required if we want to add support + // for SSH_AGENT_CONSTRAIN_MAXSIGN which uses the same ID. + agentConstrainExtensionV00 = 3 + // Constraint extension identifier in version 3 and later of the protocol. + agentConstrainExtension = 255 ) // maxAgentResponseBytes is the maximum agent reply size that is accepted. This @@ -205,7 +210,7 @@ type constrainLifetimeAgentMsg struct { } type constrainExtensionAgentMsg struct { - ExtensionName string `sshtype:"3"` + ExtensionName string `sshtype:"255|3"` ExtensionDetails []byte // Rest is a field used for parsing, not part of message diff --git a/vendor/golang.org/x/crypto/ssh/agent/server.go b/vendor/golang.org/x/crypto/ssh/agent/server.go index 6e7a1e02..e35ca7ce 100644 --- a/vendor/golang.org/x/crypto/ssh/agent/server.go +++ b/vendor/golang.org/x/crypto/ssh/agent/server.go @@ -7,6 +7,7 @@ package agent import ( "crypto/dsa" "crypto/ecdsa" + "crypto/ed25519" "crypto/elliptic" "crypto/rsa" "encoding/binary" @@ -16,11 +17,10 @@ import ( "log" "math/big" - "golang.org/x/crypto/ed25519" "golang.org/x/crypto/ssh" ) -// Server wraps an Agent and uses it to implement the agent side of +// server wraps an Agent and uses it to implement the agent side of // the SSH-agent, wire protocol. type server struct { agent Agent @@ -208,7 +208,7 @@ func parseConstraints(constraints []byte) (lifetimeSecs uint32, confirmBeforeUse case agentConstrainConfirm: confirmBeforeUse = true constraints = constraints[1:] - case agentConstrainExtension: + case agentConstrainExtension, agentConstrainExtensionV00: var msg constrainExtensionAgentMsg if err = ssh.Unmarshal(constraints, &msg); err != nil { return 0, false, nil, err diff --git a/vendor/golang.org/x/crypto/ssh/certs.go b/vendor/golang.org/x/crypto/ssh/certs.go index fc04d03e..27d0e14a 100644 --- a/vendor/golang.org/x/crypto/ssh/certs.go +++ b/vendor/golang.org/x/crypto/ssh/certs.go @@ -16,8 +16,9 @@ import ( // Certificate algorithm names from [PROTOCOL.certkeys]. These values can appear // in Certificate.Type, PublicKey.Type, and ClientConfig.HostKeyAlgorithms. -// Unlike key algorithm names, these are not passed to AlgorithmSigner and don't -// appear in the Signature.Format field. +// Unlike key algorithm names, these are not passed to AlgorithmSigner nor +// returned by MultiAlgorithmSigner and don't appear in the Signature.Format +// field. const ( CertAlgoRSAv01 = "ssh-rsa-cert-v01@openssh.com" CertAlgoDSAv01 = "ssh-dss-cert-v01@openssh.com" @@ -255,10 +256,17 @@ func NewCertSigner(cert *Certificate, signer Signer) (Signer, error) { return nil, errors.New("ssh: signer and cert have different public key") } - if algorithmSigner, ok := signer.(AlgorithmSigner); ok { + switch s := signer.(type) { + case MultiAlgorithmSigner: + return &multiAlgorithmSigner{ + AlgorithmSigner: &algorithmOpenSSHCertSigner{ + &openSSHCertSigner{cert, signer}, s}, + supportedAlgorithms: s.Algorithms(), + }, nil + case AlgorithmSigner: return &algorithmOpenSSHCertSigner{ - &openSSHCertSigner{cert, signer}, algorithmSigner}, nil - } else { + &openSSHCertSigner{cert, signer}, s}, nil + default: return &openSSHCertSigner{cert, signer}, nil } } @@ -432,7 +440,9 @@ func (c *CertChecker) CheckCert(principal string, cert *Certificate) error { } // SignCert signs the certificate with an authority, setting the Nonce, -// SignatureKey, and Signature fields. +// SignatureKey, and Signature fields. If the authority implements the +// MultiAlgorithmSigner interface the first algorithm in the list is used. This +// is useful if you want to sign with a specific algorithm. func (c *Certificate) SignCert(rand io.Reader, authority Signer) error { c.Nonce = make([]byte, 32) if _, err := io.ReadFull(rand, c.Nonce); err != nil { @@ -440,8 +450,20 @@ func (c *Certificate) SignCert(rand io.Reader, authority Signer) error { } c.SignatureKey = authority.PublicKey() - // Default to KeyAlgoRSASHA512 for ssh-rsa signers. - if v, ok := authority.(AlgorithmSigner); ok && v.PublicKey().Type() == KeyAlgoRSA { + if v, ok := authority.(MultiAlgorithmSigner); ok { + if len(v.Algorithms()) == 0 { + return errors.New("the provided authority has no signature algorithm") + } + // Use the first algorithm in the list. + sig, err := v.SignWithAlgorithm(rand, c.bytesForSigning(), v.Algorithms()[0]) + if err != nil { + return err + } + c.Signature = sig + return nil + } else if v, ok := authority.(AlgorithmSigner); ok && v.PublicKey().Type() == KeyAlgoRSA { + // Default to KeyAlgoRSASHA512 for ssh-rsa signers. + // TODO: consider using KeyAlgoRSASHA256 as default. sig, err := v.SignWithAlgorithm(rand, c.bytesForSigning(), KeyAlgoRSASHA512) if err != nil { return err diff --git a/vendor/golang.org/x/crypto/ssh/channel.go b/vendor/golang.org/x/crypto/ssh/channel.go index c0834c00..cc0bb7ab 100644 --- a/vendor/golang.org/x/crypto/ssh/channel.go +++ b/vendor/golang.org/x/crypto/ssh/channel.go @@ -187,9 +187,11 @@ type channel struct { pending *buffer extPending *buffer - // windowMu protects myWindow, the flow-control window. - windowMu sync.Mutex - myWindow uint32 + // windowMu protects myWindow, the flow-control window, and myConsumed, + // the number of bytes consumed since we last increased myWindow + windowMu sync.Mutex + myWindow uint32 + myConsumed uint32 // writeMu serializes calls to mux.conn.writePacket() and // protects sentClose and packetPool. This mutex must be @@ -332,14 +334,24 @@ func (ch *channel) handleData(packet []byte) error { return nil } -func (c *channel) adjustWindow(n uint32) error { +func (c *channel) adjustWindow(adj uint32) error { c.windowMu.Lock() - // Since myWindow is managed on our side, and can never exceed - // the initial window setting, we don't worry about overflow. - c.myWindow += uint32(n) + // Since myConsumed and myWindow are managed on our side, and can never + // exceed the initial window setting, we don't worry about overflow. + c.myConsumed += adj + var sendAdj uint32 + if (channelWindowSize-c.myWindow > 3*c.maxIncomingPayload) || + (c.myWindow < channelWindowSize/2) { + sendAdj = c.myConsumed + c.myConsumed = 0 + c.myWindow += sendAdj + } c.windowMu.Unlock() + if sendAdj == 0 { + return nil + } return c.sendMessage(windowAdjustMsg{ - AdditionalBytes: uint32(n), + AdditionalBytes: sendAdj, }) } diff --git a/vendor/golang.org/x/crypto/ssh/cipher.go b/vendor/golang.org/x/crypto/ssh/cipher.go index 87f48552..741e984f 100644 --- a/vendor/golang.org/x/crypto/ssh/cipher.go +++ b/vendor/golang.org/x/crypto/ssh/cipher.go @@ -114,7 +114,8 @@ var cipherModes = map[string]*cipherMode{ "arcfour": {16, 0, streamCipherMode(0, newRC4)}, // AEAD ciphers - gcmCipherID: {16, 12, newGCMCipher}, + gcm128CipherID: {16, 12, newGCMCipher}, + gcm256CipherID: {32, 12, newGCMCipher}, chacha20Poly1305ID: {64, 0, newChaCha20Cipher}, // CBC mode is insecure and so is not included in the default config. diff --git a/vendor/golang.org/x/crypto/ssh/client.go b/vendor/golang.org/x/crypto/ssh/client.go index bdc356cb..fd8c4974 100644 --- a/vendor/golang.org/x/crypto/ssh/client.go +++ b/vendor/golang.org/x/crypto/ssh/client.go @@ -82,7 +82,7 @@ func NewClientConn(c net.Conn, addr string, config *ClientConfig) (Conn, <-chan if err := conn.clientHandshake(addr, &fullConf); err != nil { c.Close() - return nil, nil, nil, fmt.Errorf("ssh: handshake failed: %v", err) + return nil, nil, nil, fmt.Errorf("ssh: handshake failed: %w", err) } conn.mux = newMux(conn.transport) return conn, conn.mux.incomingChannels, conn.mux.incomingRequests, nil diff --git a/vendor/golang.org/x/crypto/ssh/client_auth.go b/vendor/golang.org/x/crypto/ssh/client_auth.go index 409b5ea1..34bf089d 100644 --- a/vendor/golang.org/x/crypto/ssh/client_auth.go +++ b/vendor/golang.org/x/crypto/ssh/client_auth.go @@ -71,7 +71,9 @@ func (c *connection) clientAuthenticate(config *ClientConfig) error { for auth := AuthMethod(new(noneAuth)); auth != nil; { ok, methods, err := auth.auth(sessionID, config.User, c.transport, config.Rand, extensions) if err != nil { - return err + // We return the error later if there is no other method left to + // try. + ok = authFailure } if ok == authSuccess { // success @@ -101,6 +103,12 @@ func (c *connection) clientAuthenticate(config *ClientConfig) error { } } } + + if auth == nil && err != nil { + // We have an error and there are no other authentication methods to + // try, so we return it. + return err + } } return fmt.Errorf("ssh: unable to authenticate, attempted methods %v, no supported methods remain", tried) } @@ -217,21 +225,45 @@ func (cb publicKeyCallback) method() string { return "publickey" } -func pickSignatureAlgorithm(signer Signer, extensions map[string][]byte) (as AlgorithmSigner, algo string) { +func pickSignatureAlgorithm(signer Signer, extensions map[string][]byte) (MultiAlgorithmSigner, string, error) { + var as MultiAlgorithmSigner keyFormat := signer.PublicKey().Type() - // Like in sendKexInit, if the public key implements AlgorithmSigner we - // assume it supports all algorithms, otherwise only the key format one. - as, ok := signer.(AlgorithmSigner) - if !ok { - return algorithmSignerWrapper{signer}, keyFormat + // If the signer implements MultiAlgorithmSigner we use the algorithms it + // support, if it implements AlgorithmSigner we assume it supports all + // algorithms, otherwise only the key format one. + switch s := signer.(type) { + case MultiAlgorithmSigner: + as = s + case AlgorithmSigner: + as = &multiAlgorithmSigner{ + AlgorithmSigner: s, + supportedAlgorithms: algorithmsForKeyFormat(underlyingAlgo(keyFormat)), + } + default: + as = &multiAlgorithmSigner{ + AlgorithmSigner: algorithmSignerWrapper{signer}, + supportedAlgorithms: []string{underlyingAlgo(keyFormat)}, + } + } + + getFallbackAlgo := func() (string, error) { + // Fallback to use if there is no "server-sig-algs" extension or a + // common algorithm cannot be found. We use the public key format if the + // MultiAlgorithmSigner supports it, otherwise we return an error. + if !contains(as.Algorithms(), underlyingAlgo(keyFormat)) { + return "", fmt.Errorf("ssh: no common public key signature algorithm, server only supports %q for key type %q, signer only supports %v", + underlyingAlgo(keyFormat), keyFormat, as.Algorithms()) + } + return keyFormat, nil } extPayload, ok := extensions["server-sig-algs"] if !ok { - // If there is no "server-sig-algs" extension, fall back to the key - // format algorithm. - return as, keyFormat + // If there is no "server-sig-algs" extension use the fallback + // algorithm. + algo, err := getFallbackAlgo() + return as, algo, err } // The server-sig-algs extension only carries underlying signature @@ -245,15 +277,22 @@ func pickSignatureAlgorithm(signer Signer, extensions map[string][]byte) (as Alg } } - keyAlgos := algorithmsForKeyFormat(keyFormat) + // Filter algorithms based on those supported by MultiAlgorithmSigner. + var keyAlgos []string + for _, algo := range algorithmsForKeyFormat(keyFormat) { + if contains(as.Algorithms(), underlyingAlgo(algo)) { + keyAlgos = append(keyAlgos, algo) + } + } + algo, err := findCommon("public key signature algorithm", keyAlgos, serverAlgos) if err != nil { - // If there is no overlap, try the key anyway with the key format - // algorithm, to support servers that fail to list all supported - // algorithms. - return as, keyFormat + // If there is no overlap, return the fallback algorithm to support + // servers that fail to list all supported algorithms. + algo, err := getFallbackAlgo() + return as, algo, err } - return as, algo + return as, algo, nil } func (cb publicKeyCallback) auth(session []byte, user string, c packetConn, rand io.Reader, extensions map[string][]byte) (authResult, []string, error) { @@ -267,14 +306,39 @@ func (cb publicKeyCallback) auth(session []byte, user string, c packetConn, rand return authFailure, nil, err } var methods []string - for _, signer := range signers { - pub := signer.PublicKey() - as, algo := pickSignatureAlgorithm(signer, extensions) + var errSigAlgo error + origSignersLen := len(signers) + for idx := 0; idx < len(signers); idx++ { + signer := signers[idx] + pub := signer.PublicKey() + as, algo, err := pickSignatureAlgorithm(signer, extensions) + if err != nil && errSigAlgo == nil { + // If we cannot negotiate a signature algorithm store the first + // error so we can return it to provide a more meaningful message if + // no other signers work. + errSigAlgo = err + continue + } ok, err := validateKey(pub, algo, user, c) if err != nil { return authFailure, nil, err } + // OpenSSH 7.2-7.7 advertises support for rsa-sha2-256 and rsa-sha2-512 + // in the "server-sig-algs" extension but doesn't support these + // algorithms for certificate authentication, so if the server rejects + // the key try to use the obtained algorithm as if "server-sig-algs" had + // not been implemented if supported from the algorithm signer. + if !ok && idx < origSignersLen && isRSACert(algo) && algo != CertAlgoRSAv01 { + if contains(as.Algorithms(), KeyAlgoRSA) { + // We retry using the compat algorithm after all signers have + // been tried normally. + signers = append(signers, &multiAlgorithmSigner{ + AlgorithmSigner: as, + supportedAlgorithms: []string{KeyAlgoRSA}, + }) + } + } if !ok { continue } @@ -317,22 +381,12 @@ func (cb publicKeyCallback) auth(session []byte, user string, c packetConn, rand // contain the "publickey" method, do not attempt to authenticate with any // other keys. According to RFC 4252 Section 7, the latter can occur when // additional authentication methods are required. - if success == authSuccess || !containsMethod(methods, cb.method()) { + if success == authSuccess || !contains(methods, cb.method()) { return success, methods, err } } - return authFailure, methods, nil -} - -func containsMethod(methods []string, method string) bool { - for _, m := range methods { - if m == method { - return true - } - } - - return false + return authFailure, methods, errSigAlgo } // validateKey validates the key provided is acceptable to the server. diff --git a/vendor/golang.org/x/crypto/ssh/common.go b/vendor/golang.org/x/crypto/ssh/common.go index c7964275..7e9c2cbc 100644 --- a/vendor/golang.org/x/crypto/ssh/common.go +++ b/vendor/golang.org/x/crypto/ssh/common.go @@ -10,7 +10,6 @@ import ( "fmt" "io" "math" - "strings" "sync" _ "crypto/sha1" @@ -28,7 +27,7 @@ const ( // supportedCiphers lists ciphers we support but might not recommend. var supportedCiphers = []string{ "aes128-ctr", "aes192-ctr", "aes256-ctr", - "aes128-gcm@openssh.com", + "aes128-gcm@openssh.com", gcm256CipherID, chacha20Poly1305ID, "arcfour256", "arcfour128", "arcfour", aes128cbcID, @@ -37,7 +36,7 @@ var supportedCiphers = []string{ // preferredCiphers specifies the default preference for ciphers. var preferredCiphers = []string{ - "aes128-gcm@openssh.com", + "aes128-gcm@openssh.com", gcm256CipherID, chacha20Poly1305ID, "aes128-ctr", "aes192-ctr", "aes256-ctr", } @@ -49,7 +48,8 @@ var supportedKexAlgos = []string{ // P384 and P521 are not constant-time yet, but since we don't // reuse ephemeral keys, using them for ECDH should be OK. kexAlgoECDH256, kexAlgoECDH384, kexAlgoECDH521, - kexAlgoDH14SHA256, kexAlgoDH14SHA1, kexAlgoDH1SHA1, + kexAlgoDH14SHA256, kexAlgoDH16SHA512, kexAlgoDH14SHA1, + kexAlgoDH1SHA1, } // serverForbiddenKexAlgos contains key exchange algorithms, that are forbidden @@ -59,8 +59,9 @@ var serverForbiddenKexAlgos = map[string]struct{}{ kexAlgoDHGEXSHA256: {}, // server half implementation is only minimal to satisfy the automated tests } -// preferredKexAlgos specifies the default preference for key-exchange algorithms -// in preference order. +// preferredKexAlgos specifies the default preference for key-exchange +// algorithms in preference order. The diffie-hellman-group16-sha512 algorithm +// is disabled by default because it is a bit slower than the others. var preferredKexAlgos = []string{ kexAlgoCurve25519SHA256, kexAlgoCurve25519SHA256LibSSH, kexAlgoECDH256, kexAlgoECDH384, kexAlgoECDH521, @@ -70,12 +71,12 @@ var preferredKexAlgos = []string{ // supportedHostKeyAlgos specifies the supported host-key algorithms (i.e. methods // of authenticating servers) in preference order. var supportedHostKeyAlgos = []string{ - CertAlgoRSASHA512v01, CertAlgoRSASHA256v01, + CertAlgoRSASHA256v01, CertAlgoRSASHA512v01, CertAlgoRSAv01, CertAlgoDSAv01, CertAlgoECDSA256v01, CertAlgoECDSA384v01, CertAlgoECDSA521v01, CertAlgoED25519v01, KeyAlgoECDSA256, KeyAlgoECDSA384, KeyAlgoECDSA521, - KeyAlgoRSASHA512, KeyAlgoRSASHA256, + KeyAlgoRSASHA256, KeyAlgoRSASHA512, KeyAlgoRSA, KeyAlgoDSA, KeyAlgoED25519, @@ -85,7 +86,7 @@ var supportedHostKeyAlgos = []string{ // This is based on RFC 4253, section 6.4, but with hmac-md5 variants removed // because they have reached the end of their useful life. var supportedMACs = []string{ - "hmac-sha2-256-etm@openssh.com", "hmac-sha2-256", "hmac-sha1", "hmac-sha1-96", + "hmac-sha2-256-etm@openssh.com", "hmac-sha2-512-etm@openssh.com", "hmac-sha2-256", "hmac-sha2-512", "hmac-sha1", "hmac-sha1-96", } var supportedCompressions = []string{compressionNone} @@ -119,6 +120,21 @@ func algorithmsForKeyFormat(keyFormat string) []string { } } +// isRSA returns whether algo is a supported RSA algorithm, including certificate +// algorithms. +func isRSA(algo string) bool { + algos := algorithmsForKeyFormat(KeyAlgoRSA) + return contains(algos, underlyingAlgo(algo)) +} + +func isRSACert(algo string) bool { + _, ok := certKeyAlgoNames[algo] + if !ok { + return false + } + return isRSA(algo) +} + // supportedPubKeyAuthAlgos specifies the supported client public key // authentication algorithms. Note that this doesn't include certificate types // since those use the underlying algorithm. This list is sent to the client if @@ -131,8 +147,6 @@ var supportedPubKeyAuthAlgos = []string{ KeyAlgoDSA, } -var supportedPubKeyAuthAlgosList = strings.Join(supportedPubKeyAuthAlgos, ",") - // unexpectedMessageError results when the SSH message that we received didn't // match what we wanted. func unexpectedMessageError(expected, got uint8) error { @@ -168,7 +182,7 @@ func (a *directionAlgorithms) rekeyBytes() int64 { // 2^(BLOCKSIZE/4) blocks. For all AES flavors BLOCKSIZE is // 128. switch a.Cipher { - case "aes128-ctr", "aes192-ctr", "aes256-ctr", gcmCipherID, aes128cbcID: + case "aes128-ctr", "aes192-ctr", "aes256-ctr", gcm128CipherID, gcm256CipherID, aes128cbcID: return 16 * (1 << 32) } @@ -178,7 +192,8 @@ func (a *directionAlgorithms) rekeyBytes() int64 { } var aeadCiphers = map[string]bool{ - gcmCipherID: true, + gcm128CipherID: true, + gcm256CipherID: true, chacha20Poly1305ID: true, } @@ -261,16 +276,16 @@ type Config struct { // unspecified, a size suitable for the chosen cipher is used. RekeyThreshold uint64 - // The allowed key exchanges algorithms. If unspecified then a - // default set of algorithms is used. + // The allowed key exchanges algorithms. If unspecified then a default set + // of algorithms is used. Unsupported values are silently ignored. KeyExchanges []string - // The allowed cipher algorithms. If unspecified then a sensible - // default is used. + // The allowed cipher algorithms. If unspecified then a sensible default is + // used. Unsupported values are silently ignored. Ciphers []string - // The allowed MAC algorithms. If unspecified then a sensible default - // is used. + // The allowed MAC algorithms. If unspecified then a sensible default is + // used. Unsupported values are silently ignored. MACs []string } @@ -287,7 +302,7 @@ func (c *Config) SetDefaults() { var ciphers []string for _, c := range c.Ciphers { if cipherModes[c] != nil { - // reject the cipher if we have no cipherModes definition + // Ignore the cipher if we have no cipherModes definition. ciphers = append(ciphers, c) } } @@ -296,10 +311,26 @@ func (c *Config) SetDefaults() { if c.KeyExchanges == nil { c.KeyExchanges = preferredKexAlgos } + var kexs []string + for _, k := range c.KeyExchanges { + if kexAlgoMap[k] != nil { + // Ignore the KEX if we have no kexAlgoMap definition. + kexs = append(kexs, k) + } + } + c.KeyExchanges = kexs if c.MACs == nil { c.MACs = supportedMACs } + var macs []string + for _, m := range c.MACs { + if macModes[m] != nil { + // Ignore the MAC if we have no macModes definition. + macs = append(macs, m) + } + } + c.MACs = macs if c.RekeyThreshold == 0 { // cipher specific default diff --git a/vendor/golang.org/x/crypto/ssh/connection.go b/vendor/golang.org/x/crypto/ssh/connection.go index 35661a52..8f345ee9 100644 --- a/vendor/golang.org/x/crypto/ssh/connection.go +++ b/vendor/golang.org/x/crypto/ssh/connection.go @@ -97,7 +97,7 @@ func (c *connection) Close() error { return c.sshConn.conn.Close() } -// sshconn provides net.Conn metadata, but disallows direct reads and +// sshConn provides net.Conn metadata, but disallows direct reads and // writes. type sshConn struct { conn net.Conn diff --git a/vendor/golang.org/x/crypto/ssh/doc.go b/vendor/golang.org/x/crypto/ssh/doc.go index f6bff60d..edbe6334 100644 --- a/vendor/golang.org/x/crypto/ssh/doc.go +++ b/vendor/golang.org/x/crypto/ssh/doc.go @@ -13,6 +13,7 @@ others. References: + [PROTOCOL]: https://cvsweb.openbsd.org/cgi-bin/cvsweb/src/usr.bin/ssh/PROTOCOL?rev=HEAD [PROTOCOL.certkeys]: http://cvsweb.openbsd.org/cgi-bin/cvsweb/src/usr.bin/ssh/PROTOCOL.certkeys?rev=HEAD [SSH-PARAMETERS]: http://www.iana.org/assignments/ssh-parameters/ssh-parameters.xml#ssh-parameters-1 diff --git a/vendor/golang.org/x/crypto/ssh/handshake.go b/vendor/golang.org/x/crypto/ssh/handshake.go index 07a1843e..56cdc7c2 100644 --- a/vendor/golang.org/x/crypto/ssh/handshake.go +++ b/vendor/golang.org/x/crypto/ssh/handshake.go @@ -11,6 +11,7 @@ import ( "io" "log" "net" + "strings" "sync" ) @@ -34,6 +35,16 @@ type keyingTransport interface { // direction will be effected if a msgNewKeys message is sent // or received. prepareKeyChange(*algorithms, *kexResult) error + + // setStrictMode sets the strict KEX mode, notably triggering + // sequence number resets on sending or receiving msgNewKeys. + // If the sequence number is already > 1 when setStrictMode + // is called, an error is returned. + setStrictMode() error + + // setInitialKEXDone indicates to the transport that the initial key exchange + // was completed + setInitialKEXDone() } // handshakeTransport implements rekeying on top of a keyingTransport @@ -50,6 +61,10 @@ type handshakeTransport struct { // connection. hostKeys []Signer + // publicKeyAuthAlgorithms is non-empty if we are the server. In that case, + // it contains the supported client public key authentication algorithms. + publicKeyAuthAlgorithms []string + // hostKeyAlgorithms is non-empty if we are the client. In that case, // we accept these key types from the server as host key. hostKeyAlgorithms []string @@ -95,6 +110,10 @@ type handshakeTransport struct { // The session ID or nil if first kex did not complete yet. sessionID []byte + + // strictMode indicates if the other side of the handshake indicated + // that we should be following the strict KEX protocol restrictions. + strictMode bool } type pendingKex struct { @@ -141,6 +160,7 @@ func newClientTransport(conn keyingTransport, clientVersion, serverVersion []byt func newServerTransport(conn keyingTransport, clientVersion, serverVersion []byte, config *ServerConfig) *handshakeTransport { t := newHandshakeTransport(conn, &config.Config, clientVersion, serverVersion) t.hostKeys = config.hostKeys + t.publicKeyAuthAlgorithms = config.PublicKeyAuthAlgorithms go t.readLoop() go t.kexLoop() return t @@ -203,7 +223,10 @@ func (t *handshakeTransport) readLoop() { close(t.incoming) break } - if p[0] == msgIgnore || p[0] == msgDebug { + // If this is the first kex, and strict KEX mode is enabled, + // we don't ignore any messages, as they may be used to manipulate + // the packet sequence numbers. + if !(t.sessionID == nil && t.strictMode) && (p[0] == msgIgnore || p[0] == msgDebug) { continue } t.incoming <- p @@ -435,6 +458,11 @@ func (t *handshakeTransport) readOnePacket(first bool) ([]byte, error) { return successPacket, nil } +const ( + kexStrictClient = "kex-strict-c-v00@openssh.com" + kexStrictServer = "kex-strict-s-v00@openssh.com" +) + // sendKexInit sends a key change message. func (t *handshakeTransport) sendKexInit() error { t.mu.Lock() @@ -448,7 +476,6 @@ func (t *handshakeTransport) sendKexInit() error { } msg := &kexInitMsg{ - KexAlgos: t.config.KeyExchanges, CiphersClientServer: t.config.Ciphers, CiphersServerClient: t.config.Ciphers, MACsClientServer: t.config.MACs, @@ -458,36 +485,55 @@ func (t *handshakeTransport) sendKexInit() error { } io.ReadFull(rand.Reader, msg.Cookie[:]) + // We mutate the KexAlgos slice, in order to add the kex-strict extension algorithm, + // and possibly to add the ext-info extension algorithm. Since the slice may be the + // user owned KeyExchanges, we create our own slice in order to avoid using user + // owned memory by mistake. + msg.KexAlgos = make([]string, 0, len(t.config.KeyExchanges)+2) // room for kex-strict and ext-info + msg.KexAlgos = append(msg.KexAlgos, t.config.KeyExchanges...) + isServer := len(t.hostKeys) > 0 if isServer { for _, k := range t.hostKeys { - // If k is an AlgorithmSigner, presume it supports all signature algorithms - // associated with the key format. (Ideally AlgorithmSigner would have a - // method to advertise supported algorithms, but it doesn't. This means that - // adding support for a new algorithm is a breaking change, as we will - // immediately negotiate it even if existing implementations don't support - // it. If that ever happens, we'll have to figure something out.) - // If k is not an AlgorithmSigner, we can only assume it only supports the - // algorithms that matches the key format. (This means that Sign can't pick - // a different default.) + // If k is a MultiAlgorithmSigner, we restrict the signature + // algorithms. If k is a AlgorithmSigner, presume it supports all + // signature algorithms associated with the key format. If k is not + // an AlgorithmSigner, we can only assume it only supports the + // algorithms that matches the key format. (This means that Sign + // can't pick a different default). keyFormat := k.PublicKey().Type() - if _, ok := k.(AlgorithmSigner); ok { + + switch s := k.(type) { + case MultiAlgorithmSigner: + for _, algo := range algorithmsForKeyFormat(keyFormat) { + if contains(s.Algorithms(), underlyingAlgo(algo)) { + msg.ServerHostKeyAlgos = append(msg.ServerHostKeyAlgos, algo) + } + } + case AlgorithmSigner: msg.ServerHostKeyAlgos = append(msg.ServerHostKeyAlgos, algorithmsForKeyFormat(keyFormat)...) - } else { + default: msg.ServerHostKeyAlgos = append(msg.ServerHostKeyAlgos, keyFormat) } } + + if t.sessionID == nil { + msg.KexAlgos = append(msg.KexAlgos, kexStrictServer) + } } else { msg.ServerHostKeyAlgos = t.hostKeyAlgorithms // As a client we opt in to receiving SSH_MSG_EXT_INFO so we know what // algorithms the server supports for public key authentication. See RFC // 8308, Section 2.1. + // + // We also send the strict KEX mode extension algorithm, in order to opt + // into the strict KEX mode. if firstKeyExchange := t.sessionID == nil; firstKeyExchange { - msg.KexAlgos = make([]string, 0, len(t.config.KeyExchanges)+1) - msg.KexAlgos = append(msg.KexAlgos, t.config.KeyExchanges...) msg.KexAlgos = append(msg.KexAlgos, "ext-info-c") + msg.KexAlgos = append(msg.KexAlgos, kexStrictClient) } + } packet := Marshal(msg) @@ -593,6 +639,13 @@ func (t *handshakeTransport) enterKeyExchange(otherInitPacket []byte) error { return err } + if t.sessionID == nil && ((isClient && contains(serverInit.KexAlgos, kexStrictServer)) || (!isClient && contains(clientInit.KexAlgos, kexStrictClient))) { + t.strictMode = true + if err := t.conn.setStrictMode(); err != nil { + return err + } + } + // We don't send FirstKexFollows, but we handle receiving it. // // RFC 4253 section 7 defines the kex and the agreement method for @@ -642,16 +695,21 @@ func (t *handshakeTransport) enterKeyExchange(otherInitPacket []byte) error { // On the server side, after the first SSH_MSG_NEWKEYS, send a SSH_MSG_EXT_INFO // message with the server-sig-algs extension if the client supports it. See - // RFC 8308, Sections 2.4 and 3.1. + // RFC 8308, Sections 2.4 and 3.1, and [PROTOCOL], Section 1.9. if !isClient && firstKeyExchange && contains(clientInit.KexAlgos, "ext-info-c") { + supportedPubKeyAuthAlgosList := strings.Join(t.publicKeyAuthAlgorithms, ",") extInfo := &extInfoMsg{ - NumExtensions: 1, - Payload: make([]byte, 0, 4+15+4+len(supportedPubKeyAuthAlgosList)), + NumExtensions: 2, + Payload: make([]byte, 0, 4+15+4+len(supportedPubKeyAuthAlgosList)+4+16+4+1), } extInfo.Payload = appendInt(extInfo.Payload, len("server-sig-algs")) extInfo.Payload = append(extInfo.Payload, "server-sig-algs"...) extInfo.Payload = appendInt(extInfo.Payload, len(supportedPubKeyAuthAlgosList)) extInfo.Payload = append(extInfo.Payload, supportedPubKeyAuthAlgosList...) + extInfo.Payload = appendInt(extInfo.Payload, len("ping@openssh.com")) + extInfo.Payload = append(extInfo.Payload, "ping@openssh.com"...) + extInfo.Payload = appendInt(extInfo.Payload, 1) + extInfo.Payload = append(extInfo.Payload, "0"...) if err := t.conn.writePacket(Marshal(extInfo)); err != nil { return err } @@ -663,6 +721,12 @@ func (t *handshakeTransport) enterKeyExchange(otherInitPacket []byte) error { return unexpectedMessageError(msgNewKeys, packet[0]) } + if firstKeyExchange { + // Indicates to the transport that the first key exchange is completed + // after receiving SSH_MSG_NEWKEYS. + t.conn.setInitialKEXDone() + } + return nil } @@ -685,9 +749,16 @@ func (a algorithmSignerWrapper) SignWithAlgorithm(rand io.Reader, data []byte, a func pickHostKey(hostKeys []Signer, algo string) AlgorithmSigner { for _, k := range hostKeys { + if s, ok := k.(MultiAlgorithmSigner); ok { + if !contains(s.Algorithms(), underlyingAlgo(algo)) { + continue + } + } + if algo == k.PublicKey().Type() { return algorithmSignerWrapper{k} } + k, ok := k.(AlgorithmSigner) if !ok { continue diff --git a/vendor/golang.org/x/crypto/ssh/kex.go b/vendor/golang.org/x/crypto/ssh/kex.go index 927a90cd..8a05f799 100644 --- a/vendor/golang.org/x/crypto/ssh/kex.go +++ b/vendor/golang.org/x/crypto/ssh/kex.go @@ -23,6 +23,7 @@ const ( kexAlgoDH1SHA1 = "diffie-hellman-group1-sha1" kexAlgoDH14SHA1 = "diffie-hellman-group14-sha1" kexAlgoDH14SHA256 = "diffie-hellman-group14-sha256" + kexAlgoDH16SHA512 = "diffie-hellman-group16-sha512" kexAlgoECDH256 = "ecdh-sha2-nistp256" kexAlgoECDH384 = "ecdh-sha2-nistp384" kexAlgoECDH521 = "ecdh-sha2-nistp521" @@ -430,6 +431,17 @@ func init() { hashFunc: crypto.SHA256, } + // This is the group called diffie-hellman-group16-sha512 in RFC + // 8268 and Oakley Group 16 in RFC 3526. + p, _ = new(big.Int).SetString("FFFFFFFFFFFFFFFFC90FDAA22168C234C4C6628B80DC1CD129024E088A67CC74020BBEA63B139B22514A08798E3404DDEF9519B3CD3A431B302B0A6DF25F14374FE1356D6D51C245E485B576625E7EC6F44C42E9A637ED6B0BFF5CB6F406B7EDEE386BFB5A899FA5AE9F24117C4B1FE649286651ECE45B3DC2007CB8A163BF0598DA48361C55D39A69163FA8FD24CF5F83655D23DCA3AD961C62F356208552BB9ED529077096966D670C354E4ABC9804F1746C08CA18217C32905E462E36CE3BE39E772C180E86039B2783A2EC07A28FB5C55DF06F4C52C9DE2BCBF6955817183995497CEA956AE515D2261898FA051015728E5A8AAAC42DAD33170D04507A33A85521ABDF1CBA64ECFB850458DBEF0A8AEA71575D060C7DB3970F85A6E1E4C7ABF5AE8CDB0933D71E8C94E04A25619DCEE3D2261AD2EE6BF12FFA06D98A0864D87602733EC86A64521F2B18177B200CBBE117577A615D6C770988C0BAD946E208E24FA074E5AB3143DB5BFCE0FD108E4B82D120A92108011A723C12A787E6D788719A10BDBA5B2699C327186AF4E23C1A946834B6150BDA2583E9CA2AD44CE8DBBBC2DB04DE8EF92E8EFC141FBECAA6287C59474E6BC05D99B2964FA090C3A2233BA186515BE7ED1F612970CEE2D7AFB81BDD762170481CD0069127D5B05AA993B4EA988D8FDDC186FFB7DC90A6C08F4DF435C934063199FFFFFFFFFFFFFFFF", 16) + + kexAlgoMap[kexAlgoDH16SHA512] = &dhGroup{ + g: new(big.Int).SetInt64(2), + p: p, + pMinus1: new(big.Int).Sub(p, bigOne), + hashFunc: crypto.SHA512, + } + kexAlgoMap[kexAlgoECDH521] = &ecdh{elliptic.P521()} kexAlgoMap[kexAlgoECDH384] = &ecdh{elliptic.P384()} kexAlgoMap[kexAlgoECDH256] = &ecdh{elliptic.P256()} diff --git a/vendor/golang.org/x/crypto/ssh/keys.go b/vendor/golang.org/x/crypto/ssh/keys.go index 72969804..df4ebdad 100644 --- a/vendor/golang.org/x/crypto/ssh/keys.go +++ b/vendor/golang.org/x/crypto/ssh/keys.go @@ -11,13 +11,16 @@ import ( "crypto/cipher" "crypto/dsa" "crypto/ecdsa" + "crypto/ed25519" "crypto/elliptic" "crypto/md5" + "crypto/rand" "crypto/rsa" "crypto/sha256" "crypto/x509" "encoding/asn1" "encoding/base64" + "encoding/binary" "encoding/hex" "encoding/pem" "errors" @@ -26,7 +29,6 @@ import ( "math/big" "strings" - "golang.org/x/crypto/ed25519" "golang.org/x/crypto/ssh/internal/bcrypt_pbkdf" ) @@ -295,6 +297,18 @@ func MarshalAuthorizedKey(key PublicKey) []byte { return b.Bytes() } +// MarshalPrivateKey returns a PEM block with the private key serialized in the +// OpenSSH format. +func MarshalPrivateKey(key crypto.PrivateKey, comment string) (*pem.Block, error) { + return marshalOpenSSHPrivateKey(key, comment, unencryptedOpenSSHMarshaler) +} + +// MarshalPrivateKeyWithPassphrase returns a PEM block holding the encrypted +// private key serialized in the OpenSSH format. +func MarshalPrivateKeyWithPassphrase(key crypto.PrivateKey, comment string, passphrase []byte) (*pem.Block, error) { + return marshalOpenSSHPrivateKey(key, comment, passphraseProtectedOpenSSHMarshaler(passphrase)) +} + // PublicKey represents a public key using an unspecified algorithm. // // Some PublicKeys provided by this package also implement CryptoPublicKey. @@ -321,7 +335,7 @@ type CryptoPublicKey interface { // A Signer can create signatures that verify against a public key. // -// Some Signers provided by this package also implement AlgorithmSigner. +// Some Signers provided by this package also implement MultiAlgorithmSigner. type Signer interface { // PublicKey returns the associated PublicKey. PublicKey() PublicKey @@ -336,9 +350,9 @@ type Signer interface { // An AlgorithmSigner is a Signer that also supports specifying an algorithm to // use for signing. // -// An AlgorithmSigner can't advertise the algorithms it supports, so it should -// be prepared to be invoked with every algorithm supported by the public key -// format. +// An AlgorithmSigner can't advertise the algorithms it supports, unless it also +// implements MultiAlgorithmSigner, so it should be prepared to be invoked with +// every algorithm supported by the public key format. type AlgorithmSigner interface { Signer @@ -349,6 +363,75 @@ type AlgorithmSigner interface { SignWithAlgorithm(rand io.Reader, data []byte, algorithm string) (*Signature, error) } +// MultiAlgorithmSigner is an AlgorithmSigner that also reports the algorithms +// supported by that signer. +type MultiAlgorithmSigner interface { + AlgorithmSigner + + // Algorithms returns the available algorithms in preference order. The list + // must not be empty, and it must not include certificate types. + Algorithms() []string +} + +// NewSignerWithAlgorithms returns a signer restricted to the specified +// algorithms. The algorithms must be set in preference order. The list must not +// be empty, and it must not include certificate types. An error is returned if +// the specified algorithms are incompatible with the public key type. +func NewSignerWithAlgorithms(signer AlgorithmSigner, algorithms []string) (MultiAlgorithmSigner, error) { + if len(algorithms) == 0 { + return nil, errors.New("ssh: please specify at least one valid signing algorithm") + } + var signerAlgos []string + supportedAlgos := algorithmsForKeyFormat(underlyingAlgo(signer.PublicKey().Type())) + if s, ok := signer.(*multiAlgorithmSigner); ok { + signerAlgos = s.Algorithms() + } else { + signerAlgos = supportedAlgos + } + + for _, algo := range algorithms { + if !contains(supportedAlgos, algo) { + return nil, fmt.Errorf("ssh: algorithm %q is not supported for key type %q", + algo, signer.PublicKey().Type()) + } + if !contains(signerAlgos, algo) { + return nil, fmt.Errorf("ssh: algorithm %q is restricted for the provided signer", algo) + } + } + return &multiAlgorithmSigner{ + AlgorithmSigner: signer, + supportedAlgorithms: algorithms, + }, nil +} + +type multiAlgorithmSigner struct { + AlgorithmSigner + supportedAlgorithms []string +} + +func (s *multiAlgorithmSigner) Algorithms() []string { + return s.supportedAlgorithms +} + +func (s *multiAlgorithmSigner) isAlgorithmSupported(algorithm string) bool { + if algorithm == "" { + algorithm = underlyingAlgo(s.PublicKey().Type()) + } + for _, algo := range s.supportedAlgorithms { + if algorithm == algo { + return true + } + } + return false +} + +func (s *multiAlgorithmSigner) SignWithAlgorithm(rand io.Reader, data []byte, algorithm string) (*Signature, error) { + if !s.isAlgorithmSupported(algorithm) { + return nil, fmt.Errorf("ssh: algorithm %q is not supported: %v", algorithm, s.supportedAlgorithms) + } + return s.AlgorithmSigner.SignWithAlgorithm(rand, data, algorithm) +} + type rsaPublicKey rsa.PublicKey func (r *rsaPublicKey) Type() string { @@ -512,6 +595,10 @@ func (k *dsaPrivateKey) Sign(rand io.Reader, data []byte) (*Signature, error) { return k.SignWithAlgorithm(rand, data, k.PublicKey().Type()) } +func (k *dsaPrivateKey) Algorithms() []string { + return []string{k.PublicKey().Type()} +} + func (k *dsaPrivateKey) SignWithAlgorithm(rand io.Reader, data []byte, algorithm string) (*Signature, error) { if algorithm != "" && algorithm != k.PublicKey().Type() { return nil, fmt.Errorf("ssh: unsupported signature algorithm %s", algorithm) @@ -961,13 +1048,16 @@ func (s *wrappedSigner) Sign(rand io.Reader, data []byte) (*Signature, error) { return s.SignWithAlgorithm(rand, data, s.pubKey.Type()) } +func (s *wrappedSigner) Algorithms() []string { + return algorithmsForKeyFormat(s.pubKey.Type()) +} + func (s *wrappedSigner) SignWithAlgorithm(rand io.Reader, data []byte, algorithm string) (*Signature, error) { if algorithm == "" { algorithm = s.pubKey.Type() } - supportedAlgos := algorithmsForKeyFormat(s.pubKey.Type()) - if !contains(supportedAlgos, algorithm) { + if !contains(s.Algorithms(), algorithm) { return nil, fmt.Errorf("ssh: unsupported signature algorithm %q for key format %q", algorithm, s.pubKey.Type()) } @@ -1087,9 +1177,9 @@ func (*PassphraseMissingError) Error() string { return "ssh: this private key is passphrase protected" } -// ParseRawPrivateKey returns a private key from a PEM encoded private key. It -// supports RSA (PKCS#1), PKCS#8, DSA (OpenSSL), and ECDSA private keys. If the -// private key is encrypted, it will return a PassphraseMissingError. +// ParseRawPrivateKey returns a private key from a PEM encoded private key. It supports +// RSA, DSA, ECDSA, and Ed25519 private keys in PKCS#1, PKCS#8, OpenSSL, and OpenSSH +// formats. If the private key is encrypted, it will return a PassphraseMissingError. func ParseRawPrivateKey(pemBytes []byte) (interface{}, error) { block, _ := pem.Decode(pemBytes) if block == nil { @@ -1142,16 +1232,27 @@ func ParseRawPrivateKeyWithPassphrase(pemBytes, passphrase []byte) (interface{}, return nil, fmt.Errorf("ssh: cannot decode encrypted private keys: %v", err) } + var result interface{} + switch block.Type { case "RSA PRIVATE KEY": - return x509.ParsePKCS1PrivateKey(buf) + result, err = x509.ParsePKCS1PrivateKey(buf) case "EC PRIVATE KEY": - return x509.ParseECPrivateKey(buf) + result, err = x509.ParseECPrivateKey(buf) case "DSA PRIVATE KEY": - return ParseDSAPrivateKey(buf) + result, err = ParseDSAPrivateKey(buf) default: - return nil, fmt.Errorf("ssh: unsupported key type %q", block.Type) + err = fmt.Errorf("ssh: unsupported key type %q", block.Type) + } + // Because of deficiencies in the format, DecryptPEMBlock does not always + // detect an incorrect password. In these cases decrypted DER bytes is + // random noise. If the parsing of the key returns an asn1.StructuralError + // we return x509.IncorrectPasswordError. + if _, ok := err.(asn1.StructuralError); ok { + return nil, x509.IncorrectPasswordError } + + return result, err } // ParseDSAPrivateKey returns a DSA private key from its ASN.1 DER encoding, as @@ -1241,28 +1342,106 @@ func passphraseProtectedOpenSSHKey(passphrase []byte) openSSHDecryptFunc { } } +func unencryptedOpenSSHMarshaler(privKeyBlock []byte) ([]byte, string, string, string, error) { + key := generateOpenSSHPadding(privKeyBlock, 8) + return key, "none", "none", "", nil +} + +func passphraseProtectedOpenSSHMarshaler(passphrase []byte) openSSHEncryptFunc { + return func(privKeyBlock []byte) ([]byte, string, string, string, error) { + salt := make([]byte, 16) + if _, err := rand.Read(salt); err != nil { + return nil, "", "", "", err + } + + opts := struct { + Salt []byte + Rounds uint32 + }{salt, 16} + + // Derive key to encrypt the private key block. + k, err := bcrypt_pbkdf.Key(passphrase, salt, int(opts.Rounds), 32+aes.BlockSize) + if err != nil { + return nil, "", "", "", err + } + + // Add padding matching the block size of AES. + keyBlock := generateOpenSSHPadding(privKeyBlock, aes.BlockSize) + + // Encrypt the private key using the derived secret. + + dst := make([]byte, len(keyBlock)) + key, iv := k[:32], k[32:] + block, err := aes.NewCipher(key) + if err != nil { + return nil, "", "", "", err + } + + stream := cipher.NewCTR(block, iv) + stream.XORKeyStream(dst, keyBlock) + + return dst, "aes256-ctr", "bcrypt", string(Marshal(opts)), nil + } +} + +const privateKeyAuthMagic = "openssh-key-v1\x00" + type openSSHDecryptFunc func(CipherName, KdfName, KdfOpts string, PrivKeyBlock []byte) ([]byte, error) +type openSSHEncryptFunc func(PrivKeyBlock []byte) (ProtectedKeyBlock []byte, cipherName, kdfName, kdfOptions string, err error) + +type openSSHEncryptedPrivateKey struct { + CipherName string + KdfName string + KdfOpts string + NumKeys uint32 + PubKey []byte + PrivKeyBlock []byte +} + +type openSSHPrivateKey struct { + Check1 uint32 + Check2 uint32 + Keytype string + Rest []byte `ssh:"rest"` +} + +type openSSHRSAPrivateKey struct { + N *big.Int + E *big.Int + D *big.Int + Iqmp *big.Int + P *big.Int + Q *big.Int + Comment string + Pad []byte `ssh:"rest"` +} + +type openSSHEd25519PrivateKey struct { + Pub []byte + Priv []byte + Comment string + Pad []byte `ssh:"rest"` +} + +type openSSHECDSAPrivateKey struct { + Curve string + Pub []byte + D *big.Int + Comment string + Pad []byte `ssh:"rest"` +} // parseOpenSSHPrivateKey parses an OpenSSH private key, using the decrypt // function to unwrap the encrypted portion. unencryptedOpenSSHKey can be used // as the decrypt function to parse an unencrypted private key. See // https://github.com/openssh/openssh-portable/blob/master/PROTOCOL.key. func parseOpenSSHPrivateKey(key []byte, decrypt openSSHDecryptFunc) (crypto.PrivateKey, error) { - const magic = "openssh-key-v1\x00" - if len(key) < len(magic) || string(key[:len(magic)]) != magic { + if len(key) < len(privateKeyAuthMagic) || string(key[:len(privateKeyAuthMagic)]) != privateKeyAuthMagic { return nil, errors.New("ssh: invalid openssh private key format") } - remaining := key[len(magic):] - - var w struct { - CipherName string - KdfName string - KdfOpts string - NumKeys uint32 - PubKey []byte - PrivKeyBlock []byte - } + remaining := key[len(privateKeyAuthMagic):] + var w openSSHEncryptedPrivateKey if err := Unmarshal(remaining, &w); err != nil { return nil, err } @@ -1284,13 +1463,7 @@ func parseOpenSSHPrivateKey(key []byte, decrypt openSSHDecryptFunc) (crypto.Priv return nil, err } - pk1 := struct { - Check1 uint32 - Check2 uint32 - Keytype string - Rest []byte `ssh:"rest"` - }{} - + var pk1 openSSHPrivateKey if err := Unmarshal(privKeyBlock, &pk1); err != nil || pk1.Check1 != pk1.Check2 { if w.CipherName != "none" { return nil, x509.IncorrectPasswordError @@ -1300,18 +1473,7 @@ func parseOpenSSHPrivateKey(key []byte, decrypt openSSHDecryptFunc) (crypto.Priv switch pk1.Keytype { case KeyAlgoRSA: - // https://github.com/openssh/openssh-portable/blob/master/sshkey.c#L2760-L2773 - key := struct { - N *big.Int - E *big.Int - D *big.Int - Iqmp *big.Int - P *big.Int - Q *big.Int - Comment string - Pad []byte `ssh:"rest"` - }{} - + var key openSSHRSAPrivateKey if err := Unmarshal(pk1.Rest, &key); err != nil { return nil, err } @@ -1337,13 +1499,7 @@ func parseOpenSSHPrivateKey(key []byte, decrypt openSSHDecryptFunc) (crypto.Priv return pk, nil case KeyAlgoED25519: - key := struct { - Pub []byte - Priv []byte - Comment string - Pad []byte `ssh:"rest"` - }{} - + var key openSSHEd25519PrivateKey if err := Unmarshal(pk1.Rest, &key); err != nil { return nil, err } @@ -1360,14 +1516,7 @@ func parseOpenSSHPrivateKey(key []byte, decrypt openSSHDecryptFunc) (crypto.Priv copy(pk, key.Priv) return &pk, nil case KeyAlgoECDSA256, KeyAlgoECDSA384, KeyAlgoECDSA521: - key := struct { - Curve string - Pub []byte - D *big.Int - Comment string - Pad []byte `ssh:"rest"` - }{} - + var key openSSHECDSAPrivateKey if err := Unmarshal(pk1.Rest, &key); err != nil { return nil, err } @@ -1415,6 +1564,131 @@ func parseOpenSSHPrivateKey(key []byte, decrypt openSSHDecryptFunc) (crypto.Priv } } +func marshalOpenSSHPrivateKey(key crypto.PrivateKey, comment string, encrypt openSSHEncryptFunc) (*pem.Block, error) { + var w openSSHEncryptedPrivateKey + var pk1 openSSHPrivateKey + + // Random check bytes. + var check uint32 + if err := binary.Read(rand.Reader, binary.BigEndian, &check); err != nil { + return nil, err + } + + pk1.Check1 = check + pk1.Check2 = check + w.NumKeys = 1 + + // Use a []byte directly on ed25519 keys. + if k, ok := key.(*ed25519.PrivateKey); ok { + key = *k + } + + switch k := key.(type) { + case *rsa.PrivateKey: + E := new(big.Int).SetInt64(int64(k.PublicKey.E)) + // Marshal public key: + // E and N are in reversed order in the public and private key. + pubKey := struct { + KeyType string + E *big.Int + N *big.Int + }{ + KeyAlgoRSA, + E, k.PublicKey.N, + } + w.PubKey = Marshal(pubKey) + + // Marshal private key. + key := openSSHRSAPrivateKey{ + N: k.PublicKey.N, + E: E, + D: k.D, + Iqmp: k.Precomputed.Qinv, + P: k.Primes[0], + Q: k.Primes[1], + Comment: comment, + } + pk1.Keytype = KeyAlgoRSA + pk1.Rest = Marshal(key) + case ed25519.PrivateKey: + pub := make([]byte, ed25519.PublicKeySize) + priv := make([]byte, ed25519.PrivateKeySize) + copy(pub, k[32:]) + copy(priv, k) + + // Marshal public key. + pubKey := struct { + KeyType string + Pub []byte + }{ + KeyAlgoED25519, pub, + } + w.PubKey = Marshal(pubKey) + + // Marshal private key. + key := openSSHEd25519PrivateKey{ + Pub: pub, + Priv: priv, + Comment: comment, + } + pk1.Keytype = KeyAlgoED25519 + pk1.Rest = Marshal(key) + case *ecdsa.PrivateKey: + var curve, keyType string + switch name := k.Curve.Params().Name; name { + case "P-256": + curve = "nistp256" + keyType = KeyAlgoECDSA256 + case "P-384": + curve = "nistp384" + keyType = KeyAlgoECDSA384 + case "P-521": + curve = "nistp521" + keyType = KeyAlgoECDSA521 + default: + return nil, errors.New("ssh: unhandled elliptic curve " + name) + } + + pub := elliptic.Marshal(k.Curve, k.PublicKey.X, k.PublicKey.Y) + + // Marshal public key. + pubKey := struct { + KeyType string + Curve string + Pub []byte + }{ + keyType, curve, pub, + } + w.PubKey = Marshal(pubKey) + + // Marshal private key. + key := openSSHECDSAPrivateKey{ + Curve: curve, + Pub: pub, + D: k.D, + Comment: comment, + } + pk1.Keytype = keyType + pk1.Rest = Marshal(key) + default: + return nil, fmt.Errorf("ssh: unsupported key type %T", k) + } + + var err error + // Add padding and encrypt the key if necessary. + w.PrivKeyBlock, w.CipherName, w.KdfName, w.KdfOpts, err = encrypt(Marshal(pk1)) + if err != nil { + return nil, err + } + + b := Marshal(w) + block := &pem.Block{ + Type: "OPENSSH PRIVATE KEY", + Bytes: append([]byte(privateKeyAuthMagic), b...), + } + return block, nil +} + func checkOpenSSHKeyPadding(pad []byte) error { for i, b := range pad { if int(b) != i+1 { @@ -1424,6 +1698,13 @@ func checkOpenSSHKeyPadding(pad []byte) error { return nil } +func generateOpenSSHPadding(block []byte, blockSize int) []byte { + for i, l := 0, len(block); (l+i)%blockSize != 0; i++ { + block = append(block, byte(i+1)) + } + return block +} + // FingerprintLegacyMD5 returns the user presentation of the key's // fingerprint as described by RFC 4716 section 4. func FingerprintLegacyMD5(pubKey PublicKey) string { diff --git a/vendor/golang.org/x/crypto/ssh/mac.go b/vendor/golang.org/x/crypto/ssh/mac.go index c07a0628..06a1b275 100644 --- a/vendor/golang.org/x/crypto/ssh/mac.go +++ b/vendor/golang.org/x/crypto/ssh/mac.go @@ -10,6 +10,7 @@ import ( "crypto/hmac" "crypto/sha1" "crypto/sha256" + "crypto/sha512" "hash" ) @@ -46,9 +47,15 @@ func (t truncatingMAC) Size() int { func (t truncatingMAC) BlockSize() int { return t.hmac.BlockSize() } var macModes = map[string]*macMode{ + "hmac-sha2-512-etm@openssh.com": {64, true, func(key []byte) hash.Hash { + return hmac.New(sha512.New, key) + }}, "hmac-sha2-256-etm@openssh.com": {32, true, func(key []byte) hash.Hash { return hmac.New(sha256.New, key) }}, + "hmac-sha2-512": {64, false, func(key []byte) hash.Hash { + return hmac.New(sha512.New, key) + }}, "hmac-sha2-256": {32, false, func(key []byte) hash.Hash { return hmac.New(sha256.New, key) }}, diff --git a/vendor/golang.org/x/crypto/ssh/messages.go b/vendor/golang.org/x/crypto/ssh/messages.go index 922032d9..b55f8605 100644 --- a/vendor/golang.org/x/crypto/ssh/messages.go +++ b/vendor/golang.org/x/crypto/ssh/messages.go @@ -349,6 +349,20 @@ type userAuthGSSAPIError struct { LanguageTag string } +// Transport layer OpenSSH extension. See [PROTOCOL], section 1.9 +const msgPing = 192 + +type pingMsg struct { + Data string `sshtype:"192"` +} + +// Transport layer OpenSSH extension. See [PROTOCOL], section 1.9 +const msgPong = 193 + +type pongMsg struct { + Data string `sshtype:"193"` +} + // typeTags returns the possible type bytes for the given reflect.Type, which // should be a struct. The possible values are separated by a '|' character. func typeTags(structType reflect.Type) (tags []byte) { diff --git a/vendor/golang.org/x/crypto/ssh/mux.go b/vendor/golang.org/x/crypto/ssh/mux.go index 9654c018..d2d24c63 100644 --- a/vendor/golang.org/x/crypto/ssh/mux.go +++ b/vendor/golang.org/x/crypto/ssh/mux.go @@ -231,6 +231,12 @@ func (m *mux) onePacket() error { return m.handleChannelOpen(packet) case msgGlobalRequest, msgRequestSuccess, msgRequestFailure: return m.handleGlobalPacket(packet) + case msgPing: + var msg pingMsg + if err := Unmarshal(packet, &msg); err != nil { + return fmt.Errorf("failed to unmarshal ping@openssh.com message: %w", err) + } + return m.sendMessage(pongMsg(msg)) } // assume a channel packet. diff --git a/vendor/golang.org/x/crypto/ssh/server.go b/vendor/golang.org/x/crypto/ssh/server.go index 9e387029..c2dfe326 100644 --- a/vendor/golang.org/x/crypto/ssh/server.go +++ b/vendor/golang.org/x/crypto/ssh/server.go @@ -64,6 +64,13 @@ type ServerConfig struct { // Config contains configuration shared between client and server. Config + // PublicKeyAuthAlgorithms specifies the supported client public key + // authentication algorithms. Note that this should not include certificate + // types since those use the underlying algorithm. This list is sent to the + // client if it supports the server-sig-algs extension. Order is irrelevant. + // If unspecified then a default set of algorithms is used. + PublicKeyAuthAlgorithms []string + hostKeys []Signer // NoClientAuth is true if clients are allowed to connect without @@ -201,9 +208,20 @@ func NewServerConn(c net.Conn, config *ServerConfig) (*ServerConn, <-chan NewCha if fullConf.MaxAuthTries == 0 { fullConf.MaxAuthTries = 6 } + if len(fullConf.PublicKeyAuthAlgorithms) == 0 { + fullConf.PublicKeyAuthAlgorithms = supportedPubKeyAuthAlgos + } else { + for _, algo := range fullConf.PublicKeyAuthAlgorithms { + if !contains(supportedPubKeyAuthAlgos, algo) { + c.Close() + return nil, nil, nil, fmt.Errorf("ssh: unsupported public key authentication algorithm %s", algo) + } + } + } // Check if the config contains any unsupported key exchanges for _, kex := range fullConf.KeyExchanges { if _, ok := serverForbiddenKexAlgos[kex]; ok { + c.Close() return nil, nil, nil, fmt.Errorf("ssh: unsupported key exchange %s for server", kex) } } @@ -321,7 +339,7 @@ func checkSourceAddress(addr net.Addr, sourceAddrs string) error { return fmt.Errorf("ssh: remote address %v is not allowed because of source-address restriction", addr) } -func gssExchangeToken(gssapiConfig *GSSAPIWithMICConfig, firstToken []byte, s *connection, +func gssExchangeToken(gssapiConfig *GSSAPIWithMICConfig, token []byte, s *connection, sessionID []byte, userAuthReq userAuthRequestMsg) (authErr error, perms *Permissions, err error) { gssAPIServer := gssapiConfig.Server defer gssAPIServer.DeleteSecContext() @@ -331,7 +349,7 @@ func gssExchangeToken(gssapiConfig *GSSAPIWithMICConfig, firstToken []byte, s *c outToken []byte needContinue bool ) - outToken, srcName, needContinue, err = gssAPIServer.AcceptSecContext(firstToken) + outToken, srcName, needContinue, err = gssAPIServer.AcceptSecContext(token) if err != nil { return err, nil, nil } @@ -353,6 +371,7 @@ func gssExchangeToken(gssapiConfig *GSSAPIWithMICConfig, firstToken []byte, s *c if err := Unmarshal(packet, userAuthGSSAPITokenReq); err != nil { return nil, nil, err } + token = userAuthGSSAPITokenReq.Token } packet, err := s.transport.readPacket() if err != nil { @@ -370,6 +389,25 @@ func gssExchangeToken(gssapiConfig *GSSAPIWithMICConfig, firstToken []byte, s *c return authErr, perms, nil } +// isAlgoCompatible checks if the signature format is compatible with the +// selected algorithm taking into account edge cases that occur with old +// clients. +func isAlgoCompatible(algo, sigFormat string) bool { + // Compatibility for old clients. + // + // For certificate authentication with OpenSSH 7.2-7.7 signature format can + // be rsa-sha2-256 or rsa-sha2-512 for the algorithm + // ssh-rsa-cert-v01@openssh.com. + // + // With gpg-agent < 2.2.6 the algorithm can be rsa-sha2-256 or rsa-sha2-512 + // for signature format ssh-rsa. + if isRSA(algo) && isRSA(sigFormat) { + return true + } + // Standard case: the underlying algorithm must match the signature format. + return underlyingAlgo(algo) == sigFormat +} + // ServerAuthError represents server authentication errors and is // sometimes returned by NewServerConn. It appends any authentication // errors that may occur, and is returned if all of the authentication @@ -505,7 +543,7 @@ userAuthLoop: return nil, parseError(msgUserAuthRequest) } algo := string(algoBytes) - if !contains(supportedPubKeyAuthAlgos, underlyingAlgo(algo)) { + if !contains(config.PublicKeyAuthAlgorithms, underlyingAlgo(algo)) { authErr = fmt.Errorf("ssh: algorithm %q not accepted", algo) break } @@ -557,17 +595,26 @@ userAuthLoop: if !ok || len(payload) > 0 { return nil, parseError(msgUserAuthRequest) } - + // Ensure the declared public key algo is compatible with the + // decoded one. This check will ensure we don't accept e.g. + // ssh-rsa-cert-v01@openssh.com algorithm with ssh-rsa public + // key type. The algorithm and public key type must be + // consistent: both must be certificate algorithms, or neither. + if !contains(algorithmsForKeyFormat(pubKey.Type()), algo) { + authErr = fmt.Errorf("ssh: public key type %q not compatible with selected algorithm %q", + pubKey.Type(), algo) + break + } // Ensure the public key algo and signature algo // are supported. Compare the private key // algorithm name that corresponds to algo with // sig.Format. This is usually the same, but // for certs, the names differ. - if !contains(supportedPubKeyAuthAlgos, sig.Format) { + if !contains(config.PublicKeyAuthAlgorithms, sig.Format) { authErr = fmt.Errorf("ssh: algorithm %q not accepted", sig.Format) break } - if underlyingAlgo(algo) != sig.Format { + if !isAlgoCompatible(algo, sig.Format) { authErr = fmt.Errorf("ssh: signature %q not compatible with selected algorithm %q", sig.Format, algo) break } diff --git a/vendor/golang.org/x/crypto/ssh/tcpip.go b/vendor/golang.org/x/crypto/ssh/tcpip.go index 80d35f5e..ef5059a1 100644 --- a/vendor/golang.org/x/crypto/ssh/tcpip.go +++ b/vendor/golang.org/x/crypto/ssh/tcpip.go @@ -5,6 +5,7 @@ package ssh import ( + "context" "errors" "fmt" "io" @@ -332,6 +333,40 @@ func (l *tcpListener) Addr() net.Addr { return l.laddr } +// DialContext initiates a connection to the addr from the remote host. +// +// The provided Context must be non-nil. If the context expires before the +// connection is complete, an error is returned. Once successfully connected, +// any expiration of the context will not affect the connection. +// +// See func Dial for additional information. +func (c *Client) DialContext(ctx context.Context, n, addr string) (net.Conn, error) { + if err := ctx.Err(); err != nil { + return nil, err + } + type connErr struct { + conn net.Conn + err error + } + ch := make(chan connErr) + go func() { + conn, err := c.Dial(n, addr) + select { + case ch <- connErr{conn, err}: + case <-ctx.Done(): + if conn != nil { + conn.Close() + } + } + }() + select { + case res := <-ch: + return res.conn, res.err + case <-ctx.Done(): + return nil, ctx.Err() + } +} + // Dial initiates a connection to the addr from the remote host. // The resulting connection has a zero LocalAddr() and RemoteAddr(). func (c *Client) Dial(n, addr string) (net.Conn, error) { diff --git a/vendor/golang.org/x/crypto/ssh/transport.go b/vendor/golang.org/x/crypto/ssh/transport.go index acf5a21b..0424d2d3 100644 --- a/vendor/golang.org/x/crypto/ssh/transport.go +++ b/vendor/golang.org/x/crypto/ssh/transport.go @@ -17,7 +17,8 @@ import ( const debugTransport = false const ( - gcmCipherID = "aes128-gcm@openssh.com" + gcm128CipherID = "aes128-gcm@openssh.com" + gcm256CipherID = "aes256-gcm@openssh.com" aes128cbcID = "aes128-cbc" tripledescbcID = "3des-cbc" ) @@ -48,6 +49,9 @@ type transport struct { rand io.Reader isClient bool io.Closer + + strictMode bool + initialKEXDone bool } // packetCipher represents a combination of SSH encryption/MAC @@ -73,6 +77,18 @@ type connectionState struct { pendingKeyChange chan packetCipher } +func (t *transport) setStrictMode() error { + if t.reader.seqNum != 1 { + return errors.New("ssh: sequence number != 1 when strict KEX mode requested") + } + t.strictMode = true + return nil +} + +func (t *transport) setInitialKEXDone() { + t.initialKEXDone = true +} + // prepareKeyChange sets up key material for a keychange. The key changes in // both directions are triggered by reading and writing a msgNewKey packet // respectively. @@ -111,11 +127,12 @@ func (t *transport) printPacket(p []byte, write bool) { // Read and decrypt next packet. func (t *transport) readPacket() (p []byte, err error) { for { - p, err = t.reader.readPacket(t.bufReader) + p, err = t.reader.readPacket(t.bufReader, t.strictMode) if err != nil { break } - if len(p) == 0 || (p[0] != msgIgnore && p[0] != msgDebug) { + // in strict mode we pass through DEBUG and IGNORE packets only during the initial KEX + if len(p) == 0 || (t.strictMode && !t.initialKEXDone) || (p[0] != msgIgnore && p[0] != msgDebug) { break } } @@ -126,7 +143,7 @@ func (t *transport) readPacket() (p []byte, err error) { return p, err } -func (s *connectionState) readPacket(r *bufio.Reader) ([]byte, error) { +func (s *connectionState) readPacket(r *bufio.Reader, strictMode bool) ([]byte, error) { packet, err := s.packetCipher.readCipherPacket(s.seqNum, r) s.seqNum++ if err == nil && len(packet) == 0 { @@ -139,6 +156,9 @@ func (s *connectionState) readPacket(r *bufio.Reader) ([]byte, error) { select { case cipher := <-s.pendingKeyChange: s.packetCipher = cipher + if strictMode { + s.seqNum = 0 + } default: return nil, errors.New("ssh: got bogus newkeys message") } @@ -169,10 +189,10 @@ func (t *transport) writePacket(packet []byte) error { if debugTransport { t.printPacket(packet, true) } - return t.writer.writePacket(t.bufWriter, t.rand, packet) + return t.writer.writePacket(t.bufWriter, t.rand, packet, t.strictMode) } -func (s *connectionState) writePacket(w *bufio.Writer, rand io.Reader, packet []byte) error { +func (s *connectionState) writePacket(w *bufio.Writer, rand io.Reader, packet []byte, strictMode bool) error { changeKeys := len(packet) > 0 && packet[0] == msgNewKeys err := s.packetCipher.writeCipherPacket(s.seqNum, w, rand, packet) @@ -187,6 +207,9 @@ func (s *connectionState) writePacket(w *bufio.Writer, rand io.Reader, packet [] select { case cipher := <-s.pendingKeyChange: s.packetCipher = cipher + if strictMode { + s.seqNum = 0 + } default: panic("ssh: no key material for msgNewKeys") } diff --git a/vendor/golang.org/x/net/html/doc.go b/vendor/golang.org/x/net/html/doc.go index 7a96eae3..2466ae3d 100644 --- a/vendor/golang.org/x/net/html/doc.go +++ b/vendor/golang.org/x/net/html/doc.go @@ -99,14 +99,20 @@ Care should be taken when parsing and interpreting HTML, whether full documents or fragments, within the framework of the HTML specification, especially with regard to untrusted inputs. -This package provides both a tokenizer and a parser. Only the parser constructs -a DOM according to the HTML specification, resolving malformed and misplaced -tags where appropriate. The tokenizer simply tokenizes the HTML presented to it, -and as such does not resolve issues that may exist in the processed HTML, -producing a literal interpretation of the input. - -If your use case requires semantically well-formed HTML, as defined by the -WHATWG specifiction, the parser should be used rather than the tokenizer. +This package provides both a tokenizer and a parser, which implement the +tokenization, and tokenization and tree construction stages of the WHATWG HTML +parsing specification respectively. While the tokenizer parses and normalizes +individual HTML tokens, only the parser constructs the DOM tree from the +tokenized HTML, as described in the tree construction stage of the +specification, dynamically modifying or extending the docuemnt's DOM tree. + +If your use case requires semantically well-formed HTML documents, as defined by +the WHATWG specification, the parser should be used rather than the tokenizer. + +In security contexts, if trust decisions are being made using the tokenized or +parsed content, the input must be re-serialized (for instance by using Render or +Token.String) in order for those trust decisions to hold, as the process of +tokenization or parsing may alter the content. */ package html // import "golang.org/x/net/html" diff --git a/vendor/golang.org/x/net/http2/pipe.go b/vendor/golang.org/x/net/http2/pipe.go index c15b8a77..684d984f 100644 --- a/vendor/golang.org/x/net/http2/pipe.go +++ b/vendor/golang.org/x/net/http2/pipe.go @@ -88,13 +88,9 @@ func (p *pipe) Write(d []byte) (n int, err error) { p.c.L = &p.mu } defer p.c.Signal() - if p.err != nil { + if p.err != nil || p.breakErr != nil { return 0, errClosedPipeWrite } - if p.breakErr != nil { - p.unread += len(d) - return len(d), nil // discard when there is no reader - } return p.b.Write(d) } diff --git a/vendor/golang.org/x/net/http2/server.go b/vendor/golang.org/x/net/http2/server.go index 8cb14f3c..cd057f39 100644 --- a/vendor/golang.org/x/net/http2/server.go +++ b/vendor/golang.org/x/net/http2/server.go @@ -1822,15 +1822,18 @@ func (sc *serverConn) processData(f *DataFrame) error { } if len(data) > 0 { + st.bodyBytes += int64(len(data)) wrote, err := st.body.Write(data) if err != nil { + // The handler has closed the request body. + // Return the connection-level flow control for the discarded data, + // but not the stream-level flow control. sc.sendWindowUpdate(nil, int(f.Length)-wrote) - return sc.countError("body_write_err", streamError(id, ErrCodeStreamClosed)) + return nil } if wrote != len(data) { panic("internal error: bad Writer") } - st.bodyBytes += int64(len(data)) } // Return any padded flow control now, since we won't diff --git a/vendor/golang.org/x/net/http2/transport.go b/vendor/golang.org/x/net/http2/transport.go index 05ba23d3..ac90a263 100644 --- a/vendor/golang.org/x/net/http2/transport.go +++ b/vendor/golang.org/x/net/http2/transport.go @@ -560,10 +560,11 @@ func (t *Transport) RoundTripOpt(req *http.Request, opt RoundTripOpt) (*http.Res traceGotConn(req, cc, reused) res, err := cc.RoundTrip(req) if err != nil && retry <= 6 { + roundTripErr := err if req, err = shouldRetryRequest(req, err); err == nil { // After the first retry, do exponential backoff with 10% jitter. if retry == 0 { - t.vlogf("RoundTrip retrying after failure: %v", err) + t.vlogf("RoundTrip retrying after failure: %v", roundTripErr) continue } backoff := float64(uint(1) << (uint(retry) - 1)) @@ -572,7 +573,7 @@ func (t *Transport) RoundTripOpt(req *http.Request, opt RoundTripOpt) (*http.Res timer := backoffNewTimer(d) select { case <-timer.C: - t.vlogf("RoundTrip retrying after failure: %v", err) + t.vlogf("RoundTrip retrying after failure: %v", roundTripErr) continue case <-req.Context().Done(): timer.Stop() @@ -1265,6 +1266,27 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) { return res, nil } + cancelRequest := func(cs *clientStream, err error) error { + cs.cc.mu.Lock() + defer cs.cc.mu.Unlock() + cs.abortStreamLocked(err) + if cs.ID != 0 { + // This request may have failed because of a problem with the connection, + // or for some unrelated reason. (For example, the user might have canceled + // the request without waiting for a response.) Mark the connection as + // not reusable, since trying to reuse a dead connection is worse than + // unnecessarily creating a new one. + // + // If cs.ID is 0, then the request was never allocated a stream ID and + // whatever went wrong was unrelated to the connection. We might have + // timed out waiting for a stream slot when StrictMaxConcurrentStreams + // is set, for example, in which case retrying on a different connection + // will not help. + cs.cc.doNotReuse = true + } + return err + } + for { select { case <-cs.respHeaderRecv: @@ -1279,15 +1301,12 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) { return handleResponseHeaders() default: waitDone() - return nil, cs.abortErr + return nil, cancelRequest(cs, cs.abortErr) } case <-ctx.Done(): - err := ctx.Err() - cs.abortStream(err) - return nil, err + return nil, cancelRequest(cs, ctx.Err()) case <-cs.reqCancel: - cs.abortStream(errRequestCanceled) - return nil, errRequestCanceled + return nil, cancelRequest(cs, errRequestCanceled) } } } @@ -2555,6 +2574,9 @@ func (b transportResponseBody) Close() error { cs := b.cs cc := cs.cc + cs.bufPipe.BreakWithError(errClosedResponseBody) + cs.abortStream(errClosedResponseBody) + unread := cs.bufPipe.Len() if unread > 0 { cc.mu.Lock() @@ -2573,9 +2595,6 @@ func (b transportResponseBody) Close() error { cc.wmu.Unlock() } - cs.bufPipe.BreakWithError(errClosedResponseBody) - cs.abortStream(errClosedResponseBody) - select { case <-cs.donec: case <-cs.ctx.Done(): diff --git a/vendor/golang.org/x/net/internal/socks/socks.go b/vendor/golang.org/x/net/internal/socks/socks.go index 97db2340..84fcc32b 100644 --- a/vendor/golang.org/x/net/internal/socks/socks.go +++ b/vendor/golang.org/x/net/internal/socks/socks.go @@ -289,7 +289,7 @@ func (up *UsernamePassword) Authenticate(ctx context.Context, rw io.ReadWriter, case AuthMethodNotRequired: return nil case AuthMethodUsernamePassword: - if len(up.Username) == 0 || len(up.Username) > 255 || len(up.Password) == 0 || len(up.Password) > 255 { + if len(up.Username) == 0 || len(up.Username) > 255 || len(up.Password) > 255 { return errors.New("invalid username/password") } b := []byte{authUsernamePasswordVersion} diff --git a/vendor/golang.org/x/sys/cpu/asm_aix_ppc64.s b/vendor/golang.org/x/sys/cpu/asm_aix_ppc64.s index db9171c2..269e173c 100644 --- a/vendor/golang.org/x/sys/cpu/asm_aix_ppc64.s +++ b/vendor/golang.org/x/sys/cpu/asm_aix_ppc64.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/cpu/cpu.go b/vendor/golang.org/x/sys/cpu/cpu.go index 83f112c4..4756ad5f 100644 --- a/vendor/golang.org/x/sys/cpu/cpu.go +++ b/vendor/golang.org/x/sys/cpu/cpu.go @@ -38,7 +38,7 @@ var X86 struct { HasAVX512F bool // Advanced vector extension 512 Foundation Instructions HasAVX512CD bool // Advanced vector extension 512 Conflict Detection Instructions HasAVX512ER bool // Advanced vector extension 512 Exponential and Reciprocal Instructions - HasAVX512PF bool // Advanced vector extension 512 Prefetch Instructions Instructions + HasAVX512PF bool // Advanced vector extension 512 Prefetch Instructions HasAVX512VL bool // Advanced vector extension 512 Vector Length Extensions HasAVX512BW bool // Advanced vector extension 512 Byte and Word Instructions HasAVX512DQ bool // Advanced vector extension 512 Doubleword and Quadword Instructions @@ -54,6 +54,9 @@ var X86 struct { HasAVX512VBMI2 bool // Advanced vector extension 512 Vector Byte Manipulation Instructions 2 HasAVX512BITALG bool // Advanced vector extension 512 Bit Algorithms HasAVX512BF16 bool // Advanced vector extension 512 BFloat16 Instructions + HasAMXTile bool // Advanced Matrix Extension Tile instructions + HasAMXInt8 bool // Advanced Matrix Extension Int8 instructions + HasAMXBF16 bool // Advanced Matrix Extension BFloat16 instructions HasBMI1 bool // Bit manipulation instruction set 1 HasBMI2 bool // Bit manipulation instruction set 2 HasCX16 bool // Compare and exchange 16 Bytes diff --git a/vendor/golang.org/x/sys/cpu/cpu_aix.go b/vendor/golang.org/x/sys/cpu/cpu_aix.go index 8aaeef54..9bf0c32e 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_aix.go +++ b/vendor/golang.org/x/sys/cpu/cpu_aix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix -// +build aix package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_arm64.s b/vendor/golang.org/x/sys/cpu/cpu_arm64.s index c61f95a0..fcb9a388 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_arm64.s +++ b/vendor/golang.org/x/sys/cpu/cpu_arm64.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/cpu/cpu_gc_arm64.go b/vendor/golang.org/x/sys/cpu/cpu_gc_arm64.go index ccf542a7..a8acd3e3 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_gc_arm64.go +++ b/vendor/golang.org/x/sys/cpu/cpu_gc_arm64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_gc_s390x.go b/vendor/golang.org/x/sys/cpu/cpu_gc_s390x.go index 0af2f248..c8ae6ddc 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_gc_s390x.go +++ b/vendor/golang.org/x/sys/cpu/cpu_gc_s390x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_gc_x86.go b/vendor/golang.org/x/sys/cpu/cpu_gc_x86.go index fa7cdb9b..910728fb 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_gc_x86.go +++ b/vendor/golang.org/x/sys/cpu/cpu_gc_x86.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (386 || amd64 || amd64p32) && gc -// +build 386 amd64 amd64p32 -// +build gc package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_gccgo_arm64.go b/vendor/golang.org/x/sys/cpu/cpu_gccgo_arm64.go index 2aff3189..7f194678 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_gccgo_arm64.go +++ b/vendor/golang.org/x/sys/cpu/cpu_gccgo_arm64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gccgo -// +build gccgo package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_gccgo_s390x.go b/vendor/golang.org/x/sys/cpu/cpu_gccgo_s390x.go index 4bfbda61..9526d2ce 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_gccgo_s390x.go +++ b/vendor/golang.org/x/sys/cpu/cpu_gccgo_s390x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gccgo -// +build gccgo package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.c b/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.c index 6cc73109..3f73a05d 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.c +++ b/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.c @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (386 || amd64 || amd64p32) && gccgo -// +build 386 amd64 amd64p32 -// +build gccgo #include #include diff --git a/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.go b/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.go index 863d415a..99c60fe9 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.go +++ b/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (386 || amd64 || amd64p32) && gccgo -// +build 386 amd64 amd64p32 -// +build gccgo package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux.go b/vendor/golang.org/x/sys/cpu/cpu_linux.go index 159a686f..743eb543 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_linux.go +++ b/vendor/golang.org/x/sys/cpu/cpu_linux.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !386 && !amd64 && !amd64p32 && !arm64 -// +build !386,!amd64,!amd64p32,!arm64 package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_mips64x.go b/vendor/golang.org/x/sys/cpu/cpu_linux_mips64x.go index 6000db4c..4686c1d5 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_linux_mips64x.go +++ b/vendor/golang.org/x/sys/cpu/cpu_linux_mips64x.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (mips64 || mips64le) -// +build linux -// +build mips64 mips64le package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_noinit.go b/vendor/golang.org/x/sys/cpu/cpu_linux_noinit.go index f4992b1a..cd63e733 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_linux_noinit.go +++ b/vendor/golang.org/x/sys/cpu/cpu_linux_noinit.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && !arm && !arm64 && !mips64 && !mips64le && !ppc64 && !ppc64le && !s390x -// +build linux,!arm,!arm64,!mips64,!mips64le,!ppc64,!ppc64le,!s390x package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_ppc64x.go b/vendor/golang.org/x/sys/cpu/cpu_linux_ppc64x.go index 021356d6..197188e6 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_linux_ppc64x.go +++ b/vendor/golang.org/x/sys/cpu/cpu_linux_ppc64x.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (ppc64 || ppc64le) -// +build linux -// +build ppc64 ppc64le package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_loong64.go b/vendor/golang.org/x/sys/cpu/cpu_loong64.go index 0f57b05b..55863585 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_loong64.go +++ b/vendor/golang.org/x/sys/cpu/cpu_loong64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build loong64 -// +build loong64 package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_mips64x.go b/vendor/golang.org/x/sys/cpu/cpu_mips64x.go index f4063c66..fedb00cc 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_mips64x.go +++ b/vendor/golang.org/x/sys/cpu/cpu_mips64x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build mips64 || mips64le -// +build mips64 mips64le package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_mipsx.go b/vendor/golang.org/x/sys/cpu/cpu_mipsx.go index 07c4e36d..ffb4ec7e 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_mipsx.go +++ b/vendor/golang.org/x/sys/cpu/cpu_mipsx.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build mips || mipsle -// +build mips mipsle package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_other_arm.go b/vendor/golang.org/x/sys/cpu/cpu_other_arm.go index d7b4fb4c..e9ecf2a4 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_other_arm.go +++ b/vendor/golang.org/x/sys/cpu/cpu_other_arm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !linux && arm -// +build !linux,arm package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_other_arm64.go b/vendor/golang.org/x/sys/cpu/cpu_other_arm64.go index f3cde129..5341e7f8 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_other_arm64.go +++ b/vendor/golang.org/x/sys/cpu/cpu_other_arm64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !linux && !netbsd && !openbsd && arm64 -// +build !linux,!netbsd,!openbsd,arm64 package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_other_mips64x.go b/vendor/golang.org/x/sys/cpu/cpu_other_mips64x.go index 0dafe964..5f8f2419 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_other_mips64x.go +++ b/vendor/golang.org/x/sys/cpu/cpu_other_mips64x.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build !linux && (mips64 || mips64le) -// +build !linux -// +build mips64 mips64le package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_other_ppc64x.go b/vendor/golang.org/x/sys/cpu/cpu_other_ppc64x.go index 060d46b6..89608fba 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_other_ppc64x.go +++ b/vendor/golang.org/x/sys/cpu/cpu_other_ppc64x.go @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build !aix && !linux && (ppc64 || ppc64le) -// +build !aix -// +build !linux -// +build ppc64 ppc64le package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_other_riscv64.go b/vendor/golang.org/x/sys/cpu/cpu_other_riscv64.go index dd10eb79..5ab87808 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_other_riscv64.go +++ b/vendor/golang.org/x/sys/cpu/cpu_other_riscv64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !linux && riscv64 -// +build !linux,riscv64 package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_ppc64x.go b/vendor/golang.org/x/sys/cpu/cpu_ppc64x.go index 4e8acd16..c14f12b1 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_ppc64x.go +++ b/vendor/golang.org/x/sys/cpu/cpu_ppc64x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build ppc64 || ppc64le -// +build ppc64 ppc64le package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_riscv64.go b/vendor/golang.org/x/sys/cpu/cpu_riscv64.go index bd6c128a..7f0c79c0 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_riscv64.go +++ b/vendor/golang.org/x/sys/cpu/cpu_riscv64.go @@ -3,10 +3,9 @@ // license that can be found in the LICENSE file. //go:build riscv64 -// +build riscv64 package cpu -const cacheLineSize = 32 +const cacheLineSize = 64 func initOptions() {} diff --git a/vendor/golang.org/x/sys/cpu/cpu_s390x.s b/vendor/golang.org/x/sys/cpu/cpu_s390x.s index 96f81e20..1fb4b701 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_s390x.s +++ b/vendor/golang.org/x/sys/cpu/cpu_s390x.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/cpu/cpu_wasm.go b/vendor/golang.org/x/sys/cpu/cpu_wasm.go index 7747d888..384787ea 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_wasm.go +++ b/vendor/golang.org/x/sys/cpu/cpu_wasm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build wasm -// +build wasm package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_x86.go b/vendor/golang.org/x/sys/cpu/cpu_x86.go index f5aacfc8..c29f5e4c 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_x86.go +++ b/vendor/golang.org/x/sys/cpu/cpu_x86.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build 386 || amd64 || amd64p32 -// +build 386 amd64 amd64p32 package cpu @@ -37,6 +36,9 @@ func initOptions() { {Name: "avx512vbmi2", Feature: &X86.HasAVX512VBMI2}, {Name: "avx512bitalg", Feature: &X86.HasAVX512BITALG}, {Name: "avx512bf16", Feature: &X86.HasAVX512BF16}, + {Name: "amxtile", Feature: &X86.HasAMXTile}, + {Name: "amxint8", Feature: &X86.HasAMXInt8}, + {Name: "amxbf16", Feature: &X86.HasAMXBF16}, {Name: "bmi1", Feature: &X86.HasBMI1}, {Name: "bmi2", Feature: &X86.HasBMI2}, {Name: "cx16", Feature: &X86.HasCX16}, @@ -138,6 +140,10 @@ func archInit() { eax71, _, _, _ := cpuid(7, 1) X86.HasAVX512BF16 = isSet(5, eax71) } + + X86.HasAMXTile = isSet(24, edx7) + X86.HasAMXInt8 = isSet(25, edx7) + X86.HasAMXBF16 = isSet(22, edx7) } func isSet(bitpos uint, value uint32) bool { diff --git a/vendor/golang.org/x/sys/cpu/cpu_x86.s b/vendor/golang.org/x/sys/cpu/cpu_x86.s index 39acab2f..7d7ba33e 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_x86.s +++ b/vendor/golang.org/x/sys/cpu/cpu_x86.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (386 || amd64 || amd64p32) && gc -// +build 386 amd64 amd64p32 -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/cpu/endian_big.go b/vendor/golang.org/x/sys/cpu/endian_big.go index 93ce03a3..7fe04b0a 100644 --- a/vendor/golang.org/x/sys/cpu/endian_big.go +++ b/vendor/golang.org/x/sys/cpu/endian_big.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build armbe || arm64be || m68k || mips || mips64 || mips64p32 || ppc || ppc64 || s390 || s390x || shbe || sparc || sparc64 -// +build armbe arm64be m68k mips mips64 mips64p32 ppc ppc64 s390 s390x shbe sparc sparc64 package cpu diff --git a/vendor/golang.org/x/sys/cpu/endian_little.go b/vendor/golang.org/x/sys/cpu/endian_little.go index fe545966..48eccc4c 100644 --- a/vendor/golang.org/x/sys/cpu/endian_little.go +++ b/vendor/golang.org/x/sys/cpu/endian_little.go @@ -2,8 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || loong64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh -// +build 386 amd64 amd64p32 alpha arm arm64 loong64 mipsle mips64le mips64p32le nios2 ppc64le riscv riscv64 sh +//go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || loong64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh || wasm package cpu diff --git a/vendor/golang.org/x/sys/cpu/hwcap_linux.go b/vendor/golang.org/x/sys/cpu/hwcap_linux.go index 1d9d91f3..34e49f95 100644 --- a/vendor/golang.org/x/sys/cpu/hwcap_linux.go +++ b/vendor/golang.org/x/sys/cpu/hwcap_linux.go @@ -5,7 +5,7 @@ package cpu import ( - "io/ioutil" + "os" ) const ( @@ -39,7 +39,7 @@ func readHWCAP() error { return nil } - buf, err := ioutil.ReadFile(procAuxv) + buf, err := os.ReadFile(procAuxv) if err != nil { // e.g. on android /proc/self/auxv is not accessible, so silently // ignore the error and leave Initialized = false. On some diff --git a/vendor/golang.org/x/sys/cpu/proc_cpuinfo_linux.go b/vendor/golang.org/x/sys/cpu/proc_cpuinfo_linux.go index d87bd6b3..4cd64c70 100644 --- a/vendor/golang.org/x/sys/cpu/proc_cpuinfo_linux.go +++ b/vendor/golang.org/x/sys/cpu/proc_cpuinfo_linux.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && arm64 -// +build linux,arm64 package cpu diff --git a/vendor/golang.org/x/sys/cpu/runtime_auxv_go121.go b/vendor/golang.org/x/sys/cpu/runtime_auxv_go121.go index b975ea2a..4c9788ea 100644 --- a/vendor/golang.org/x/sys/cpu/runtime_auxv_go121.go +++ b/vendor/golang.org/x/sys/cpu/runtime_auxv_go121.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build go1.21 -// +build go1.21 package cpu diff --git a/vendor/golang.org/x/sys/cpu/syscall_aix_gccgo.go b/vendor/golang.org/x/sys/cpu/syscall_aix_gccgo.go index 96134157..1b9ccb09 100644 --- a/vendor/golang.org/x/sys/cpu/syscall_aix_gccgo.go +++ b/vendor/golang.org/x/sys/cpu/syscall_aix_gccgo.go @@ -9,7 +9,6 @@ // gccgo's libgo and thus must not used a CGo method. //go:build aix && gccgo -// +build aix,gccgo package cpu diff --git a/vendor/golang.org/x/sys/cpu/syscall_aix_ppc64_gc.go b/vendor/golang.org/x/sys/cpu/syscall_aix_ppc64_gc.go index 904be42f..e8b6cdbe 100644 --- a/vendor/golang.org/x/sys/cpu/syscall_aix_ppc64_gc.go +++ b/vendor/golang.org/x/sys/cpu/syscall_aix_ppc64_gc.go @@ -7,7 +7,6 @@ // (See golang.org/issue/32102) //go:build aix && ppc64 && gc -// +build aix,ppc64,gc package cpu diff --git a/vendor/golang.org/x/sys/execabs/execabs_go118.go b/vendor/golang.org/x/sys/execabs/execabs_go118.go index 2000064a..5627d70e 100644 --- a/vendor/golang.org/x/sys/execabs/execabs_go118.go +++ b/vendor/golang.org/x/sys/execabs/execabs_go118.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !go1.19 -// +build !go1.19 package execabs diff --git a/vendor/golang.org/x/sys/execabs/execabs_go119.go b/vendor/golang.org/x/sys/execabs/execabs_go119.go index f364b341..d60ab1b4 100644 --- a/vendor/golang.org/x/sys/execabs/execabs_go119.go +++ b/vendor/golang.org/x/sys/execabs/execabs_go119.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build go1.19 -// +build go1.19 package execabs diff --git a/vendor/golang.org/x/sys/internal/unsafeheader/unsafeheader.go b/vendor/golang.org/x/sys/internal/unsafeheader/unsafeheader.go deleted file mode 100644 index e07899b9..00000000 --- a/vendor/golang.org/x/sys/internal/unsafeheader/unsafeheader.go +++ /dev/null @@ -1,30 +0,0 @@ -// Copyright 2020 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package unsafeheader contains header declarations for the Go runtime's -// slice and string implementations. -// -// This package allows x/sys to use types equivalent to -// reflect.SliceHeader and reflect.StringHeader without introducing -// a dependency on the (relatively heavy) "reflect" package. -package unsafeheader - -import ( - "unsafe" -) - -// Slice is the runtime representation of a slice. -// It cannot be used safely or portably and its representation may change in a later release. -type Slice struct { - Data unsafe.Pointer - Len int - Cap int -} - -// String is the runtime representation of a string. -// It cannot be used safely or portably and its representation may change in a later release. -type String struct { - Data unsafe.Pointer - Len int -} diff --git a/vendor/golang.org/x/sys/plan9/pwd_go15_plan9.go b/vendor/golang.org/x/sys/plan9/pwd_go15_plan9.go index c9b69937..73687de7 100644 --- a/vendor/golang.org/x/sys/plan9/pwd_go15_plan9.go +++ b/vendor/golang.org/x/sys/plan9/pwd_go15_plan9.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build go1.5 -// +build go1.5 package plan9 diff --git a/vendor/golang.org/x/sys/plan9/pwd_plan9.go b/vendor/golang.org/x/sys/plan9/pwd_plan9.go index 98bf56b7..fb945821 100644 --- a/vendor/golang.org/x/sys/plan9/pwd_plan9.go +++ b/vendor/golang.org/x/sys/plan9/pwd_plan9.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !go1.5 -// +build !go1.5 package plan9 diff --git a/vendor/golang.org/x/sys/plan9/race.go b/vendor/golang.org/x/sys/plan9/race.go index 62377d2f..c02d9ed3 100644 --- a/vendor/golang.org/x/sys/plan9/race.go +++ b/vendor/golang.org/x/sys/plan9/race.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build plan9 && race -// +build plan9,race package plan9 diff --git a/vendor/golang.org/x/sys/plan9/race0.go b/vendor/golang.org/x/sys/plan9/race0.go index f8da3087..7b15e15f 100644 --- a/vendor/golang.org/x/sys/plan9/race0.go +++ b/vendor/golang.org/x/sys/plan9/race0.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build plan9 && !race -// +build plan9,!race package plan9 diff --git a/vendor/golang.org/x/sys/plan9/str.go b/vendor/golang.org/x/sys/plan9/str.go index 55fa8d02..ba3e8ff8 100644 --- a/vendor/golang.org/x/sys/plan9/str.go +++ b/vendor/golang.org/x/sys/plan9/str.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build plan9 -// +build plan9 package plan9 diff --git a/vendor/golang.org/x/sys/plan9/syscall.go b/vendor/golang.org/x/sys/plan9/syscall.go index 67e5b011..d631fd66 100644 --- a/vendor/golang.org/x/sys/plan9/syscall.go +++ b/vendor/golang.org/x/sys/plan9/syscall.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build plan9 -// +build plan9 // Package plan9 contains an interface to the low-level operating system // primitives. OS details vary depending on the underlying system, and diff --git a/vendor/golang.org/x/sys/plan9/zsyscall_plan9_386.go b/vendor/golang.org/x/sys/plan9/zsyscall_plan9_386.go index 3f40b9bd..f780d5c8 100644 --- a/vendor/golang.org/x/sys/plan9/zsyscall_plan9_386.go +++ b/vendor/golang.org/x/sys/plan9/zsyscall_plan9_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build plan9 && 386 -// +build plan9,386 package plan9 diff --git a/vendor/golang.org/x/sys/plan9/zsyscall_plan9_amd64.go b/vendor/golang.org/x/sys/plan9/zsyscall_plan9_amd64.go index 0e6a96aa..7de61065 100644 --- a/vendor/golang.org/x/sys/plan9/zsyscall_plan9_amd64.go +++ b/vendor/golang.org/x/sys/plan9/zsyscall_plan9_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build plan9 && amd64 -// +build plan9,amd64 package plan9 diff --git a/vendor/golang.org/x/sys/plan9/zsyscall_plan9_arm.go b/vendor/golang.org/x/sys/plan9/zsyscall_plan9_arm.go index 244c501b..ea85780f 100644 --- a/vendor/golang.org/x/sys/plan9/zsyscall_plan9_arm.go +++ b/vendor/golang.org/x/sys/plan9/zsyscall_plan9_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build plan9 && arm -// +build plan9,arm package plan9 diff --git a/vendor/golang.org/x/sys/unix/aliases.go b/vendor/golang.org/x/sys/unix/aliases.go index abc89c10..e7d3df4b 100644 --- a/vendor/golang.org/x/sys/unix/aliases.go +++ b/vendor/golang.org/x/sys/unix/aliases.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos) && go1.9 -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos -// +build go1.9 package unix diff --git a/vendor/golang.org/x/sys/unix/asm_aix_ppc64.s b/vendor/golang.org/x/sys/unix/asm_aix_ppc64.s index db9171c2..269e173c 100644 --- a/vendor/golang.org/x/sys/unix/asm_aix_ppc64.s +++ b/vendor/golang.org/x/sys/unix/asm_aix_ppc64.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_386.s b/vendor/golang.org/x/sys/unix/asm_bsd_386.s index e0fcd9b3..a4fcef0e 100644 --- a/vendor/golang.org/x/sys/unix/asm_bsd_386.s +++ b/vendor/golang.org/x/sys/unix/asm_bsd_386.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (freebsd || netbsd || openbsd) && gc -// +build freebsd netbsd openbsd -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_amd64.s b/vendor/golang.org/x/sys/unix/asm_bsd_amd64.s index 2b99c349..1e63615c 100644 --- a/vendor/golang.org/x/sys/unix/asm_bsd_amd64.s +++ b/vendor/golang.org/x/sys/unix/asm_bsd_amd64.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin || dragonfly || freebsd || netbsd || openbsd) && gc -// +build darwin dragonfly freebsd netbsd openbsd -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_arm.s b/vendor/golang.org/x/sys/unix/asm_bsd_arm.s index d702d4ad..6496c310 100644 --- a/vendor/golang.org/x/sys/unix/asm_bsd_arm.s +++ b/vendor/golang.org/x/sys/unix/asm_bsd_arm.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (freebsd || netbsd || openbsd) && gc -// +build freebsd netbsd openbsd -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_arm64.s b/vendor/golang.org/x/sys/unix/asm_bsd_arm64.s index fe36a739..4fd1f54d 100644 --- a/vendor/golang.org/x/sys/unix/asm_bsd_arm64.s +++ b/vendor/golang.org/x/sys/unix/asm_bsd_arm64.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin || freebsd || netbsd || openbsd) && gc -// +build darwin freebsd netbsd openbsd -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s b/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s index e5b9a848..42f7eb9e 100644 --- a/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s +++ b/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin || freebsd || netbsd || openbsd) && gc -// +build darwin freebsd netbsd openbsd -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_riscv64.s b/vendor/golang.org/x/sys/unix/asm_bsd_riscv64.s index d560019e..f8902667 100644 --- a/vendor/golang.org/x/sys/unix/asm_bsd_riscv64.s +++ b/vendor/golang.org/x/sys/unix/asm_bsd_riscv64.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin || freebsd || netbsd || openbsd) && gc -// +build darwin freebsd netbsd openbsd -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_386.s b/vendor/golang.org/x/sys/unix/asm_linux_386.s index 8fd101d0..3b473487 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_386.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_386.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_amd64.s b/vendor/golang.org/x/sys/unix/asm_linux_amd64.s index 7ed38e43..67e29f31 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_amd64.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_amd64.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_arm.s b/vendor/golang.org/x/sys/unix/asm_linux_arm.s index 8ef1d514..d6ae269c 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_arm.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_arm.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_arm64.s b/vendor/golang.org/x/sys/unix/asm_linux_arm64.s index 98ae0276..01e5e253 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_arm64.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_arm64.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && arm64 && gc -// +build linux -// +build arm64 -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_loong64.s b/vendor/golang.org/x/sys/unix/asm_linux_loong64.s index 56535728..2abf12f6 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_loong64.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_loong64.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && loong64 && gc -// +build linux -// +build loong64 -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_mips64x.s b/vendor/golang.org/x/sys/unix/asm_linux_mips64x.s index 21231d2c..f84bae71 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_mips64x.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_mips64x.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (mips64 || mips64le) && gc -// +build linux -// +build mips64 mips64le -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_mipsx.s b/vendor/golang.org/x/sys/unix/asm_linux_mipsx.s index 6783b26c..f08f6280 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_mipsx.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_mipsx.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (mips || mipsle) && gc -// +build linux -// +build mips mipsle -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_ppc64x.s b/vendor/golang.org/x/sys/unix/asm_linux_ppc64x.s index 19d49893..bdfc024d 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_ppc64x.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_ppc64x.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (ppc64 || ppc64le) && gc -// +build linux -// +build ppc64 ppc64le -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_riscv64.s b/vendor/golang.org/x/sys/unix/asm_linux_riscv64.s index e42eb81d..2e8c9961 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_riscv64.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_riscv64.s @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build riscv64 && gc -// +build riscv64 -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_linux_s390x.s b/vendor/golang.org/x/sys/unix/asm_linux_s390x.s index c46aab33..2c394b11 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_s390x.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_s390x.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && s390x && gc -// +build linux -// +build s390x -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_openbsd_mips64.s b/vendor/golang.org/x/sys/unix/asm_openbsd_mips64.s index 5e7a1169..fab586a2 100644 --- a/vendor/golang.org/x/sys/unix/asm_openbsd_mips64.s +++ b/vendor/golang.org/x/sys/unix/asm_openbsd_mips64.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_solaris_amd64.s b/vendor/golang.org/x/sys/unix/asm_solaris_amd64.s index f8c5394c..f949ec54 100644 --- a/vendor/golang.org/x/sys/unix/asm_solaris_amd64.s +++ b/vendor/golang.org/x/sys/unix/asm_solaris_amd64.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gc -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/asm_zos_s390x.s b/vendor/golang.org/x/sys/unix/asm_zos_s390x.s index 3b54e185..2f67ba86 100644 --- a/vendor/golang.org/x/sys/unix/asm_zos_s390x.s +++ b/vendor/golang.org/x/sys/unix/asm_zos_s390x.s @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x && gc -// +build zos -// +build s390x -// +build gc #include "textflag.h" diff --git a/vendor/golang.org/x/sys/unix/cap_freebsd.go b/vendor/golang.org/x/sys/unix/cap_freebsd.go index 0b7c6adb..a0865789 100644 --- a/vendor/golang.org/x/sys/unix/cap_freebsd.go +++ b/vendor/golang.org/x/sys/unix/cap_freebsd.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build freebsd -// +build freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/constants.go b/vendor/golang.org/x/sys/unix/constants.go index 394a3965..6fb7cb77 100644 --- a/vendor/golang.org/x/sys/unix/constants.go +++ b/vendor/golang.org/x/sys/unix/constants.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos package unix diff --git a/vendor/golang.org/x/sys/unix/dev_aix_ppc.go b/vendor/golang.org/x/sys/unix/dev_aix_ppc.go index 65a99850..d7851346 100644 --- a/vendor/golang.org/x/sys/unix/dev_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/dev_aix_ppc.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix && ppc -// +build aix,ppc // Functions to access/create device major and minor numbers matching the // encoding used by AIX. diff --git a/vendor/golang.org/x/sys/unix/dev_aix_ppc64.go b/vendor/golang.org/x/sys/unix/dev_aix_ppc64.go index 8fc08ad0..623a5e69 100644 --- a/vendor/golang.org/x/sys/unix/dev_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/dev_aix_ppc64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix && ppc64 -// +build aix,ppc64 // Functions to access/create device major and minor numbers matching the // encoding used AIX. diff --git a/vendor/golang.org/x/sys/unix/dev_zos.go b/vendor/golang.org/x/sys/unix/dev_zos.go index a388e59a..bb6a64fe 100644 --- a/vendor/golang.org/x/sys/unix/dev_zos.go +++ b/vendor/golang.org/x/sys/unix/dev_zos.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x // Functions to access/create device major and minor numbers matching the // encoding used by z/OS. diff --git a/vendor/golang.org/x/sys/unix/dirent.go b/vendor/golang.org/x/sys/unix/dirent.go index 2499f977..1ebf1178 100644 --- a/vendor/golang.org/x/sys/unix/dirent.go +++ b/vendor/golang.org/x/sys/unix/dirent.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos package unix diff --git a/vendor/golang.org/x/sys/unix/endian_big.go b/vendor/golang.org/x/sys/unix/endian_big.go index a5202655..1095fd31 100644 --- a/vendor/golang.org/x/sys/unix/endian_big.go +++ b/vendor/golang.org/x/sys/unix/endian_big.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. // //go:build armbe || arm64be || m68k || mips || mips64 || mips64p32 || ppc || ppc64 || s390 || s390x || shbe || sparc || sparc64 -// +build armbe arm64be m68k mips mips64 mips64p32 ppc ppc64 s390 s390x shbe sparc sparc64 package unix diff --git a/vendor/golang.org/x/sys/unix/endian_little.go b/vendor/golang.org/x/sys/unix/endian_little.go index b0f2bc4a..b9f0e277 100644 --- a/vendor/golang.org/x/sys/unix/endian_little.go +++ b/vendor/golang.org/x/sys/unix/endian_little.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. // //go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || loong64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh -// +build 386 amd64 amd64p32 alpha arm arm64 loong64 mipsle mips64le mips64p32le nios2 ppc64le riscv riscv64 sh package unix diff --git a/vendor/golang.org/x/sys/unix/env_unix.go b/vendor/golang.org/x/sys/unix/env_unix.go index 29ccc4d1..a96da71f 100644 --- a/vendor/golang.org/x/sys/unix/env_unix.go +++ b/vendor/golang.org/x/sys/unix/env_unix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos // Unix environment variables. diff --git a/vendor/golang.org/x/sys/unix/epoll_zos.go b/vendor/golang.org/x/sys/unix/epoll_zos.go index cedaf7e0..7753fdde 100644 --- a/vendor/golang.org/x/sys/unix/epoll_zos.go +++ b/vendor/golang.org/x/sys/unix/epoll_zos.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x package unix diff --git a/vendor/golang.org/x/sys/unix/fcntl.go b/vendor/golang.org/x/sys/unix/fcntl.go index e9b99125..6200876f 100644 --- a/vendor/golang.org/x/sys/unix/fcntl.go +++ b/vendor/golang.org/x/sys/unix/fcntl.go @@ -2,8 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build dragonfly || freebsd || linux || netbsd || openbsd -// +build dragonfly freebsd linux netbsd openbsd +//go:build dragonfly || freebsd || linux || netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/fcntl_linux_32bit.go b/vendor/golang.org/x/sys/unix/fcntl_linux_32bit.go index 29d44808..13b4acd5 100644 --- a/vendor/golang.org/x/sys/unix/fcntl_linux_32bit.go +++ b/vendor/golang.org/x/sys/unix/fcntl_linux_32bit.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build (linux && 386) || (linux && arm) || (linux && mips) || (linux && mipsle) || (linux && ppc) -// +build linux,386 linux,arm linux,mips linux,mipsle linux,ppc package unix diff --git a/vendor/golang.org/x/sys/unix/fdset.go b/vendor/golang.org/x/sys/unix/fdset.go index a8068f94..9e83d18c 100644 --- a/vendor/golang.org/x/sys/unix/fdset.go +++ b/vendor/golang.org/x/sys/unix/fdset.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos package unix diff --git a/vendor/golang.org/x/sys/unix/fstatfs_zos.go b/vendor/golang.org/x/sys/unix/fstatfs_zos.go index e377cc9f..c8bde601 100644 --- a/vendor/golang.org/x/sys/unix/fstatfs_zos.go +++ b/vendor/golang.org/x/sys/unix/fstatfs_zos.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x package unix diff --git a/vendor/golang.org/x/sys/unix/gccgo.go b/vendor/golang.org/x/sys/unix/gccgo.go index b06f52d7..aca5721d 100644 --- a/vendor/golang.org/x/sys/unix/gccgo.go +++ b/vendor/golang.org/x/sys/unix/gccgo.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gccgo && !aix && !hurd -// +build gccgo,!aix,!hurd package unix diff --git a/vendor/golang.org/x/sys/unix/gccgo_c.c b/vendor/golang.org/x/sys/unix/gccgo_c.c index f98a1c54..d468b7b4 100644 --- a/vendor/golang.org/x/sys/unix/gccgo_c.c +++ b/vendor/golang.org/x/sys/unix/gccgo_c.c @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gccgo && !aix && !hurd -// +build gccgo,!aix,!hurd #include #include diff --git a/vendor/golang.org/x/sys/unix/gccgo_linux_amd64.go b/vendor/golang.org/x/sys/unix/gccgo_linux_amd64.go index e60e49a3..972d61bd 100644 --- a/vendor/golang.org/x/sys/unix/gccgo_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/gccgo_linux_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build gccgo && linux && amd64 -// +build gccgo,linux,amd64 package unix diff --git a/vendor/golang.org/x/sys/unix/ifreq_linux.go b/vendor/golang.org/x/sys/unix/ifreq_linux.go index 15721a51..848840ae 100644 --- a/vendor/golang.org/x/sys/unix/ifreq_linux.go +++ b/vendor/golang.org/x/sys/unix/ifreq_linux.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux -// +build linux package unix diff --git a/vendor/golang.org/x/sys/unix/ioctl_linux.go b/vendor/golang.org/x/sys/unix/ioctl_linux.go index 0d12c085..dbe680ea 100644 --- a/vendor/golang.org/x/sys/unix/ioctl_linux.go +++ b/vendor/golang.org/x/sys/unix/ioctl_linux.go @@ -231,3 +231,8 @@ func IoctlLoopGetStatus64(fd int) (*LoopInfo64, error) { func IoctlLoopSetStatus64(fd int, value *LoopInfo64) error { return ioctlPtr(fd, LOOP_SET_STATUS64, unsafe.Pointer(value)) } + +// IoctlLoopConfigure configures all loop device parameters in a single step +func IoctlLoopConfigure(fd int, value *LoopConfig) error { + return ioctlPtr(fd, LOOP_CONFIGURE, unsafe.Pointer(value)) +} diff --git a/vendor/golang.org/x/sys/unix/ioctl_signed.go b/vendor/golang.org/x/sys/unix/ioctl_signed.go new file mode 100644 index 00000000..5b0759bd --- /dev/null +++ b/vendor/golang.org/x/sys/unix/ioctl_signed.go @@ -0,0 +1,69 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build aix || solaris + +package unix + +import ( + "unsafe" +) + +// ioctl itself should not be exposed directly, but additional get/set +// functions for specific types are permissible. + +// IoctlSetInt performs an ioctl operation which sets an integer value +// on fd, using the specified request number. +func IoctlSetInt(fd int, req int, value int) error { + return ioctl(fd, req, uintptr(value)) +} + +// IoctlSetPointerInt performs an ioctl operation which sets an +// integer value on fd, using the specified request number. The ioctl +// argument is called with a pointer to the integer value, rather than +// passing the integer value directly. +func IoctlSetPointerInt(fd int, req int, value int) error { + v := int32(value) + return ioctlPtr(fd, req, unsafe.Pointer(&v)) +} + +// IoctlSetWinsize performs an ioctl on fd with a *Winsize argument. +// +// To change fd's window size, the req argument should be TIOCSWINSZ. +func IoctlSetWinsize(fd int, req int, value *Winsize) error { + // TODO: if we get the chance, remove the req parameter and + // hardcode TIOCSWINSZ. + return ioctlPtr(fd, req, unsafe.Pointer(value)) +} + +// IoctlSetTermios performs an ioctl on fd with a *Termios. +// +// The req value will usually be TCSETA or TIOCSETA. +func IoctlSetTermios(fd int, req int, value *Termios) error { + // TODO: if we get the chance, remove the req parameter. + return ioctlPtr(fd, req, unsafe.Pointer(value)) +} + +// IoctlGetInt performs an ioctl operation which gets an integer value +// from fd, using the specified request number. +// +// A few ioctl requests use the return value as an output parameter; +// for those, IoctlRetInt should be used instead of this function. +func IoctlGetInt(fd int, req int) (int, error) { + var value int + err := ioctlPtr(fd, req, unsafe.Pointer(&value)) + return value, err +} + +func IoctlGetWinsize(fd int, req int) (*Winsize, error) { + var value Winsize + err := ioctlPtr(fd, req, unsafe.Pointer(&value)) + return &value, err +} + +func IoctlGetTermios(fd int, req int) (*Termios, error) { + var value Termios + err := ioctlPtr(fd, req, unsafe.Pointer(&value)) + return &value, err +} diff --git a/vendor/golang.org/x/sys/unix/ioctl.go b/vendor/golang.org/x/sys/unix/ioctl_unsigned.go similarity index 92% rename from vendor/golang.org/x/sys/unix/ioctl.go rename to vendor/golang.org/x/sys/unix/ioctl_unsigned.go index 7ce8dd40..20f470b9 100644 --- a/vendor/golang.org/x/sys/unix/ioctl.go +++ b/vendor/golang.org/x/sys/unix/ioctl_unsigned.go @@ -2,8 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build aix || darwin || dragonfly || freebsd || hurd || linux || netbsd || openbsd || solaris -// +build aix darwin dragonfly freebsd hurd linux netbsd openbsd solaris +//go:build darwin || dragonfly || freebsd || hurd || linux || netbsd || openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ioctl_zos.go b/vendor/golang.org/x/sys/unix/ioctl_zos.go index 6532f09a..c8b2a750 100644 --- a/vendor/golang.org/x/sys/unix/ioctl_zos.go +++ b/vendor/golang.org/x/sys/unix/ioctl_zos.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x package unix @@ -17,14 +16,14 @@ import ( // IoctlSetInt performs an ioctl operation which sets an integer value // on fd, using the specified request number. -func IoctlSetInt(fd int, req uint, value int) error { +func IoctlSetInt(fd int, req int, value int) error { return ioctl(fd, req, uintptr(value)) } // IoctlSetWinsize performs an ioctl on fd with a *Winsize argument. // // To change fd's window size, the req argument should be TIOCSWINSZ. -func IoctlSetWinsize(fd int, req uint, value *Winsize) error { +func IoctlSetWinsize(fd int, req int, value *Winsize) error { // TODO: if we get the chance, remove the req parameter and // hardcode TIOCSWINSZ. return ioctlPtr(fd, req, unsafe.Pointer(value)) @@ -33,7 +32,7 @@ func IoctlSetWinsize(fd int, req uint, value *Winsize) error { // IoctlSetTermios performs an ioctl on fd with a *Termios. // // The req value is expected to be TCSETS, TCSETSW, or TCSETSF -func IoctlSetTermios(fd int, req uint, value *Termios) error { +func IoctlSetTermios(fd int, req int, value *Termios) error { if (req != TCSETS) && (req != TCSETSW) && (req != TCSETSF) { return ENOSYS } @@ -47,13 +46,13 @@ func IoctlSetTermios(fd int, req uint, value *Termios) error { // // A few ioctl requests use the return value as an output parameter; // for those, IoctlRetInt should be used instead of this function. -func IoctlGetInt(fd int, req uint) (int, error) { +func IoctlGetInt(fd int, req int) (int, error) { var value int err := ioctlPtr(fd, req, unsafe.Pointer(&value)) return value, err } -func IoctlGetWinsize(fd int, req uint) (*Winsize, error) { +func IoctlGetWinsize(fd int, req int) (*Winsize, error) { var value Winsize err := ioctlPtr(fd, req, unsafe.Pointer(&value)) return &value, err @@ -62,7 +61,7 @@ func IoctlGetWinsize(fd int, req uint) (*Winsize, error) { // IoctlGetTermios performs an ioctl on fd with a *Termios. // // The req value is expected to be TCGETS -func IoctlGetTermios(fd int, req uint) (*Termios, error) { +func IoctlGetTermios(fd int, req int) (*Termios, error) { var value Termios if req != TCGETS { return &value, ENOSYS diff --git a/vendor/golang.org/x/sys/unix/mkall.sh b/vendor/golang.org/x/sys/unix/mkall.sh index 8e3947c3..e6f31d37 100644 --- a/vendor/golang.org/x/sys/unix/mkall.sh +++ b/vendor/golang.org/x/sys/unix/mkall.sh @@ -50,7 +50,7 @@ if [[ "$GOOS" = "linux" ]]; then # Use the Docker-based build system # Files generated through docker (use $cmd so you can Ctl-C the build or run) $cmd docker build --tag generate:$GOOS $GOOS - $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && /bin/pwd):/build generate:$GOOS + $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && pwd):/build generate:$GOOS exit fi diff --git a/vendor/golang.org/x/sys/unix/mkerrors.sh b/vendor/golang.org/x/sys/unix/mkerrors.sh index 7456d9dd..6202638b 100644 --- a/vendor/golang.org/x/sys/unix/mkerrors.sh +++ b/vendor/golang.org/x/sys/unix/mkerrors.sh @@ -66,6 +66,7 @@ includes_Darwin=' #include #include #include +#include #include #include #include @@ -203,6 +204,7 @@ struct ltchars { #include #include #include +#include #include #include #include @@ -517,10 +519,12 @@ ccflags="$@" $2 ~ /^LOCK_(SH|EX|NB|UN)$/ || $2 ~ /^LO_(KEY|NAME)_SIZE$/ || $2 ~ /^LOOP_(CLR|CTL|GET|SET)_/ || - $2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT)_/ || + $2 == "LOOP_CONFIGURE" || + $2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MREMAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT|UDP)_/ || $2 ~ /^NFC_(GENL|PROTO|COMM|RF|SE|DIRECTION|LLCP|SOCKPROTO)_/ || $2 ~ /^NFC_.*_(MAX)?SIZE$/ || $2 ~ /^RAW_PAYLOAD_/ || + $2 ~ /^[US]F_/ || $2 ~ /^TP_STATUS_/ || $2 ~ /^FALLOC_/ || $2 ~ /^ICMPV?6?_(FILTER|SEC)/ || @@ -557,7 +561,7 @@ ccflags="$@" $2 ~ /^RLIMIT_(AS|CORE|CPU|DATA|FSIZE|LOCKS|MEMLOCK|MSGQUEUE|NICE|NOFILE|NPROC|RSS|RTPRIO|RTTIME|SIGPENDING|STACK)|RLIM_INFINITY/ || $2 ~ /^PRIO_(PROCESS|PGRP|USER)/ || $2 ~ /^CLONE_[A-Z_]+/ || - $2 !~ /^(BPF_TIMEVAL|BPF_FIB_LOOKUP_[A-Z]+)$/ && + $2 !~ /^(BPF_TIMEVAL|BPF_FIB_LOOKUP_[A-Z]+|BPF_F_LINK)$/ && $2 ~ /^(BPF|DLT)_/ || $2 ~ /^AUDIT_/ || $2 ~ /^(CLOCK|TIMER)_/ || @@ -580,6 +584,7 @@ ccflags="$@" $2 ~ /^PERF_/ || $2 ~ /^SECCOMP_MODE_/ || $2 ~ /^SEEK_/ || + $2 ~ /^SCHED_/ || $2 ~ /^SPLICE_/ || $2 ~ /^SYNC_FILE_RANGE_/ || $2 !~ /IOC_MAGIC/ && @@ -621,7 +626,7 @@ ccflags="$@" $2 ~ /^MEM/ || $2 ~ /^WG/ || $2 ~ /^FIB_RULE_/ || - $2 ~ /^BLK[A-Z]*(GET$|SET$|BUF$|PART$|SIZE)/ {printf("\t%s = C.%s\n", $2, $2)} + $2 ~ /^BLK[A-Z]*(GET$|SET$|BUF$|PART$|SIZE|IOMIN$|IOOPT$|ALIGNOFF$|DISCARD|ROTATIONAL$|ZEROOUT$|GETDISKSEQ$)/ {printf("\t%s = C.%s\n", $2, $2)} $2 ~ /^__WCOREFLAG$/ {next} $2 ~ /^__W[A-Z0-9]+$/ {printf("\t%s = C.%s\n", substr($2,3), $2)} @@ -659,7 +664,6 @@ echo '// mkerrors.sh' "$@" echo '// Code generated by the command above; see README.md. DO NOT EDIT.' echo echo "//go:build ${GOARCH} && ${GOOS}" -echo "// +build ${GOARCH},${GOOS}" echo go tool cgo -godefs -- "$@" _const.go >_error.out cat _error.out | grep -vf _error.grep | grep -vf _signal.grep @@ -738,7 +742,8 @@ main(void) e = errors[i].num; if(i > 0 && errors[i-1].num == e) continue; - strcpy(buf, strerror(e)); + strncpy(buf, strerror(e), sizeof(buf) - 1); + buf[sizeof(buf) - 1] = '\0'; // lowercase first letter: Bad -> bad, but STREAM -> STREAM. if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z) buf[0] += a - A; @@ -757,7 +762,8 @@ main(void) e = signals[i].num; if(i > 0 && signals[i-1].num == e) continue; - strcpy(buf, strsignal(e)); + strncpy(buf, strsignal(e), sizeof(buf) - 1); + buf[sizeof(buf) - 1] = '\0'; // lowercase first letter: Bad -> bad, but STREAM -> STREAM. if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z) buf[0] += a - A; diff --git a/vendor/golang.org/x/sys/unix/mmap_nomremap.go b/vendor/golang.org/x/sys/unix/mmap_nomremap.go new file mode 100644 index 00000000..4b68e597 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/mmap_nomremap.go @@ -0,0 +1,13 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build aix || darwin || dragonfly || freebsd || openbsd || solaris + +package unix + +var mapper = &mmapper{ + active: make(map[*byte][]byte), + mmap: mmap, + munmap: munmap, +} diff --git a/vendor/golang.org/x/sys/unix/mremap.go b/vendor/golang.org/x/sys/unix/mremap.go new file mode 100644 index 00000000..fd45fe52 --- /dev/null +++ b/vendor/golang.org/x/sys/unix/mremap.go @@ -0,0 +1,52 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build linux || netbsd + +package unix + +import "unsafe" + +type mremapMmapper struct { + mmapper + mremap func(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) +} + +var mapper = &mremapMmapper{ + mmapper: mmapper{ + active: make(map[*byte][]byte), + mmap: mmap, + munmap: munmap, + }, + mremap: mremap, +} + +func (m *mremapMmapper) Mremap(oldData []byte, newLength int, flags int) (data []byte, err error) { + if newLength <= 0 || len(oldData) == 0 || len(oldData) != cap(oldData) || flags&mremapFixed != 0 { + return nil, EINVAL + } + + pOld := &oldData[cap(oldData)-1] + m.Lock() + defer m.Unlock() + bOld := m.active[pOld] + if bOld == nil || &bOld[0] != &oldData[0] { + return nil, EINVAL + } + newAddr, errno := m.mremap(uintptr(unsafe.Pointer(&bOld[0])), uintptr(len(bOld)), uintptr(newLength), flags, 0) + if errno != nil { + return nil, errno + } + bNew := unsafe.Slice((*byte)(unsafe.Pointer(newAddr)), newLength) + pNew := &bNew[cap(bNew)-1] + if flags&mremapDontunmap == 0 { + delete(m.active, pOld) + } + m.active[pNew] = bNew + return bNew, nil +} + +func Mremap(oldData []byte, newLength int, flags int) (data []byte, err error) { + return mapper.Mremap(oldData, newLength, flags) +} diff --git a/vendor/golang.org/x/sys/unix/pagesize_unix.go b/vendor/golang.org/x/sys/unix/pagesize_unix.go index 53f1b4c5..4d0a3430 100644 --- a/vendor/golang.org/x/sys/unix/pagesize_unix.go +++ b/vendor/golang.org/x/sys/unix/pagesize_unix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris // For Unix, get the pagesize from the runtime. diff --git a/vendor/golang.org/x/sys/unix/pledge_openbsd.go b/vendor/golang.org/x/sys/unix/pledge_openbsd.go index eb48294b..6a09af53 100644 --- a/vendor/golang.org/x/sys/unix/pledge_openbsd.go +++ b/vendor/golang.org/x/sys/unix/pledge_openbsd.go @@ -8,54 +8,31 @@ import ( "errors" "fmt" "strconv" - "syscall" - "unsafe" ) // Pledge implements the pledge syscall. // -// The pledge syscall does not accept execpromises on OpenBSD releases -// before 6.3. -// -// execpromises must be empty when Pledge is called on OpenBSD -// releases predating 6.3, otherwise an error will be returned. +// This changes both the promises and execpromises; use PledgePromises or +// PledgeExecpromises to only change the promises or execpromises +// respectively. // // For more information see pledge(2). func Pledge(promises, execpromises string) error { - maj, min, err := majmin() - if err != nil { + if err := pledgeAvailable(); err != nil { return err } - err = pledgeAvailable(maj, min, execpromises) + pptr, err := BytePtrFromString(promises) if err != nil { return err } - pptr, err := syscall.BytePtrFromString(promises) + exptr, err := BytePtrFromString(execpromises) if err != nil { return err } - // This variable will hold either a nil unsafe.Pointer or - // an unsafe.Pointer to a string (execpromises). - var expr unsafe.Pointer - - // If we're running on OpenBSD > 6.2, pass execpromises to the syscall. - if maj > 6 || (maj == 6 && min > 2) { - exptr, err := syscall.BytePtrFromString(execpromises) - if err != nil { - return err - } - expr = unsafe.Pointer(exptr) - } - - _, _, e := syscall.Syscall(SYS_PLEDGE, uintptr(unsafe.Pointer(pptr)), uintptr(expr), 0) - if e != 0 { - return e - } - - return nil + return pledge(pptr, exptr) } // PledgePromises implements the pledge syscall. @@ -64,30 +41,16 @@ func Pledge(promises, execpromises string) error { // // For more information see pledge(2). func PledgePromises(promises string) error { - maj, min, err := majmin() - if err != nil { - return err - } - - err = pledgeAvailable(maj, min, "") - if err != nil { + if err := pledgeAvailable(); err != nil { return err } - // This variable holds the execpromises and is always nil. - var expr unsafe.Pointer - - pptr, err := syscall.BytePtrFromString(promises) + pptr, err := BytePtrFromString(promises) if err != nil { return err } - _, _, e := syscall.Syscall(SYS_PLEDGE, uintptr(unsafe.Pointer(pptr)), uintptr(expr), 0) - if e != 0 { - return e - } - - return nil + return pledge(pptr, nil) } // PledgeExecpromises implements the pledge syscall. @@ -96,30 +59,16 @@ func PledgePromises(promises string) error { // // For more information see pledge(2). func PledgeExecpromises(execpromises string) error { - maj, min, err := majmin() - if err != nil { + if err := pledgeAvailable(); err != nil { return err } - err = pledgeAvailable(maj, min, execpromises) + exptr, err := BytePtrFromString(execpromises) if err != nil { return err } - // This variable holds the promises and is always nil. - var pptr unsafe.Pointer - - exptr, err := syscall.BytePtrFromString(execpromises) - if err != nil { - return err - } - - _, _, e := syscall.Syscall(SYS_PLEDGE, uintptr(pptr), uintptr(unsafe.Pointer(exptr)), 0) - if e != 0 { - return e - } - - return nil + return pledge(nil, exptr) } // majmin returns major and minor version number for an OpenBSD system. @@ -147,16 +96,15 @@ func majmin() (major int, minor int, err error) { // pledgeAvailable checks for availability of the pledge(2) syscall // based on the running OpenBSD version. -func pledgeAvailable(maj, min int, execpromises string) error { - // If OpenBSD <= 5.9, pledge is not available. - if (maj == 5 && min != 9) || maj < 5 { - return fmt.Errorf("pledge syscall is not available on OpenBSD %d.%d", maj, min) +func pledgeAvailable() error { + maj, min, err := majmin() + if err != nil { + return err } - // If OpenBSD <= 6.2 and execpromises is not empty, - // return an error - execpromises is not available before 6.3 - if (maj < 6 || (maj == 6 && min <= 2)) && execpromises != "" { - return fmt.Errorf("cannot use execpromises on OpenBSD %d.%d", maj, min) + // Require OpenBSD 6.4 as a minimum. + if maj < 6 || (maj == 6 && min <= 3) { + return fmt.Errorf("cannot call Pledge on OpenBSD %d.%d", maj, min) } return nil diff --git a/vendor/golang.org/x/sys/unix/ptrace_darwin.go b/vendor/golang.org/x/sys/unix/ptrace_darwin.go index 39dba6ca..3f0975f3 100644 --- a/vendor/golang.org/x/sys/unix/ptrace_darwin.go +++ b/vendor/golang.org/x/sys/unix/ptrace_darwin.go @@ -3,16 +3,9 @@ // license that can be found in the LICENSE file. //go:build darwin && !ios -// +build darwin,!ios package unix -import "unsafe" - func ptrace(request int, pid int, addr uintptr, data uintptr) error { return ptrace1(request, pid, addr, data) } - -func ptracePtr(request int, pid int, addr uintptr, data unsafe.Pointer) error { - return ptrace1Ptr(request, pid, addr, data) -} diff --git a/vendor/golang.org/x/sys/unix/ptrace_ios.go b/vendor/golang.org/x/sys/unix/ptrace_ios.go index 9ea66330..a4d35db5 100644 --- a/vendor/golang.org/x/sys/unix/ptrace_ios.go +++ b/vendor/golang.org/x/sys/unix/ptrace_ios.go @@ -3,16 +3,9 @@ // license that can be found in the LICENSE file. //go:build ios -// +build ios package unix -import "unsafe" - func ptrace(request int, pid int, addr uintptr, data uintptr) (err error) { return ENOTSUP } - -func ptracePtr(request int, pid int, addr uintptr, data unsafe.Pointer) (err error) { - return ENOTSUP -} diff --git a/vendor/golang.org/x/sys/unix/race.go b/vendor/golang.org/x/sys/unix/race.go index 6f6c5fec..714d2aae 100644 --- a/vendor/golang.org/x/sys/unix/race.go +++ b/vendor/golang.org/x/sys/unix/race.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin && race) || (linux && race) || (freebsd && race) -// +build darwin,race linux,race freebsd,race package unix diff --git a/vendor/golang.org/x/sys/unix/race0.go b/vendor/golang.org/x/sys/unix/race0.go index 706e1322..4a9f6634 100644 --- a/vendor/golang.org/x/sys/unix/race0.go +++ b/vendor/golang.org/x/sys/unix/race0.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || (darwin && !race) || (linux && !race) || (freebsd && !race) || netbsd || openbsd || solaris || dragonfly || zos -// +build aix darwin,!race linux,!race freebsd,!race netbsd openbsd solaris dragonfly zos package unix diff --git a/vendor/golang.org/x/sys/unix/readdirent_getdents.go b/vendor/golang.org/x/sys/unix/readdirent_getdents.go index 4d625756..dbd2b6cc 100644 --- a/vendor/golang.org/x/sys/unix/readdirent_getdents.go +++ b/vendor/golang.org/x/sys/unix/readdirent_getdents.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || dragonfly || freebsd || linux || netbsd || openbsd -// +build aix dragonfly freebsd linux netbsd openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go b/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go index 2a4ba47c..130398b6 100644 --- a/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go +++ b/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build darwin -// +build darwin package unix diff --git a/vendor/golang.org/x/sys/unix/sockcmsg_unix.go b/vendor/golang.org/x/sys/unix/sockcmsg_unix.go index 3865943f..c3a62dbb 100644 --- a/vendor/golang.org/x/sys/unix/sockcmsg_unix.go +++ b/vendor/golang.org/x/sys/unix/sockcmsg_unix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos // Socket control messages diff --git a/vendor/golang.org/x/sys/unix/sockcmsg_unix_other.go b/vendor/golang.org/x/sys/unix/sockcmsg_unix_other.go index 0840fe4a..4a1eab37 100644 --- a/vendor/golang.org/x/sys/unix/sockcmsg_unix_other.go +++ b/vendor/golang.org/x/sys/unix/sockcmsg_unix_other.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin freebsd linux netbsd openbsd solaris zos package unix diff --git a/vendor/golang.org/x/sys/unix/syscall.go b/vendor/golang.org/x/sys/unix/syscall.go index 63e8c838..5ea74da9 100644 --- a/vendor/golang.org/x/sys/unix/syscall.go +++ b/vendor/golang.org/x/sys/unix/syscall.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos // Package unix contains an interface to the low-level operating system // primitives. OS details vary depending on the underlying system, and diff --git a/vendor/golang.org/x/sys/unix/syscall_aix.go b/vendor/golang.org/x/sys/unix/syscall_aix.go index d9f5544c..67ce6cef 100644 --- a/vendor/golang.org/x/sys/unix/syscall_aix.go +++ b/vendor/golang.org/x/sys/unix/syscall_aix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix -// +build aix // Aix system calls. // This file is compiled as ordinary Go code, @@ -107,7 +106,8 @@ func (sa *SockaddrUnix) sockaddr() (unsafe.Pointer, _Socklen, error) { if n > 0 { sl += _Socklen(n) + 1 } - if sa.raw.Path[0] == '@' { + if sa.raw.Path[0] == '@' || (sa.raw.Path[0] == 0 && sl > 3) { + // Check sl > 3 so we don't change unnamed socket behavior. sa.raw.Path[0] = 0 // Don't count trailing NUL for abstract address. sl-- @@ -408,8 +408,8 @@ func (w WaitStatus) CoreDump() bool { return w&0x80 == 0x80 } func (w WaitStatus) TrapCause() int { return -1 } -//sys ioctl(fd int, req uint, arg uintptr) (err error) -//sys ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = ioctl +//sys ioctl(fd int, req int, arg uintptr) (err error) +//sys ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) = ioctl // fcntl must never be called with cmd=F_DUP2FD because it doesn't work on AIX // There is no way to create a custom fcntl and to keep //sys fcntl easily, @@ -487,8 +487,6 @@ func Fsync(fd int) error { //sys Unlinkat(dirfd int, path string, flags int) (err error) //sys Ustat(dev int, ubuf *Ustat_t) (err error) //sys write(fd int, p []byte) (n int, err error) -//sys readlen(fd int, p *byte, np int) (n int, err error) = read -//sys writelen(fd int, p *byte, np int) (n int, err error) = write //sys Dup2(oldfd int, newfd int) (err error) //sys Fadvise(fd int, offset int64, length int64, advice int) (err error) = posix_fadvise64 @@ -535,21 +533,6 @@ func Fsync(fd int) error { //sys sendmsg(s int, msg *Msghdr, flags int) (n int, err error) = nsendmsg //sys munmap(addr uintptr, length uintptr) (err error) - -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Madvise(b []byte, advice int) (err error) //sys Mprotect(b []byte, prot int) (err error) //sys Mlock(b []byte) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go b/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go index e92a0be1..1fdaa476 100644 --- a/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go @@ -3,12 +3,10 @@ // license that can be found in the LICENSE file. //go:build aix && ppc -// +build aix,ppc package unix //sysnb Getrlimit(resource int, rlim *Rlimit) (err error) = getrlimit64 -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) = setrlimit64 //sys Seek(fd int, offset int64, whence int) (off int64, err error) = lseek64 //sys mmap(addr uintptr, length uintptr, prot int, flags int, fd int, offset int64) (xaddr uintptr, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go b/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go index 16eed170..c87f9a9f 100644 --- a/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go @@ -3,12 +3,10 @@ // license that can be found in the LICENSE file. //go:build aix && ppc64 -// +build aix,ppc64 package unix //sysnb Getrlimit(resource int, rlim *Rlimit) (err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Seek(fd int, offset int64, whence int) (off int64, err error) = lseek //sys mmap(addr uintptr, length uintptr, prot int, flags int, fd int, offset int64) (xaddr uintptr, err error) = mmap64 diff --git a/vendor/golang.org/x/sys/unix/syscall_bsd.go b/vendor/golang.org/x/sys/unix/syscall_bsd.go index 7705c327..a00c3e54 100644 --- a/vendor/golang.org/x/sys/unix/syscall_bsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_bsd.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build darwin || dragonfly || freebsd || netbsd || openbsd -// +build darwin dragonfly freebsd netbsd openbsd // BSD system call wrappers shared by *BSD based systems // including OS X (Darwin) and FreeBSD. Like the other @@ -317,7 +316,7 @@ func GetsockoptString(fd, level, opt int) (string, error) { if err != nil { return "", err } - return string(buf[:vallen-1]), nil + return ByteSliceToString(buf[:vallen]), nil } //sys recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) @@ -601,20 +600,6 @@ func Poll(fds []PollFd, timeout int) (n int, err error) { // Gethostuuid(uuid *byte, timeout *Timespec) (err error) // Ptrace(req int, pid int, addr uintptr, data int) (ret uintptr, err error) -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Madvise(b []byte, behav int) (err error) //sys Mlock(b []byte) (err error) //sys Mlockall(flags int) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin.go b/vendor/golang.org/x/sys/unix/syscall_darwin.go index 7064d6eb..59542a89 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin.go @@ -510,30 +510,36 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { return nil, err } - // Find size. - n := uintptr(0) - if err := sysctl(mib, nil, &n, nil, 0); err != nil { - return nil, err - } - if n == 0 { - return nil, nil - } - if n%SizeofKinfoProc != 0 { - return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) - } + for { + // Find size. + n := uintptr(0) + if err := sysctl(mib, nil, &n, nil, 0); err != nil { + return nil, err + } + if n == 0 { + return nil, nil + } + if n%SizeofKinfoProc != 0 { + return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) + } - // Read into buffer of that size. - buf := make([]KinfoProc, n/SizeofKinfoProc) - if err := sysctl(mib, (*byte)(unsafe.Pointer(&buf[0])), &n, nil, 0); err != nil { - return nil, err - } - if n%SizeofKinfoProc != 0 { - return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) - } + // Read into buffer of that size. + buf := make([]KinfoProc, n/SizeofKinfoProc) + if err := sysctl(mib, (*byte)(unsafe.Pointer(&buf[0])), &n, nil, 0); err != nil { + if err == ENOMEM { + // Process table grew. Try again. + continue + } + return nil, err + } + if n%SizeofKinfoProc != 0 { + return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc) + } - // The actual call may return less than the original reported required - // size so ensure we deal with that. - return buf[:n/SizeofKinfoProc], nil + // The actual call may return less than the original reported required + // size so ensure we deal with that. + return buf[:n/SizeofKinfoProc], nil + } } //sys sendfile(infd int, outfd int, offset int64, len *int64, hdtr unsafe.Pointer, flags int) (err error) @@ -613,6 +619,7 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { //sys Rmdir(path string) (err error) //sys Seek(fd int, offset int64, whence int) (newoffset int64, err error) = SYS_LSEEK //sys Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) +//sys Setattrlist(path string, attrlist *Attrlist, attrBuf []byte, options int) (err error) //sys Setegid(egid int) (err error) //sysnb Seteuid(euid int) (err error) //sysnb Setgid(gid int) (err error) @@ -622,7 +629,6 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { //sys Setprivexec(flag int) (err error) //sysnb Setregid(rgid int, egid int) (err error) //sysnb Setreuid(ruid int, euid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setsid() (pid int, err error) //sysnb Settimeofday(tp *Timeval) (err error) //sysnb Setuid(uid int) (err error) @@ -638,190 +644,3 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE - -/* - * Unimplemented - */ -// Profil -// Sigaction -// Sigprocmask -// Getlogin -// Sigpending -// Sigaltstack -// Ioctl -// Reboot -// Execve -// Vfork -// Sbrk -// Sstk -// Ovadvise -// Mincore -// Setitimer -// Swapon -// Select -// Sigsuspend -// Readv -// Writev -// Nfssvc -// Getfh -// Quotactl -// Csops -// Waitid -// Add_profil -// Kdebug_trace -// Sigreturn -// Atsocket -// Kqueue_from_portset_np -// Kqueue_portset -// Getattrlist -// Setattrlist -// Getdirentriesattr -// Searchfs -// Delete -// Copyfile -// Watchevent -// Waitevent -// Modwatch -// Fsctl -// Initgroups -// Posix_spawn -// Nfsclnt -// Fhopen -// Minherit -// Semsys -// Msgsys -// Shmsys -// Semctl -// Semget -// Semop -// Msgctl -// Msgget -// Msgsnd -// Msgrcv -// Shm_open -// Shm_unlink -// Sem_open -// Sem_close -// Sem_unlink -// Sem_wait -// Sem_trywait -// Sem_post -// Sem_getvalue -// Sem_init -// Sem_destroy -// Open_extended -// Umask_extended -// Stat_extended -// Lstat_extended -// Fstat_extended -// Chmod_extended -// Fchmod_extended -// Access_extended -// Settid -// Gettid -// Setsgroups -// Getsgroups -// Setwgroups -// Getwgroups -// Mkfifo_extended -// Mkdir_extended -// Identitysvc -// Shared_region_check_np -// Shared_region_map_np -// __pthread_mutex_destroy -// __pthread_mutex_init -// __pthread_mutex_lock -// __pthread_mutex_trylock -// __pthread_mutex_unlock -// __pthread_cond_init -// __pthread_cond_destroy -// __pthread_cond_broadcast -// __pthread_cond_signal -// Setsid_with_pid -// __pthread_cond_timedwait -// Aio_fsync -// Aio_return -// Aio_suspend -// Aio_cancel -// Aio_error -// Aio_read -// Aio_write -// Lio_listio -// __pthread_cond_wait -// Iopolicysys -// __pthread_kill -// __pthread_sigmask -// __sigwait -// __disable_threadsignal -// __pthread_markcancel -// __pthread_canceled -// __semwait_signal -// Proc_info -// sendfile -// Stat64_extended -// Lstat64_extended -// Fstat64_extended -// __pthread_chdir -// __pthread_fchdir -// Audit -// Auditon -// Getauid -// Setauid -// Getaudit -// Setaudit -// Getaudit_addr -// Setaudit_addr -// Auditctl -// Bsdthread_create -// Bsdthread_terminate -// Stack_snapshot -// Bsdthread_register -// Workq_open -// Workq_ops -// __mac_execve -// __mac_syscall -// __mac_get_file -// __mac_set_file -// __mac_get_link -// __mac_set_link -// __mac_get_proc -// __mac_set_proc -// __mac_get_fd -// __mac_set_fd -// __mac_get_pid -// __mac_get_lcid -// __mac_get_lctx -// __mac_set_lctx -// Setlcid -// Read_nocancel -// Write_nocancel -// Open_nocancel -// Close_nocancel -// Wait4_nocancel -// Recvmsg_nocancel -// Sendmsg_nocancel -// Recvfrom_nocancel -// Accept_nocancel -// Fcntl_nocancel -// Select_nocancel -// Fsync_nocancel -// Connect_nocancel -// Sigsuspend_nocancel -// Readv_nocancel -// Writev_nocancel -// Sendto_nocancel -// Pread_nocancel -// Pwrite_nocancel -// Waitid_nocancel -// Poll_nocancel -// Msgsnd_nocancel -// Msgrcv_nocancel -// Sem_wait_nocancel -// Aio_suspend_nocancel -// __sigwait_nocancel -// __semwait_signal_nocancel -// __mac_mount -// __mac_get_mount -// __mac_getfsstat diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go b/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go index 9fa87980..0eaecf5f 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && darwin -// +build amd64,darwin package unix @@ -47,6 +46,5 @@ func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, //sys getfsstat(buf unsafe.Pointer, size uintptr, flags int) (n int, err error) = SYS_GETFSSTAT64 //sys Lstat(path string, stat *Stat_t) (err error) = SYS_LSTAT64 //sys ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) = SYS_ptrace -//sys ptrace1Ptr(request int, pid int, addr unsafe.Pointer, data uintptr) (err error) = SYS_ptrace //sys Stat(path string, stat *Stat_t) (err error) = SYS_STAT64 //sys Statfs(path string, stat *Statfs_t) (err error) = SYS_STATFS64 diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go b/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go index f17b8c52..f36c6707 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm64 && darwin -// +build arm64,darwin package unix @@ -47,6 +46,5 @@ func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, //sys getfsstat(buf unsafe.Pointer, size uintptr, flags int) (n int, err error) = SYS_GETFSSTAT //sys Lstat(path string, stat *Stat_t) (err error) //sys ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) = SYS_ptrace -//sys ptrace1Ptr(request int, pid int, addr unsafe.Pointer, data uintptr) (err error) = SYS_ptrace //sys Stat(path string, stat *Stat_t) (err error) //sys Statfs(path string, stat *Statfs_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go b/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go index 53c96641..16dc6993 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build darwin && go1.12 -// +build darwin,go1.12 package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go b/vendor/golang.org/x/sys/unix/syscall_dragonfly.go index 221efc26..97cb916f 100644 --- a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go +++ b/vendor/golang.org/x/sys/unix/syscall_dragonfly.go @@ -326,7 +326,6 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sysnb Setreuid(ruid int, euid int) (err error) //sysnb Setresgid(rgid int, egid int, sgid int) (err error) //sysnb Setresuid(ruid int, euid int, suid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setsid() (pid int, err error) //sysnb Settimeofday(tp *Timeval) (err error) //sysnb Setuid(uid int) (err error) @@ -344,203 +343,5 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE //sys accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) //sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) - -/* - * Unimplemented - * TODO(jsing): Update this list for DragonFly. - */ -// Profil -// Sigaction -// Sigprocmask -// Getlogin -// Sigpending -// Sigaltstack -// Reboot -// Execve -// Vfork -// Sbrk -// Sstk -// Ovadvise -// Mincore -// Setitimer -// Swapon -// Select -// Sigsuspend -// Readv -// Writev -// Nfssvc -// Getfh -// Quotactl -// Mount -// Csops -// Waitid -// Add_profil -// Kdebug_trace -// Sigreturn -// Atsocket -// Kqueue_from_portset_np -// Kqueue_portset -// Getattrlist -// Setattrlist -// Getdirentriesattr -// Searchfs -// Delete -// Copyfile -// Watchevent -// Waitevent -// Modwatch -// Getxattr -// Fgetxattr -// Setxattr -// Fsetxattr -// Removexattr -// Fremovexattr -// Listxattr -// Flistxattr -// Fsctl -// Initgroups -// Posix_spawn -// Nfsclnt -// Fhopen -// Minherit -// Semsys -// Msgsys -// Shmsys -// Semctl -// Semget -// Semop -// Msgctl -// Msgget -// Msgsnd -// Msgrcv -// Shmat -// Shmctl -// Shmdt -// Shmget -// Shm_open -// Shm_unlink -// Sem_open -// Sem_close -// Sem_unlink -// Sem_wait -// Sem_trywait -// Sem_post -// Sem_getvalue -// Sem_init -// Sem_destroy -// Open_extended -// Umask_extended -// Stat_extended -// Lstat_extended -// Fstat_extended -// Chmod_extended -// Fchmod_extended -// Access_extended -// Settid -// Gettid -// Setsgroups -// Getsgroups -// Setwgroups -// Getwgroups -// Mkfifo_extended -// Mkdir_extended -// Identitysvc -// Shared_region_check_np -// Shared_region_map_np -// __pthread_mutex_destroy -// __pthread_mutex_init -// __pthread_mutex_lock -// __pthread_mutex_trylock -// __pthread_mutex_unlock -// __pthread_cond_init -// __pthread_cond_destroy -// __pthread_cond_broadcast -// __pthread_cond_signal -// Setsid_with_pid -// __pthread_cond_timedwait -// Aio_fsync -// Aio_return -// Aio_suspend -// Aio_cancel -// Aio_error -// Aio_read -// Aio_write -// Lio_listio -// __pthread_cond_wait -// Iopolicysys -// __pthread_kill -// __pthread_sigmask -// __sigwait -// __disable_threadsignal -// __pthread_markcancel -// __pthread_canceled -// __semwait_signal -// Proc_info -// Stat64_extended -// Lstat64_extended -// Fstat64_extended -// __pthread_chdir -// __pthread_fchdir -// Audit -// Auditon -// Getauid -// Setauid -// Getaudit -// Setaudit -// Getaudit_addr -// Setaudit_addr -// Auditctl -// Bsdthread_create -// Bsdthread_terminate -// Stack_snapshot -// Bsdthread_register -// Workq_open -// Workq_ops -// __mac_execve -// __mac_syscall -// __mac_get_file -// __mac_set_file -// __mac_get_link -// __mac_set_link -// __mac_get_proc -// __mac_set_proc -// __mac_get_fd -// __mac_set_fd -// __mac_get_pid -// __mac_get_lcid -// __mac_get_lctx -// __mac_set_lctx -// Setlcid -// Read_nocancel -// Write_nocancel -// Open_nocancel -// Close_nocancel -// Wait4_nocancel -// Recvmsg_nocancel -// Sendmsg_nocancel -// Recvfrom_nocancel -// Accept_nocancel -// Fcntl_nocancel -// Select_nocancel -// Fsync_nocancel -// Connect_nocancel -// Sigsuspend_nocancel -// Readv_nocancel -// Writev_nocancel -// Sendto_nocancel -// Pread_nocancel -// Pwrite_nocancel -// Waitid_nocancel -// Msgsnd_nocancel -// Msgrcv_nocancel -// Sem_wait_nocancel -// Aio_suspend_nocancel -// __sigwait_nocancel -// __semwait_signal_nocancel -// __mac_mount -// __mac_get_mount -// __mac_getfsstat diff --git a/vendor/golang.org/x/sys/unix/syscall_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/syscall_dragonfly_amd64.go index 4e2d3212..14bab6b2 100644 --- a/vendor/golang.org/x/sys/unix/syscall_dragonfly_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_dragonfly_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && dragonfly -// +build amd64,dragonfly package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd.go b/vendor/golang.org/x/sys/unix/syscall_freebsd.go index 5bdde03e..64d1bb4d 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd.go @@ -433,7 +433,6 @@ func Dup3(oldfd, newfd, flags int) error { //sysnb Setreuid(ruid int, euid int) (err error) //sysnb Setresgid(rgid int, egid int, sgid int) (err error) //sysnb Setresuid(ruid int, euid int, suid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setsid() (pid int, err error) //sysnb Settimeofday(tp *Timeval) (err error) //sysnb Setuid(uid int) (err error) @@ -450,197 +449,5 @@ func Dup3(oldfd, newfd, flags int) error { //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE //sys accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) //sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) - -/* - * Unimplemented - */ -// Profil -// Sigaction -// Sigprocmask -// Getlogin -// Sigpending -// Sigaltstack -// Ioctl -// Reboot -// Execve -// Vfork -// Sbrk -// Sstk -// Ovadvise -// Mincore -// Setitimer -// Swapon -// Select -// Sigsuspend -// Readv -// Writev -// Nfssvc -// Getfh -// Quotactl -// Mount -// Csops -// Waitid -// Add_profil -// Kdebug_trace -// Sigreturn -// Atsocket -// Kqueue_from_portset_np -// Kqueue_portset -// Getattrlist -// Setattrlist -// Getdents -// Getdirentriesattr -// Searchfs -// Delete -// Copyfile -// Watchevent -// Waitevent -// Modwatch -// Fsctl -// Initgroups -// Posix_spawn -// Nfsclnt -// Fhopen -// Minherit -// Semsys -// Msgsys -// Shmsys -// Semctl -// Semget -// Semop -// Msgctl -// Msgget -// Msgsnd -// Msgrcv -// Shmat -// Shmctl -// Shmdt -// Shmget -// Shm_open -// Shm_unlink -// Sem_open -// Sem_close -// Sem_unlink -// Sem_wait -// Sem_trywait -// Sem_post -// Sem_getvalue -// Sem_init -// Sem_destroy -// Open_extended -// Umask_extended -// Stat_extended -// Lstat_extended -// Fstat_extended -// Chmod_extended -// Fchmod_extended -// Access_extended -// Settid -// Gettid -// Setsgroups -// Getsgroups -// Setwgroups -// Getwgroups -// Mkfifo_extended -// Mkdir_extended -// Identitysvc -// Shared_region_check_np -// Shared_region_map_np -// __pthread_mutex_destroy -// __pthread_mutex_init -// __pthread_mutex_lock -// __pthread_mutex_trylock -// __pthread_mutex_unlock -// __pthread_cond_init -// __pthread_cond_destroy -// __pthread_cond_broadcast -// __pthread_cond_signal -// Setsid_with_pid -// __pthread_cond_timedwait -// Aio_fsync -// Aio_return -// Aio_suspend -// Aio_cancel -// Aio_error -// Aio_read -// Aio_write -// Lio_listio -// __pthread_cond_wait -// Iopolicysys -// __pthread_kill -// __pthread_sigmask -// __sigwait -// __disable_threadsignal -// __pthread_markcancel -// __pthread_canceled -// __semwait_signal -// Proc_info -// Stat64_extended -// Lstat64_extended -// Fstat64_extended -// __pthread_chdir -// __pthread_fchdir -// Audit -// Auditon -// Getauid -// Setauid -// Getaudit -// Setaudit -// Getaudit_addr -// Setaudit_addr -// Auditctl -// Bsdthread_create -// Bsdthread_terminate -// Stack_snapshot -// Bsdthread_register -// Workq_open -// Workq_ops -// __mac_execve -// __mac_syscall -// __mac_get_file -// __mac_set_file -// __mac_get_link -// __mac_set_link -// __mac_get_proc -// __mac_set_proc -// __mac_get_fd -// __mac_set_fd -// __mac_get_pid -// __mac_get_lcid -// __mac_get_lctx -// __mac_set_lctx -// Setlcid -// Read_nocancel -// Write_nocancel -// Open_nocancel -// Close_nocancel -// Wait4_nocancel -// Recvmsg_nocancel -// Sendmsg_nocancel -// Recvfrom_nocancel -// Accept_nocancel -// Fcntl_nocancel -// Select_nocancel -// Fsync_nocancel -// Connect_nocancel -// Sigsuspend_nocancel -// Readv_nocancel -// Writev_nocancel -// Sendto_nocancel -// Pread_nocancel -// Pwrite_nocancel -// Waitid_nocancel -// Poll_nocancel -// Msgsnd_nocancel -// Msgrcv_nocancel -// Sem_wait_nocancel -// Aio_suspend_nocancel -// __sigwait_nocancel -// __semwait_signal_nocancel -// __mac_mount -// __mac_get_mount -// __mac_getfsstat diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go index b8da5100..3967bca7 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build 386 && freebsd -// +build 386,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go index 47155c48..eff19ada 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && freebsd -// +build amd64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go index 08932093..4f24b517 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm && freebsd -// +build arm,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go index d151a0d0..ac30759e 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm64 && freebsd -// +build arm64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go index d5cd64b3..aab725ca 100644 --- a/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build riscv64 && freebsd -// +build riscv64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_hurd.go b/vendor/golang.org/x/sys/unix/syscall_hurd.go index 381fd467..ba46651f 100644 --- a/vendor/golang.org/x/sys/unix/syscall_hurd.go +++ b/vendor/golang.org/x/sys/unix/syscall_hurd.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build hurd -// +build hurd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_hurd_386.go b/vendor/golang.org/x/sys/unix/syscall_hurd_386.go index 7cf54a3e..df89f9e6 100644 --- a/vendor/golang.org/x/sys/unix/syscall_hurd_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_hurd_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build 386 && hurd -// +build 386,hurd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_illumos.go b/vendor/golang.org/x/sys/unix/syscall_illumos.go index 87db5a6a..a863f705 100644 --- a/vendor/golang.org/x/sys/unix/syscall_illumos.go +++ b/vendor/golang.org/x/sys/unix/syscall_illumos.go @@ -5,7 +5,6 @@ // illumos system calls not present on Solaris. //go:build amd64 && illumos -// +build amd64,illumos package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go index 97353315..0f85e29e 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux.go @@ -61,15 +61,23 @@ func FanotifyMark(fd int, flags uint, mask uint64, dirFd int, pathname string) ( } //sys fchmodat(dirfd int, path string, mode uint32) (err error) - -func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { - // Linux fchmodat doesn't support the flags parameter. Mimick glibc's behavior - // and check the flags. Otherwise the mode would be applied to the symlink - // destination which is not what the user expects. - if flags&^AT_SYMLINK_NOFOLLOW != 0 { - return EINVAL - } else if flags&AT_SYMLINK_NOFOLLOW != 0 { - return EOPNOTSUPP +//sys fchmodat2(dirfd int, path string, mode uint32, flags int) (err error) + +func Fchmodat(dirfd int, path string, mode uint32, flags int) error { + // Linux fchmodat doesn't support the flags parameter, but fchmodat2 does. + // Try fchmodat2 if flags are specified. + if flags != 0 { + err := fchmodat2(dirfd, path, mode, flags) + if err == ENOSYS { + // fchmodat2 isn't available. If the flags are known to be valid, + // return EOPNOTSUPP to indicate that fchmodat doesn't support them. + if flags&^(AT_SYMLINK_NOFOLLOW|AT_EMPTY_PATH) != 0 { + return EINVAL + } else if flags&(AT_SYMLINK_NOFOLLOW|AT_EMPTY_PATH) != 0 { + return EOPNOTSUPP + } + } + return err } return fchmodat(dirfd, path, mode) } @@ -417,7 +425,8 @@ func (sa *SockaddrUnix) sockaddr() (unsafe.Pointer, _Socklen, error) { if n > 0 { sl += _Socklen(n) + 1 } - if sa.raw.Path[0] == '@' { + if sa.raw.Path[0] == '@' || (sa.raw.Path[0] == 0 && sl > 3) { + // Check sl > 3 so we don't change unnamed socket behavior. sa.raw.Path[0] = 0 // Don't count trailing NUL for abstract address. sl-- @@ -693,10 +702,10 @@ type SockaddrALG struct { func (sa *SockaddrALG) sockaddr() (unsafe.Pointer, _Socklen, error) { // Leave room for NUL byte terminator. - if len(sa.Type) > 13 { + if len(sa.Type) > len(sa.raw.Type)-1 { return nil, 0, EINVAL } - if len(sa.Name) > 63 { + if len(sa.Name) > len(sa.raw.Name)-1 { return nil, 0, EINVAL } @@ -704,17 +713,8 @@ func (sa *SockaddrALG) sockaddr() (unsafe.Pointer, _Socklen, error) { sa.raw.Feat = sa.Feature sa.raw.Mask = sa.Mask - typ, err := ByteSliceFromString(sa.Type) - if err != nil { - return nil, 0, err - } - name, err := ByteSliceFromString(sa.Name) - if err != nil { - return nil, 0, err - } - - copy(sa.raw.Type[:], typ) - copy(sa.raw.Name[:], name) + copy(sa.raw.Type[:], sa.Type) + copy(sa.raw.Name[:], sa.Name) return unsafe.Pointer(&sa.raw), SizeofSockaddrALG, nil } @@ -1310,7 +1310,7 @@ func GetsockoptString(fd, level, opt int) (string, error) { return "", err } } - return string(buf[:vallen-1]), nil + return ByteSliceToString(buf[:vallen]), nil } func GetsockoptTpacketStats(fd, level, opt int) (*TpacketStats, error) { @@ -1699,12 +1699,23 @@ func PtracePokeUser(pid int, addr uintptr, data []byte) (count int, err error) { return ptracePoke(PTRACE_POKEUSR, PTRACE_PEEKUSR, pid, addr, data) } +// elfNT_PRSTATUS is a copy of the debug/elf.NT_PRSTATUS constant so +// x/sys/unix doesn't need to depend on debug/elf and thus +// compress/zlib, debug/dwarf, and other packages. +const elfNT_PRSTATUS = 1 + func PtraceGetRegs(pid int, regsout *PtraceRegs) (err error) { - return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout)) + var iov Iovec + iov.Base = (*byte)(unsafe.Pointer(regsout)) + iov.SetLen(int(unsafe.Sizeof(*regsout))) + return ptracePtr(PTRACE_GETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov)) } func PtraceSetRegs(pid int, regs *PtraceRegs) (err error) { - return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs)) + var iov Iovec + iov.Base = (*byte)(unsafe.Pointer(regs)) + iov.SetLen(int(unsafe.Sizeof(*regs))) + return ptracePtr(PTRACE_SETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov)) } func PtraceSetOptions(pid int, options int) (err error) { @@ -1873,9 +1884,8 @@ func Getpgrp() (pid int) { //sys OpenTree(dfd int, fileName string, flags uint) (r int, err error) //sys PerfEventOpen(attr *PerfEventAttr, pid int, cpu int, groupFd int, flags int) (fd int, err error) //sys PivotRoot(newroot string, putold string) (err error) = SYS_PIVOT_ROOT -//sysnb Prlimit(pid int, resource int, newlimit *Rlimit, old *Rlimit) (err error) = SYS_PRLIMIT64 //sys Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (err error) -//sys Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) = SYS_PSELECT6 +//sys pselect6(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *sigset_argpack) (n int, err error) //sys read(fd int, p []byte) (n int, err error) //sys Removexattr(path string, attr string) (err error) //sys Renameat2(olddirfd int, oldpath string, newdirfd int, newpath string, flags uint) (err error) @@ -1887,6 +1897,15 @@ func Getpgrp() (pid int) { //sysnb Settimeofday(tv *Timeval) (err error) //sys Setns(fd int, nstype int) (err error) +//go:linkname syscall_prlimit syscall.prlimit +func syscall_prlimit(pid, resource int, newlimit, old *syscall.Rlimit) error + +func Prlimit(pid, resource int, newlimit, old *Rlimit) error { + // Just call the syscall version, because as of Go 1.21 + // it will affect starting a new process. + return syscall_prlimit(pid, resource, (*syscall.Rlimit)(newlimit), (*syscall.Rlimit)(old)) +} + // PrctlRetInt performs a prctl operation specified by option and further // optional arguments arg2 through arg5 depending on option. It returns a // non-negative integer that is returned by the prctl syscall. @@ -1969,8 +1988,6 @@ func Signalfd(fd int, sigmask *Sigset_t, flags int) (newfd int, err error) { //sys Unshare(flags int) (err error) //sys write(fd int, p []byte) (n int, err error) //sys exitThread(code int) (err error) = SYS_EXIT -//sys readlen(fd int, p *byte, np int) (n int, err error) = SYS_READ -//sys writelen(fd int, p *byte, np int) (n int, err error) = SYS_WRITE //sys readv(fd int, iovs []Iovec) (n int, err error) = SYS_READV //sys writev(fd int, iovs []Iovec) (n int, err error) = SYS_WRITEV //sys preadv(fd int, iovs []Iovec, offs_l uintptr, offs_h uintptr) (n int, err error) = SYS_PREADV @@ -2105,21 +2122,7 @@ func writevRacedetect(iovecs []Iovec, n int) { // mmap varies by architecture; see syscall_linux_*.go. //sys munmap(addr uintptr, length uintptr) (err error) - -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - +//sys mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) //sys Madvise(b []byte, advice int) (err error) //sys Mprotect(b []byte, prot int) (err error) //sys Mlock(b []byte) (err error) @@ -2128,6 +2131,12 @@ func Munmap(b []byte) (err error) { //sys Munlock(b []byte) (err error) //sys Munlockall() (err error) +const ( + mremapFixed = MREMAP_FIXED + mremapDontunmap = MREMAP_DONTUNMAP + mremapMaymove = MREMAP_MAYMOVE +) + // Vmsplice splices user pages from a slice of Iovecs into a pipe specified by fd, // using the specified flags. func Vmsplice(fd int, iovs []Iovec, flags int) (int, error) { @@ -2412,99 +2421,75 @@ func PthreadSigmask(how int, set, oldset *Sigset_t) error { return rtSigprocmask(how, set, oldset, _C__NSIG/8) } -/* - * Unimplemented - */ -// AfsSyscall -// ArchPrctl -// Brk -// ClockNanosleep -// ClockSettime -// Clone -// EpollCtlOld -// EpollPwait -// EpollWaitOld -// Execve -// Fork -// Futex -// GetKernelSyms -// GetMempolicy -// GetRobustList -// GetThreadArea -// Getpmsg -// IoCancel -// IoDestroy -// IoGetevents -// IoSetup -// IoSubmit -// IoprioGet -// IoprioSet -// KexecLoad -// LookupDcookie -// Mbind -// MigratePages -// Mincore -// ModifyLdt -// Mount -// MovePages -// MqGetsetattr -// MqNotify -// MqOpen -// MqTimedreceive -// MqTimedsend -// MqUnlink -// Mremap -// Msgctl -// Msgget -// Msgrcv -// Msgsnd -// Nfsservctl -// Personality -// Pselect6 -// Ptrace -// Putpmsg -// Quotactl -// Readahead -// Readv -// RemapFilePages -// RestartSyscall -// RtSigaction -// RtSigpending -// RtSigqueueinfo -// RtSigreturn -// RtSigsuspend -// RtSigtimedwait -// SchedGetPriorityMax -// SchedGetPriorityMin -// SchedGetparam -// SchedGetscheduler -// SchedRrGetInterval -// SchedSetparam -// SchedYield -// Security -// Semctl -// Semget -// Semop -// Semtimedop -// SetMempolicy -// SetRobustList -// SetThreadArea -// SetTidAddress -// Sigaltstack -// Swapoff -// Swapon -// Sysfs -// TimerCreate -// TimerDelete -// TimerGetoverrun -// TimerGettime -// TimerSettime -// Tkill (obsolete) -// Tuxcall -// Umount2 -// Uselib -// Utimensat -// Vfork -// Vhangup -// Vserver -// _Sysctl +//sysnb getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) +//sysnb getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) + +func Getresuid() (ruid, euid, suid int) { + var r, e, s _C_int + getresuid(&r, &e, &s) + return int(r), int(e), int(s) +} + +func Getresgid() (rgid, egid, sgid int) { + var r, e, s _C_int + getresgid(&r, &e, &s) + return int(r), int(e), int(s) +} + +// Pselect is a wrapper around the Linux pselect6 system call. +// This version does not modify the timeout argument. +func Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { + // Per https://man7.org/linux/man-pages/man2/select.2.html#NOTES, + // The Linux pselect6() system call modifies its timeout argument. + // [Not modifying the argument] is the behavior required by POSIX.1-2001. + var mutableTimeout *Timespec + if timeout != nil { + mutableTimeout = new(Timespec) + *mutableTimeout = *timeout + } + + // The final argument of the pselect6() system call is not a + // sigset_t * pointer, but is instead a structure + var kernelMask *sigset_argpack + if sigmask != nil { + wordBits := 32 << (^uintptr(0) >> 63) // see math.intSize + + // A sigset stores one bit per signal, + // offset by 1 (because signal 0 does not exist). + // So the number of words needed is ⌈__C_NSIG - 1 / wordBits⌉. + sigsetWords := (_C__NSIG - 1 + wordBits - 1) / (wordBits) + + sigsetBytes := uintptr(sigsetWords * (wordBits / 8)) + kernelMask = &sigset_argpack{ + ss: sigmask, + ssLen: sigsetBytes, + } + } + + return pselect6(nfd, r, w, e, mutableTimeout, kernelMask) +} + +//sys schedSetattr(pid int, attr *SchedAttr, flags uint) (err error) +//sys schedGetattr(pid int, attr *SchedAttr, size uint, flags uint) (err error) + +// SchedSetAttr is a wrapper for sched_setattr(2) syscall. +// https://man7.org/linux/man-pages/man2/sched_setattr.2.html +func SchedSetAttr(pid int, attr *SchedAttr, flags uint) error { + if attr == nil { + return EINVAL + } + attr.Size = SizeofSchedAttr + return schedSetattr(pid, attr, flags) +} + +// SchedGetAttr is a wrapper for sched_getattr(2) syscall. +// https://man7.org/linux/man-pages/man2/sched_getattr.2.html +func SchedGetAttr(pid int, flags uint) (*SchedAttr, error) { + attr := &SchedAttr{} + if err := schedGetattr(pid, attr, SizeofSchedAttr, flags); err != nil { + return nil, err + } + return attr, nil +} + +//sys Cachestat(fd uint, crange *CachestatRange, cstat *Cachestat_t, flags uint) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_386.go b/vendor/golang.org/x/sys/unix/syscall_linux_386.go index ff5b5899..506dafa7 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build 386 && linux -// +build 386,linux package unix @@ -97,33 +96,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { return } -//sysnb setrlimit(resource int, rlim *rlimit32) (err error) = SYS_SETRLIMIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - err = Prlimit(0, resource, rlim, nil) - if err != ENOSYS { - return err - } - - rl := rlimit32{} - if rlim.Cur == rlimInf64 { - rl.Cur = rlimInf32 - } else if rlim.Cur < uint64(rlimInf32) { - rl.Cur = uint32(rlim.Cur) - } else { - return EINVAL - } - if rlim.Max == rlimInf64 { - rl.Max = rlimInf32 - } else if rlim.Max < uint64(rlimInf32) { - rl.Max = uint32(rlim.Max) - } else { - return EINVAL - } - - return setrlimit(resource, &rl) -} - func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { newoffset, errno := seek(fd, offset, whence) if errno != 0 { diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_alarm.go b/vendor/golang.org/x/sys/unix/syscall_linux_alarm.go index 08086ac6..38d55641 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_alarm.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_alarm.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (386 || amd64 || mips || mipsle || mips64 || mipsle || ppc64 || ppc64le || ppc || s390x || sparc64) -// +build linux -// +build 386 amd64 mips mipsle mips64 mipsle ppc64 ppc64le ppc s390x sparc64 package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go index 9b270353..d557cf8d 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && linux -// +build amd64,linux package unix @@ -40,13 +39,12 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_amd64_gc.go b/vendor/golang.org/x/sys/unix/syscall_linux_amd64_gc.go index 8b0f0f3a..facdb83b 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_amd64_gc.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_amd64_gc.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && linux && gc -// +build amd64,linux,gc package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_arm.go b/vendor/golang.org/x/sys/unix/syscall_linux_arm.go index 856ad1d6..cd2dd797 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_arm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm && linux -// +build arm,linux package unix @@ -171,33 +170,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { return } -//sysnb setrlimit(resource int, rlim *rlimit32) (err error) = SYS_SETRLIMIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - err = Prlimit(0, resource, rlim, nil) - if err != ENOSYS { - return err - } - - rl := rlimit32{} - if rlim.Cur == rlimInf64 { - rl.Cur = rlimInf32 - } else if rlim.Cur < uint64(rlimInf32) { - rl.Cur = uint32(rlim.Cur) - } else { - return EINVAL - } - if rlim.Max == rlimInf64 { - rl.Max = rlimInf32 - } else if rlim.Max < uint64(rlimInf32) { - rl.Max = uint32(rlim.Max) - } else { - return EINVAL - } - - return setrlimit(resource, &rl) -} - func (r *PtraceRegs) PC() uint64 { return uint64(r.Uregs[15]) } func (r *PtraceRegs) SetPC(pc uint64) { r.Uregs[15] = uint32(pc) } diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go index 6422704b..cf2ee6c7 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm64 && linux -// +build arm64,linux package unix @@ -33,13 +32,12 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb setrlimit(resource int, rlim *Rlimit) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) @@ -143,15 +141,6 @@ func Getrlimit(resource int, rlim *Rlimit) error { return getrlimit(resource, rlim) } -// Setrlimit prefers the prlimit64 system call. See issue 38604. -func Setrlimit(resource int, rlim *Rlimit) error { - err := Prlimit(0, resource, rlim, nil) - if err != ENOSYS { - return err - } - return setrlimit(resource, rlim) -} - func (r *PtraceRegs) PC() uint64 { return r.Pc } func (r *PtraceRegs) SetPC(pc uint64) { r.Pc = pc } diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gc.go b/vendor/golang.org/x/sys/unix/syscall_linux_gc.go index 2b1168d7..ffc4c2b6 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_gc.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_gc.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && gc -// +build linux,gc package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gc_386.go b/vendor/golang.org/x/sys/unix/syscall_linux_gc_386.go index 9843fb48..9ebfdcf4 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_gc_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_gc_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && gc && 386 -// +build linux,gc,386 package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gc_arm.go b/vendor/golang.org/x/sys/unix/syscall_linux_gc_arm.go index a6008fcc..5f2b57c4 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_gc_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_gc_arm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm && gc && linux -// +build arm,gc,linux package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_386.go b/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_386.go index 7740af24..d1a3ad82 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && gccgo && 386 -// +build linux,gccgo,386 package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_arm.go b/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_arm.go index e16a1229..f2f67423 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_arm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && gccgo && arm -// +build linux,gccgo,arm package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go index 59dab510..3d0e9845 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build loong64 && linux -// +build loong64,linux package unix @@ -28,7 +27,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) @@ -126,11 +125,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { return } -func Setrlimit(resource int, rlim *Rlimit) (err error) { - err = Prlimit(0, resource, rlim, nil) - return -} - func futimesat(dirfd int, path string, tv *[2]Timeval) (err error) { if tv == nil { return utimensat(dirfd, path, nil, 0) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go index bfef09a3..70963a95 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (mips64 || mips64le) -// +build linux -// +build mips64 mips64le package unix @@ -31,13 +29,12 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) //sys Statfs(path string, buf *Statfs_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go b/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go index ab302509..c218ebd2 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (mips || mipsle) -// +build linux -// +build mips mipsle package unix @@ -151,33 +149,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { return } -//sysnb setrlimit(resource int, rlim *rlimit32) (err error) = SYS_SETRLIMIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - err = Prlimit(0, resource, rlim, nil) - if err != ENOSYS { - return err - } - - rl := rlimit32{} - if rlim.Cur == rlimInf64 { - rl.Cur = rlimInf32 - } else if rlim.Cur < uint64(rlimInf32) { - rl.Cur = uint32(rlim.Cur) - } else { - return EINVAL - } - if rlim.Max == rlimInf64 { - rl.Max = rlimInf32 - } else if rlim.Max < uint64(rlimInf32) { - rl.Max = uint32(rlim.Max) - } else { - return EINVAL - } - - return setrlimit(resource, &rl) -} - func (r *PtraceRegs) PC() uint64 { return r.Epc } func (r *PtraceRegs) SetPC(pc uint64) { r.Epc = pc } diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go b/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go index eac1cf1a..e6c48500 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && ppc -// +build linux,ppc package unix @@ -159,33 +158,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { return } -//sysnb setrlimit(resource int, rlim *rlimit32) (err error) = SYS_SETRLIMIT - -func Setrlimit(resource int, rlim *Rlimit) (err error) { - err = Prlimit(0, resource, rlim, nil) - if err != ENOSYS { - return err - } - - rl := rlimit32{} - if rlim.Cur == rlimInf64 { - rl.Cur = rlimInf32 - } else if rlim.Cur < uint64(rlimInf32) { - rl.Cur = uint32(rlim.Cur) - } else { - return EINVAL - } - if rlim.Max == rlimInf64 { - rl.Max = rlimInf32 - } else if rlim.Max < uint64(rlimInf32) { - rl.Max = uint32(rlim.Max) - } else { - return EINVAL - } - - return setrlimit(resource, &rl) -} - func (r *PtraceRegs) PC() uint32 { return r.Nip } func (r *PtraceRegs) SetPC(pc uint32) { r.Nip = pc } diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go b/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go index 4df56616..7286a9aa 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (ppc64 || ppc64le) -// +build linux -// +build ppc64 ppc64le package unix @@ -34,7 +32,6 @@ package unix //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) //sys Stat(path string, stat *Stat_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go index 5f4243de..6f5a2889 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build riscv64 && linux -// +build riscv64,linux package unix @@ -32,13 +31,12 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err if timeout != nil { ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000} } - return Pselect(nfd, r, w, e, ts, nil) + return pselect6(nfd, r, w, e, ts, nil) } //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) @@ -178,3 +176,14 @@ func KexecFileLoad(kernelFd int, initrdFd int, cmdline string, flags int) error } return kexecFileLoad(kernelFd, initrdFd, cmdlineLen, cmdline, flags) } + +//sys riscvHWProbe(pairs []RISCVHWProbePairs, cpuCount uintptr, cpus *CPUSet, flags uint) (err error) + +func RISCVHWProbe(pairs []RISCVHWProbePairs, set *CPUSet, flags uint) (err error) { + var setSize uintptr + + if set != nil { + setSize = uintptr(unsafe.Sizeof(*set)) + } + return riscvHWProbe(pairs, setSize, set, flags) +} diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go b/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go index d0a7d406..66f31210 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build s390x && linux -// +build s390x,linux package unix @@ -34,7 +33,6 @@ import ( //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) //sys Stat(path string, stat *Stat_t) (err error) //sys Statfs(path string, buf *Statfs_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go b/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go index f5c793be..11d1f169 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build sparc64 && linux -// +build sparc64,linux package unix @@ -31,7 +30,6 @@ package unix //sys sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) //sys setfsgid(gid int) (prev int, err error) //sys setfsuid(uid int) (prev int, err error) -//sysnb Setrlimit(resource int, rlim *Rlimit) (err error) //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) //sys Stat(path string, stat *Stat_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd.go b/vendor/golang.org/x/sys/unix/syscall_netbsd.go index e66865dc..88162099 100644 --- a/vendor/golang.org/x/sys/unix/syscall_netbsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_netbsd.go @@ -340,7 +340,6 @@ func Statvfs(path string, buf *Statvfs_t) (err error) { //sys Setpriority(which int, who int, prio int) (err error) //sysnb Setregid(rgid int, egid int) (err error) //sysnb Setreuid(ruid int, euid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setsid() (pid int, err error) //sysnb Settimeofday(tp *Timeval) (err error) //sysnb Setuid(uid int) (err error) @@ -357,267 +356,16 @@ func Statvfs(path string, buf *Statvfs_t) (err error) { //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE //sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) -/* - * Unimplemented - */ -// ____semctl13 -// __clone -// __fhopen40 -// __fhstat40 -// __fhstatvfs140 -// __fstat30 -// __getcwd -// __getfh30 -// __getlogin -// __lstat30 -// __mount50 -// __msgctl13 -// __msync13 -// __ntp_gettime30 -// __posix_chown -// __posix_fchown -// __posix_lchown -// __posix_rename -// __setlogin -// __shmctl13 -// __sigaction_sigtramp -// __sigaltstack14 -// __sigpending14 -// __sigprocmask14 -// __sigsuspend14 -// __sigtimedwait -// __stat30 -// __syscall -// __vfork14 -// _ksem_close -// _ksem_destroy -// _ksem_getvalue -// _ksem_init -// _ksem_open -// _ksem_post -// _ksem_trywait -// _ksem_unlink -// _ksem_wait -// _lwp_continue -// _lwp_create -// _lwp_ctl -// _lwp_detach -// _lwp_exit -// _lwp_getname -// _lwp_getprivate -// _lwp_kill -// _lwp_park -// _lwp_self -// _lwp_setname -// _lwp_setprivate -// _lwp_suspend -// _lwp_unpark -// _lwp_unpark_all -// _lwp_wait -// _lwp_wakeup -// _pset_bind -// _sched_getaffinity -// _sched_getparam -// _sched_setaffinity -// _sched_setparam -// acct -// aio_cancel -// aio_error -// aio_fsync -// aio_read -// aio_return -// aio_suspend -// aio_write -// break -// clock_getres -// clock_gettime -// clock_settime -// compat_09_ogetdomainname -// compat_09_osetdomainname -// compat_09_ouname -// compat_10_omsgsys -// compat_10_osemsys -// compat_10_oshmsys -// compat_12_fstat12 -// compat_12_getdirentries -// compat_12_lstat12 -// compat_12_msync -// compat_12_oreboot -// compat_12_oswapon -// compat_12_stat12 -// compat_13_sigaction13 -// compat_13_sigaltstack13 -// compat_13_sigpending13 -// compat_13_sigprocmask13 -// compat_13_sigreturn13 -// compat_13_sigsuspend13 -// compat_14___semctl -// compat_14_msgctl -// compat_14_shmctl -// compat_16___sigaction14 -// compat_16___sigreturn14 -// compat_20_fhstatfs -// compat_20_fstatfs -// compat_20_getfsstat -// compat_20_statfs -// compat_30___fhstat30 -// compat_30___fstat13 -// compat_30___lstat13 -// compat_30___stat13 -// compat_30_fhopen -// compat_30_fhstat -// compat_30_fhstatvfs1 -// compat_30_getdents -// compat_30_getfh -// compat_30_ntp_gettime -// compat_30_socket -// compat_40_mount -// compat_43_fstat43 -// compat_43_lstat43 -// compat_43_oaccept -// compat_43_ocreat -// compat_43_oftruncate -// compat_43_ogetdirentries -// compat_43_ogetdtablesize -// compat_43_ogethostid -// compat_43_ogethostname -// compat_43_ogetkerninfo -// compat_43_ogetpagesize -// compat_43_ogetpeername -// compat_43_ogetrlimit -// compat_43_ogetsockname -// compat_43_okillpg -// compat_43_olseek -// compat_43_ommap -// compat_43_oquota -// compat_43_orecv -// compat_43_orecvfrom -// compat_43_orecvmsg -// compat_43_osend -// compat_43_osendmsg -// compat_43_osethostid -// compat_43_osethostname -// compat_43_osetrlimit -// compat_43_osigblock -// compat_43_osigsetmask -// compat_43_osigstack -// compat_43_osigvec -// compat_43_otruncate -// compat_43_owait -// compat_43_stat43 -// execve -// extattr_delete_fd -// extattr_delete_file -// extattr_delete_link -// extattr_get_fd -// extattr_get_file -// extattr_get_link -// extattr_list_fd -// extattr_list_file -// extattr_list_link -// extattr_set_fd -// extattr_set_file -// extattr_set_link -// extattrctl -// fchroot -// fdatasync -// fgetxattr -// fktrace -// flistxattr -// fork -// fremovexattr -// fsetxattr -// fstatvfs1 -// fsync_range -// getcontext -// getitimer -// getvfsstat -// getxattr -// ktrace -// lchflags -// lchmod -// lfs_bmapv -// lfs_markv -// lfs_segclean -// lfs_segwait -// lgetxattr -// lio_listio -// listxattr -// llistxattr -// lremovexattr -// lseek -// lsetxattr -// lutimes -// madvise -// mincore -// minherit -// modctl -// mq_close -// mq_getattr -// mq_notify -// mq_open -// mq_receive -// mq_send -// mq_setattr -// mq_timedreceive -// mq_timedsend -// mq_unlink -// mremap -// msgget -// msgrcv -// msgsnd -// nfssvc -// ntp_adjtime -// pmc_control -// pmc_get_info -// pollts -// preadv -// profil -// pselect -// pset_assign -// pset_create -// pset_destroy -// ptrace -// pwritev -// quotactl -// rasctl -// readv -// reboot -// removexattr -// sa_enable -// sa_preempt -// sa_register -// sa_setconcurrency -// sa_stacks -// sa_yield -// sbrk -// sched_yield -// semconfig -// semget -// semop -// setcontext -// setitimer -// setxattr -// shmat -// shmdt -// shmget -// sstk -// statvfs1 -// swapctl -// sysarch -// syscall -// timer_create -// timer_delete -// timer_getoverrun -// timer_gettime -// timer_settime -// undelete -// utrace -// uuidgen -// vadvise -// vfork -// writev +const ( + mremapFixed = MAP_FIXED + mremapDontunmap = 0 + mremapMaymove = 0 +) + +//sys mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) = SYS_MREMAP + +func mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (uintptr, error) { + return mremapNetBSD(oldaddr, oldlength, newaddr, newlength, flags) +} diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd_386.go b/vendor/golang.org/x/sys/unix/syscall_netbsd_386.go index 5199d282..7a5eb574 100644 --- a/vendor/golang.org/x/sys/unix/syscall_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_netbsd_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build 386 && netbsd -// +build 386,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/syscall_netbsd_amd64.go index 70a9c52e..62d8957a 100644 --- a/vendor/golang.org/x/sys/unix/syscall_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_netbsd_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && netbsd -// +build amd64,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd_arm.go b/vendor/golang.org/x/sys/unix/syscall_netbsd_arm.go index 3eb5942f..ce6a0688 100644 --- a/vendor/golang.org/x/sys/unix/syscall_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_netbsd_arm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm && netbsd -// +build arm,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/syscall_netbsd_arm64.go index fc6ccfd8..d46d689d 100644 --- a/vendor/golang.org/x/sys/unix/syscall_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_netbsd_arm64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm64 && netbsd -// +build arm64,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd.go b/vendor/golang.org/x/sys/unix/syscall_openbsd.go index 5e9de23a..b25343c7 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd.go @@ -137,18 +137,28 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e } func Getfsstat(buf []Statfs_t, flags int) (n int, err error) { - var _p0 unsafe.Pointer + var bufptr *Statfs_t var bufsize uintptr if len(buf) > 0 { - _p0 = unsafe.Pointer(&buf[0]) + bufptr = &buf[0] bufsize = unsafe.Sizeof(Statfs_t{}) * uintptr(len(buf)) } - r0, _, e1 := Syscall(SYS_GETFSSTAT, uintptr(_p0), bufsize, uintptr(flags)) - n = int(r0) - if e1 != 0 { - err = e1 - } - return + return getfsstat(bufptr, bufsize, flags) +} + +//sysnb getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) +//sysnb getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) + +func Getresuid() (ruid, euid, suid int) { + var r, e, s _C_int + getresuid(&r, &e, &s) + return int(r), int(e), int(s) +} + +func Getresgid() (rgid, egid, sgid int) { + var r, e, s _C_int + getresgid(&r, &e, &s) + return int(r), int(e), int(s) } //sys ioctl(fd int, req uint, arg uintptr) (err error) @@ -156,6 +166,20 @@ func Getfsstat(buf []Statfs_t, flags int) (n int, err error) { //sys sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) = SYS___SYSCTL +//sys fcntl(fd int, cmd int, arg int) (n int, err error) +//sys fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) = SYS_FCNTL + +// FcntlInt performs a fcntl syscall on fd with the provided command and argument. +func FcntlInt(fd uintptr, cmd, arg int) (int, error) { + return fcntl(int(fd), cmd, arg) +} + +// FcntlFlock performs a fcntl syscall for the F_GETLK, F_SETLK or F_SETLKW command. +func FcntlFlock(fd uintptr, cmd int, lk *Flock_t) error { + _, err := fcntlPtr(int(fd), cmd, unsafe.Pointer(lk)) + return err +} + //sys ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) func Ppoll(fds []PollFd, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { @@ -294,7 +318,6 @@ func Uname(uname *Utsname) error { //sysnb Setreuid(ruid int, euid int) (err error) //sysnb Setresgid(rgid int, egid int, sgid int) (err error) //sysnb Setresuid(ruid int, euid int, suid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setrtable(rtable int) (err error) //sysnb Setsid() (pid int, err error) //sysnb Settimeofday(tp *Timeval) (err error) @@ -312,80 +335,7 @@ func Uname(uname *Utsname) error { //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ -//sys writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE +//sys getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) //sys utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) - -/* - * Unimplemented - */ -// __getcwd -// __semctl -// __syscall -// __sysctl -// adjfreq -// break -// clock_getres -// clock_gettime -// clock_settime -// closefrom -// execve -// fhopen -// fhstat -// fhstatfs -// fork -// futimens -// getfh -// getgid -// getitimer -// getlogin -// getresgid -// getresuid -// getthrid -// ktrace -// lfs_bmapv -// lfs_markv -// lfs_segclean -// lfs_segwait -// mincore -// minherit -// mount -// mquery -// msgctl -// msgget -// msgrcv -// msgsnd -// nfssvc -// nnpfspioctl -// preadv -// profil -// pwritev -// quotactl -// readv -// reboot -// renameat -// rfork -// sched_yield -// semget -// semop -// setgroups -// setitimer -// setsockopt -// shmat -// shmctl -// shmdt -// shmget -// sigaction -// sigaltstack -// sigpending -// sigprocmask -// sigreturn -// sigsuspend -// sysarch -// syscall -// threxit -// thrsigdivert -// thrsleep -// thrwakeup -// vfork -// writev +//sys pledge(promises *byte, execpromises *byte) (err error) +//sys unveil(path *byte, flags *byte) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_386.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_386.go index 6baabcdc..9ddc89f4 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_386.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build 386 && openbsd -// +build 386,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_amd64.go index bab25360..70a3c96e 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && openbsd -// +build amd64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_arm.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_arm.go index 8eed3c4d..265caa87 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_arm.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm && openbsd -// +build arm,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_arm64.go index 483dde99..ac4fda17 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_arm64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build arm64 && openbsd -// +build arm64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go index 04aa43f4..0a451e6d 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build openbsd -// +build openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go index c2796139..30a308cb 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build ppc64 && openbsd -// +build ppc64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go index 23199a7f..ea954330 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build riscv64 && openbsd -// +build riscv64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_solaris.go b/vendor/golang.org/x/sys/unix/syscall_solaris.go index d3444b64..21974af0 100644 --- a/vendor/golang.org/x/sys/unix/syscall_solaris.go +++ b/vendor/golang.org/x/sys/unix/syscall_solaris.go @@ -128,7 +128,8 @@ func (sa *SockaddrUnix) sockaddr() (unsafe.Pointer, _Socklen, error) { if n > 0 { sl += _Socklen(n) + 1 } - if sa.raw.Path[0] == '@' { + if sa.raw.Path[0] == '@' || (sa.raw.Path[0] == 0 && sl > 3) { + // Check sl > 3 so we don't change unnamed socket behavior. sa.raw.Path[0] = 0 // Don't count trailing NUL for abstract address. sl-- @@ -157,7 +158,7 @@ func GetsockoptString(fd, level, opt int) (string, error) { if err != nil { return "", err } - return string(buf[:vallen-1]), nil + return ByteSliceToString(buf[:vallen]), nil } const ImplementsGetwd = true @@ -545,24 +546,24 @@ func Minor(dev uint64) uint32 { * Expose the ioctl function */ -//sys ioctlRet(fd int, req uint, arg uintptr) (ret int, err error) = libc.ioctl -//sys ioctlPtrRet(fd int, req uint, arg unsafe.Pointer) (ret int, err error) = libc.ioctl +//sys ioctlRet(fd int, req int, arg uintptr) (ret int, err error) = libc.ioctl +//sys ioctlPtrRet(fd int, req int, arg unsafe.Pointer) (ret int, err error) = libc.ioctl -func ioctl(fd int, req uint, arg uintptr) (err error) { +func ioctl(fd int, req int, arg uintptr) (err error) { _, err = ioctlRet(fd, req, arg) return err } -func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { +func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) { _, err = ioctlPtrRet(fd, req, arg) return err } -func IoctlSetTermio(fd int, req uint, value *Termio) error { +func IoctlSetTermio(fd int, req int, value *Termio) error { return ioctlPtr(fd, req, unsafe.Pointer(value)) } -func IoctlGetTermio(fd int, req uint) (*Termio, error) { +func IoctlGetTermio(fd int, req int) (*Termio, error) { var value Termio err := ioctlPtr(fd, req, unsafe.Pointer(&value)) return &value, err @@ -665,7 +666,6 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sys Setpriority(which int, who int, prio int) (err error) //sysnb Setregid(rgid int, egid int) (err error) //sysnb Setreuid(ruid int, euid int) (err error) -//sysnb Setrlimit(which int, lim *Rlimit) (err error) //sysnb Setsid() (pid int, err error) //sysnb Setuid(uid int) (err error) //sys Shutdown(s int, how int) (err error) = libsocket.shutdown @@ -699,38 +699,6 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sys setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) = libsocket.setsockopt //sys recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) = libsocket.recvfrom -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procread)), 3, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf), 0, 0, 0) - n = int(r0) - if e1 != 0 { - err = e1 - } - return -} - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwrite)), 3, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf), 0, 0, 0) - n = int(r0) - if e1 != 0 { - err = e1 - } - return -} - -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - // Event Ports type fileObjCookie struct { @@ -1080,11 +1048,11 @@ func Getmsg(fd int, cl []byte, data []byte) (retCl []byte, retData []byte, flags return retCl, retData, flags, nil } -func IoctlSetIntRetInt(fd int, req uint, arg int) (int, error) { +func IoctlSetIntRetInt(fd int, req int, arg int) (int, error) { return ioctlRet(fd, req, uintptr(arg)) } -func IoctlSetString(fd int, req uint, val string) error { +func IoctlSetString(fd int, req int, val string) error { bs := make([]byte, len(val)+1) copy(bs[:len(bs)-1], val) err := ioctlPtr(fd, req, unsafe.Pointer(&bs[0])) @@ -1120,7 +1088,7 @@ func (l *Lifreq) GetLifruUint() uint { return *(*uint)(unsafe.Pointer(&l.Lifru[0])) } -func IoctlLifreq(fd int, req uint, l *Lifreq) error { +func IoctlLifreq(fd int, req int, l *Lifreq) error { return ioctlPtr(fd, req, unsafe.Pointer(l)) } @@ -1131,6 +1099,6 @@ func (s *Strioctl) SetInt(i int) { s.Dp = (*int8)(unsafe.Pointer(&i)) } -func IoctlSetStrioctlRetInt(fd int, req uint, s *Strioctl) (int, error) { +func IoctlSetStrioctlRetInt(fd int, req int, s *Strioctl) (int, error) { return ioctlPtrRet(fd, req, unsafe.Pointer(s)) } diff --git a/vendor/golang.org/x/sys/unix/syscall_solaris_amd64.go b/vendor/golang.org/x/sys/unix/syscall_solaris_amd64.go index 0bd25ef8..e02d8cea 100644 --- a/vendor/golang.org/x/sys/unix/syscall_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_solaris_amd64.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build amd64 && solaris -// +build amd64,solaris package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_unix.go b/vendor/golang.org/x/sys/unix/syscall_unix.go index 00f0aa37..77081de8 100644 --- a/vendor/golang.org/x/sys/unix/syscall_unix.go +++ b/vendor/golang.org/x/sys/unix/syscall_unix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris package unix @@ -147,6 +146,14 @@ func (m *mmapper) Munmap(data []byte) (err error) { return nil } +func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { + return mapper.Mmap(fd, offset, length, prot, flags) +} + +func Munmap(b []byte) (err error) { + return mapper.Munmap(b) +} + func Read(fd int, p []byte) (n int, err error) { n, err = read(fd, p) if raceenabled { @@ -541,6 +548,9 @@ func SetNonblock(fd int, nonblocking bool) (err error) { if err != nil { return err } + if (flag&O_NONBLOCK != 0) == nonblocking { + return nil + } if nonblocking { flag |= O_NONBLOCK } else { @@ -587,3 +597,10 @@ func emptyIovecs(iov []Iovec) bool { } return true } + +// Setrlimit sets a resource limit. +func Setrlimit(resource int, rlim *Rlimit) error { + // Just call the syscall version, because as of Go 1.21 + // it will affect starting a new process. + return syscall.Setrlimit(resource, (*syscall.Rlimit)(rlim)) +} diff --git a/vendor/golang.org/x/sys/unix/syscall_unix_gc.go b/vendor/golang.org/x/sys/unix/syscall_unix_gc.go index b6919ca5..05c95bcc 100644 --- a/vendor/golang.org/x/sys/unix/syscall_unix_gc.go +++ b/vendor/golang.org/x/sys/unix/syscall_unix_gc.go @@ -3,8 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin || dragonfly || freebsd || (linux && !ppc64 && !ppc64le) || netbsd || openbsd || solaris) && gc -// +build darwin dragonfly freebsd linux,!ppc64,!ppc64le netbsd openbsd solaris -// +build gc package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_unix_gc_ppc64x.go b/vendor/golang.org/x/sys/unix/syscall_unix_gc_ppc64x.go index f6f707ac..23f39b7a 100644 --- a/vendor/golang.org/x/sys/unix/syscall_unix_gc_ppc64x.go +++ b/vendor/golang.org/x/sys/unix/syscall_unix_gc_ppc64x.go @@ -3,9 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux && (ppc64le || ppc64) && gc -// +build linux -// +build ppc64le ppc64 -// +build gc package unix diff --git a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go index b295497a..b473038c 100644 --- a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x package unix @@ -192,7 +191,6 @@ func (cmsg *Cmsghdr) SetLen(length int) { //sys fcntl(fd int, cmd int, arg int) (val int, err error) //sys read(fd int, p []byte) (n int, err error) -//sys readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ //sys write(fd int, p []byte) (n int, err error) //sys accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) = SYS___ACCEPT_A @@ -212,8 +210,8 @@ func (cmsg *Cmsghdr) SetLen(length int) { //sys sendmsg(s int, msg *Msghdr, flags int) (n int, err error) = SYS___SENDMSG_A //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) = SYS_MMAP //sys munmap(addr uintptr, length uintptr) (err error) = SYS_MUNMAP -//sys ioctl(fd int, req uint, arg uintptr) (err error) = SYS_IOCTL -//sys ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = SYS_IOCTL +//sys ioctl(fd int, req int, arg uintptr) (err error) = SYS_IOCTL +//sys ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) = SYS_IOCTL //sys Access(path string, mode uint32) (err error) = SYS___ACCESS_A //sys Chdir(path string) (err error) = SYS___CHDIR_A @@ -285,25 +283,11 @@ func Close(fd int) (err error) { return } -var mapper = &mmapper{ - active: make(map[*byte][]byte), - mmap: mmap, - munmap: munmap, -} - // Dummy function: there are no semantics for Madvise on z/OS func Madvise(b []byte, advice int) (err error) { return } -func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) { - return mapper.Mmap(fd, offset, length, prot, flags) -} - -func Munmap(b []byte) (err error) { - return mapper.Munmap(b) -} - //sys Gethostname(buf []byte) (err error) = SYS___GETHOSTNAME_A //sysnb Getegid() (egid int) //sysnb Geteuid() (uid int) @@ -1120,7 +1104,7 @@ func GetsockoptString(fd, level, opt int) (string, error) { return "", err } - return string(buf[:vallen-1]), nil + return ByteSliceToString(buf[:vallen]), nil } func Recvmsg(fd int, p, oob []byte, flags int) (n, oobn int, recvflags int, from Sockaddr, err error) { diff --git a/vendor/golang.org/x/sys/unix/sysvshm_linux.go b/vendor/golang.org/x/sys/unix/sysvshm_linux.go index 2c3a4437..4fcd38de 100644 --- a/vendor/golang.org/x/sys/unix/sysvshm_linux.go +++ b/vendor/golang.org/x/sys/unix/sysvshm_linux.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build linux -// +build linux package unix diff --git a/vendor/golang.org/x/sys/unix/sysvshm_unix.go b/vendor/golang.org/x/sys/unix/sysvshm_unix.go index 5bb41d17..79a84f18 100644 --- a/vendor/golang.org/x/sys/unix/sysvshm_unix.go +++ b/vendor/golang.org/x/sys/unix/sysvshm_unix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build (darwin && !ios) || linux -// +build darwin,!ios linux package unix diff --git a/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go b/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go index 71bddefd..9eb0db66 100644 --- a/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go +++ b/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build darwin && !ios -// +build darwin,!ios package unix diff --git a/vendor/golang.org/x/sys/unix/timestruct.go b/vendor/golang.org/x/sys/unix/timestruct.go index 616b1b28..7997b190 100644 --- a/vendor/golang.org/x/sys/unix/timestruct.go +++ b/vendor/golang.org/x/sys/unix/timestruct.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos package unix diff --git a/vendor/golang.org/x/sys/unix/unveil_openbsd.go b/vendor/golang.org/x/sys/unix/unveil_openbsd.go index 168d5ae7..cb7e598c 100644 --- a/vendor/golang.org/x/sys/unix/unveil_openbsd.go +++ b/vendor/golang.org/x/sys/unix/unveil_openbsd.go @@ -4,39 +4,48 @@ package unix -import ( - "syscall" - "unsafe" -) +import "fmt" // Unveil implements the unveil syscall. // For more information see unveil(2). // Note that the special case of blocking further // unveil calls is handled by UnveilBlock. func Unveil(path string, flags string) error { - pathPtr, err := syscall.BytePtrFromString(path) - if err != nil { + if err := supportsUnveil(); err != nil { return err } - flagsPtr, err := syscall.BytePtrFromString(flags) + pathPtr, err := BytePtrFromString(path) if err != nil { return err } - _, _, e := syscall.Syscall(SYS_UNVEIL, uintptr(unsafe.Pointer(pathPtr)), uintptr(unsafe.Pointer(flagsPtr)), 0) - if e != 0 { - return e + flagsPtr, err := BytePtrFromString(flags) + if err != nil { + return err } - return nil + return unveil(pathPtr, flagsPtr) } // UnveilBlock blocks future unveil calls. // For more information see unveil(2). func UnveilBlock() error { - // Both pointers must be nil. - var pathUnsafe, flagsUnsafe unsafe.Pointer - _, _, e := syscall.Syscall(SYS_UNVEIL, uintptr(pathUnsafe), uintptr(flagsUnsafe), 0) - if e != 0 { - return e + if err := supportsUnveil(); err != nil { + return err } + return unveil(nil, nil) +} + +// supportsUnveil checks for availability of the unveil(2) system call based +// on the running OpenBSD version. +func supportsUnveil() error { + maj, min, err := majmin() + if err != nil { + return err + } + + // unveil is not available before 6.4 + if maj < 6 || (maj == 6 && min <= 3) { + return fmt.Errorf("cannot call Unveil on OpenBSD %d.%d", maj, min) + } + return nil } diff --git a/vendor/golang.org/x/sys/unix/xattr_bsd.go b/vendor/golang.org/x/sys/unix/xattr_bsd.go index f5f8e9f3..e1687939 100644 --- a/vendor/golang.org/x/sys/unix/xattr_bsd.go +++ b/vendor/golang.org/x/sys/unix/xattr_bsd.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build freebsd || netbsd -// +build freebsd netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go index ca9799b7..2fb219d7 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && aix -// +build ppc,aix // Created by cgo -godefs - DO NOT EDIT // cgo -godefs -- -maix32 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go index 200c8c26..b0e6f5c8 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && aix -// +build ppc64,aix // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -maix64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go index 476a1c7e..e40fa852 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && darwin -// +build amd64,darwin // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go @@ -1270,6 +1269,16 @@ const ( SEEK_END = 0x2 SEEK_HOLE = 0x3 SEEK_SET = 0x0 + SF_APPEND = 0x40000 + SF_ARCHIVED = 0x10000 + SF_DATALESS = 0x40000000 + SF_FIRMLINK = 0x800000 + SF_IMMUTABLE = 0x20000 + SF_NOUNLINK = 0x100000 + SF_RESTRICTED = 0x80000 + SF_SETTABLE = 0x3fff0000 + SF_SUPPORTED = 0x9f0000 + SF_SYNTHETIC = 0xc0000000 SHUT_RD = 0x0 SHUT_RDWR = 0x2 SHUT_WR = 0x1 @@ -1543,6 +1552,15 @@ const ( TIOCTIMESTAMP = 0x40107459 TIOCUCNTL = 0x80047466 TOSTOP = 0x400000 + UF_APPEND = 0x4 + UF_COMPRESSED = 0x20 + UF_DATAVAULT = 0x80 + UF_HIDDEN = 0x8000 + UF_IMMUTABLE = 0x2 + UF_NODUMP = 0x1 + UF_OPAQUE = 0x8 + UF_SETTABLE = 0xffff + UF_TRACKED = 0x40 VDISCARD = 0xf VDSUSP = 0xb VEOF = 0x0 diff --git a/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go index e36f5178..bb02aa6c 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && darwin -// +build arm64,darwin // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go @@ -1270,6 +1269,16 @@ const ( SEEK_END = 0x2 SEEK_HOLE = 0x3 SEEK_SET = 0x0 + SF_APPEND = 0x40000 + SF_ARCHIVED = 0x10000 + SF_DATALESS = 0x40000000 + SF_FIRMLINK = 0x800000 + SF_IMMUTABLE = 0x20000 + SF_NOUNLINK = 0x100000 + SF_RESTRICTED = 0x80000 + SF_SETTABLE = 0x3fff0000 + SF_SUPPORTED = 0x9f0000 + SF_SYNTHETIC = 0xc0000000 SHUT_RD = 0x0 SHUT_RDWR = 0x2 SHUT_WR = 0x1 @@ -1543,6 +1552,15 @@ const ( TIOCTIMESTAMP = 0x40107459 TIOCUCNTL = 0x80047466 TOSTOP = 0x400000 + UF_APPEND = 0x4 + UF_COMPRESSED = 0x20 + UF_DATAVAULT = 0x80 + UF_HIDDEN = 0x8000 + UF_IMMUTABLE = 0x2 + UF_NODUMP = 0x1 + UF_OPAQUE = 0x8 + UF_SETTABLE = 0xffff + UF_TRACKED = 0x40 VDISCARD = 0xf VDSUSP = 0xb VEOF = 0x0 diff --git a/vendor/golang.org/x/sys/unix/zerrors_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_dragonfly_amd64.go index 17bba0e4..c0e0f869 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_dragonfly_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_dragonfly_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && dragonfly -// +build amd64,dragonfly // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go index f8c2c513..6c692390 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && freebsd -// +build 386,freebsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m32 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go index 96310c3b..dd9163f8 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && freebsd -// +build amd64,freebsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go index 777b69de..493a2a79 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && freebsd -// +build arm,freebsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go index c557ac2d..8b437b30 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && freebsd -// +build arm64,freebsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_riscv64.go index 341b4d96..67c02dd5 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && freebsd -// +build riscv64,freebsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux.go b/vendor/golang.org/x/sys/unix/zerrors_linux.go index 398c37e5..c73cfe2f 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux.go @@ -1,7 +1,6 @@ // Code generated by mkmerge; DO NOT EDIT. //go:build linux -// +build linux package unix @@ -481,10 +480,13 @@ const ( BPF_FROM_BE = 0x8 BPF_FROM_LE = 0x0 BPF_FS_MAGIC = 0xcafe4a11 + BPF_F_AFTER = 0x10 BPF_F_ALLOW_MULTI = 0x2 BPF_F_ALLOW_OVERRIDE = 0x1 BPF_F_ANY_ALIGNMENT = 0x2 - BPF_F_KPROBE_MULTI_RETURN = 0x1 + BPF_F_BEFORE = 0x8 + BPF_F_ID = 0x20 + BPF_F_NETFILTER_IP_DEFRAG = 0x1 BPF_F_QUERY_EFFECTIVE = 0x1 BPF_F_REPLACE = 0x4 BPF_F_SLEEPABLE = 0x10 @@ -493,6 +495,7 @@ const ( BPF_F_TEST_RUN_ON_CPU = 0x1 BPF_F_TEST_STATE_FREQ = 0x8 BPF_F_TEST_XDP_LIVE_FRAMES = 0x2 + BPF_F_XDP_DEV_BOUND_ONLY = 0x40 BPF_F_XDP_HAS_FRAGS = 0x20 BPF_H = 0x8 BPF_IMM = 0x0 @@ -520,6 +523,7 @@ const ( BPF_MAJOR_VERSION = 0x1 BPF_MAXINSNS = 0x1000 BPF_MEM = 0x60 + BPF_MEMSX = 0x80 BPF_MEMWORDS = 0x10 BPF_MINOR_VERSION = 0x1 BPF_MISC = 0x7 @@ -775,6 +779,8 @@ const ( DEVLINK_GENL_MCGRP_CONFIG_NAME = "config" DEVLINK_GENL_NAME = "devlink" DEVLINK_GENL_VERSION = 0x1 + DEVLINK_PORT_FN_CAP_IPSEC_CRYPTO = 0x4 + DEVLINK_PORT_FN_CAP_IPSEC_PACKET = 0x8 DEVLINK_PORT_FN_CAP_MIGRATABLE = 0x2 DEVLINK_PORT_FN_CAP_ROCE = 0x1 DEVLINK_SB_THRESHOLD_TO_ALPHA_MAX = 0x14 @@ -826,9 +832,9 @@ const ( DM_UUID_FLAG = 0x4000 DM_UUID_LEN = 0x81 DM_VERSION = 0xc138fd00 - DM_VERSION_EXTRA = "-ioctl (2022-07-28)" + DM_VERSION_EXTRA = "-ioctl (2023-03-01)" DM_VERSION_MAJOR = 0x4 - DM_VERSION_MINOR = 0x2f + DM_VERSION_MINOR = 0x30 DM_VERSION_PATCHLEVEL = 0x0 DT_BLK = 0x6 DT_CHR = 0x2 @@ -1197,6 +1203,7 @@ const ( FAN_EVENT_METADATA_LEN = 0x18 FAN_EVENT_ON_CHILD = 0x8000000 FAN_FS_ERROR = 0x8000 + FAN_INFO = 0x20 FAN_MARK_ADD = 0x1 FAN_MARK_DONT_FOLLOW = 0x4 FAN_MARK_EVICTABLE = 0x200 @@ -1233,6 +1240,8 @@ const ( FAN_REPORT_PIDFD = 0x80 FAN_REPORT_TARGET_FID = 0x1000 FAN_REPORT_TID = 0x100 + FAN_RESPONSE_INFO_AUDIT_RULE = 0x1 + FAN_RESPONSE_INFO_NONE = 0x0 FAN_UNLIMITED_MARKS = 0x20 FAN_UNLIMITED_QUEUE = 0x10 FD_CLOEXEC = 0x1 @@ -1694,6 +1703,7 @@ const ( KEXEC_ON_CRASH = 0x1 KEXEC_PRESERVE_CONTEXT = 0x2 KEXEC_SEGMENT_MAX = 0x10 + KEXEC_UPDATE_ELFCOREHDR = 0x4 KEYCTL_ASSUME_AUTHORITY = 0x10 KEYCTL_CAPABILITIES = 0x1f KEYCTL_CAPS0_BIG_KEY = 0x10 @@ -1791,6 +1801,7 @@ const ( LOCK_SH = 0x1 LOCK_UN = 0x8 LOOP_CLR_FD = 0x4c01 + LOOP_CONFIGURE = 0x4c0a LOOP_CTL_ADD = 0x4c80 LOOP_CTL_GET_FREE = 0x4c82 LOOP_CTL_REMOVE = 0x4c81 @@ -1860,6 +1871,7 @@ const ( MEMWRITEOOB64 = 0xc0184d15 MFD_ALLOW_SEALING = 0x2 MFD_CLOEXEC = 0x1 + MFD_EXEC = 0x10 MFD_HUGETLB = 0x4 MFD_HUGE_16GB = 0x88000000 MFD_HUGE_16MB = 0x60000000 @@ -1875,6 +1887,7 @@ const ( MFD_HUGE_8MB = 0x5c000000 MFD_HUGE_MASK = 0x3f MFD_HUGE_SHIFT = 0x1a + MFD_NOEXEC_SEAL = 0x8 MINIX2_SUPER_MAGIC = 0x2468 MINIX2_SUPER_MAGIC2 = 0x2478 MINIX3_SUPER_MAGIC = 0x4d5a @@ -1898,6 +1911,9 @@ const ( MOUNT_ATTR_SIZE_VER0 = 0x20 MOUNT_ATTR_STRICTATIME = 0x20 MOUNT_ATTR__ATIME = 0x70 + MREMAP_DONTUNMAP = 0x4 + MREMAP_FIXED = 0x2 + MREMAP_MAYMOVE = 0x1 MSDOS_SUPER_MAGIC = 0x4d44 MSG_BATCH = 0x40000 MSG_CMSG_CLOEXEC = 0x40000000 @@ -2204,6 +2220,7 @@ const ( PACKET_USER = 0x6 PACKET_VERSION = 0xa PACKET_VNET_HDR = 0xf + PACKET_VNET_HDR_SZ = 0x18 PARITY_CRC16_PR0 = 0x2 PARITY_CRC16_PR0_CCITT = 0x4 PARITY_CRC16_PR1 = 0x3 @@ -2221,6 +2238,7 @@ const ( PERF_ATTR_SIZE_VER5 = 0x70 PERF_ATTR_SIZE_VER6 = 0x78 PERF_ATTR_SIZE_VER7 = 0x80 + PERF_ATTR_SIZE_VER8 = 0x88 PERF_AUX_FLAG_COLLISION = 0x8 PERF_AUX_FLAG_CORESIGHT_FORMAT_CORESIGHT = 0x0 PERF_AUX_FLAG_CORESIGHT_FORMAT_RAW = 0x100 @@ -2264,6 +2282,7 @@ const ( PERF_MEM_LVLNUM_PMEM = 0xe PERF_MEM_LVLNUM_RAM = 0xd PERF_MEM_LVLNUM_SHIFT = 0x21 + PERF_MEM_LVLNUM_UNC = 0x8 PERF_MEM_LVL_HIT = 0x2 PERF_MEM_LVL_IO = 0x1000 PERF_MEM_LVL_L1 = 0x8 @@ -2361,6 +2380,7 @@ const ( PR_FP_EXC_UND = 0x40000 PR_FP_MODE_FR = 0x1 PR_FP_MODE_FRE = 0x2 + PR_GET_AUXV = 0x41555856 PR_GET_CHILD_SUBREAPER = 0x25 PR_GET_DUMPABLE = 0x3 PR_GET_ENDIAN = 0x13 @@ -2369,6 +2389,8 @@ const ( PR_GET_FP_MODE = 0x2e PR_GET_IO_FLUSHER = 0x3a PR_GET_KEEPCAPS = 0x7 + PR_GET_MDWE = 0x42 + PR_GET_MEMORY_MERGE = 0x44 PR_GET_NAME = 0x10 PR_GET_NO_NEW_PRIVS = 0x27 PR_GET_PDEATHSIG = 0x2 @@ -2389,6 +2411,7 @@ const ( PR_MCE_KILL_GET = 0x22 PR_MCE_KILL_LATE = 0x0 PR_MCE_KILL_SET = 0x1 + PR_MDWE_REFUSE_EXEC_GAIN = 0x1 PR_MPX_DISABLE_MANAGEMENT = 0x2c PR_MPX_ENABLE_MANAGEMENT = 0x2b PR_MTE_TAG_MASK = 0x7fff8 @@ -2406,6 +2429,15 @@ const ( PR_PAC_GET_ENABLED_KEYS = 0x3d PR_PAC_RESET_KEYS = 0x36 PR_PAC_SET_ENABLED_KEYS = 0x3c + PR_RISCV_V_GET_CONTROL = 0x46 + PR_RISCV_V_SET_CONTROL = 0x45 + PR_RISCV_V_VSTATE_CTRL_CUR_MASK = 0x3 + PR_RISCV_V_VSTATE_CTRL_DEFAULT = 0x0 + PR_RISCV_V_VSTATE_CTRL_INHERIT = 0x10 + PR_RISCV_V_VSTATE_CTRL_MASK = 0x1f + PR_RISCV_V_VSTATE_CTRL_NEXT_MASK = 0xc + PR_RISCV_V_VSTATE_CTRL_OFF = 0x1 + PR_RISCV_V_VSTATE_CTRL_ON = 0x2 PR_SCHED_CORE = 0x3e PR_SCHED_CORE_CREATE = 0x1 PR_SCHED_CORE_GET = 0x0 @@ -2423,6 +2455,8 @@ const ( PR_SET_FP_MODE = 0x2d PR_SET_IO_FLUSHER = 0x39 PR_SET_KEEPCAPS = 0x8 + PR_SET_MDWE = 0x41 + PR_SET_MEMORY_MERGE = 0x43 PR_SET_MM = 0x23 PR_SET_MM_ARG_END = 0x9 PR_SET_MM_ARG_START = 0x8 @@ -2506,6 +2540,7 @@ const ( PTRACE_GETSIGMASK = 0x420a PTRACE_GET_RSEQ_CONFIGURATION = 0x420f PTRACE_GET_SYSCALL_INFO = 0x420e + PTRACE_GET_SYSCALL_USER_DISPATCH_CONFIG = 0x4211 PTRACE_INTERRUPT = 0x4207 PTRACE_KILL = 0x8 PTRACE_LISTEN = 0x4208 @@ -2536,6 +2571,7 @@ const ( PTRACE_SETREGSET = 0x4205 PTRACE_SETSIGINFO = 0x4203 PTRACE_SETSIGMASK = 0x420b + PTRACE_SET_SYSCALL_USER_DISPATCH_CONFIG = 0x4210 PTRACE_SINGLESTEP = 0x9 PTRACE_SYSCALL = 0x18 PTRACE_SYSCALL_INFO_ENTRY = 0x1 @@ -2802,6 +2838,23 @@ const ( RWF_SUPPORTED = 0x1f RWF_SYNC = 0x4 RWF_WRITE_LIFE_NOT_SET = 0x0 + SCHED_BATCH = 0x3 + SCHED_DEADLINE = 0x6 + SCHED_FIFO = 0x1 + SCHED_FLAG_ALL = 0x7f + SCHED_FLAG_DL_OVERRUN = 0x4 + SCHED_FLAG_KEEP_ALL = 0x18 + SCHED_FLAG_KEEP_PARAMS = 0x10 + SCHED_FLAG_KEEP_POLICY = 0x8 + SCHED_FLAG_RECLAIM = 0x2 + SCHED_FLAG_RESET_ON_FORK = 0x1 + SCHED_FLAG_UTIL_CLAMP = 0x60 + SCHED_FLAG_UTIL_CLAMP_MAX = 0x40 + SCHED_FLAG_UTIL_CLAMP_MIN = 0x20 + SCHED_IDLE = 0x5 + SCHED_NORMAL = 0x0 + SCHED_RESET_ON_FORK = 0x40000000 + SCHED_RR = 0x2 SCM_CREDENTIALS = 0x2 SCM_RIGHTS = 0x1 SCM_TIMESTAMP = 0x1d @@ -2967,6 +3020,7 @@ const ( SOL_TCP = 0x6 SOL_TIPC = 0x10f SOL_TLS = 0x11a + SOL_UDP = 0x11 SOL_X25 = 0x106 SOL_XDP = 0x11b SOMAXCONN = 0x1000 @@ -3071,7 +3125,7 @@ const ( TASKSTATS_GENL_NAME = "TASKSTATS" TASKSTATS_GENL_VERSION = 0x1 TASKSTATS_TYPE_MAX = 0x6 - TASKSTATS_VERSION = 0xd + TASKSTATS_VERSION = 0xe TCIFLUSH = 0x0 TCIOFF = 0x2 TCIOFLUSH = 0x2 @@ -3237,6 +3291,7 @@ const ( TP_STATUS_COPY = 0x2 TP_STATUS_CSUMNOTREADY = 0x8 TP_STATUS_CSUM_VALID = 0x80 + TP_STATUS_GSO_TCP = 0x100 TP_STATUS_KERNEL = 0x0 TP_STATUS_LOSING = 0x4 TP_STATUS_SENDING = 0x2 @@ -3251,6 +3306,19 @@ const ( TRACEFS_MAGIC = 0x74726163 TS_COMM_LEN = 0x20 UDF_SUPER_MAGIC = 0x15013346 + UDP_CORK = 0x1 + UDP_ENCAP = 0x64 + UDP_ENCAP_ESPINUDP = 0x2 + UDP_ENCAP_ESPINUDP_NON_IKE = 0x1 + UDP_ENCAP_GTP0 = 0x4 + UDP_ENCAP_GTP1U = 0x5 + UDP_ENCAP_L2TPINUDP = 0x3 + UDP_GRO = 0x68 + UDP_NO_CHECK6_RX = 0x66 + UDP_NO_CHECK6_TX = 0x65 + UDP_SEGMENT = 0x67 + UDP_V4_FLOW = 0x2 + UDP_V6_FLOW = 0x6 UMOUNT_NOFOLLOW = 0x8 USBDEVICE_SUPER_MAGIC = 0x9fa2 UTIME_NOW = 0x3fffffff @@ -3401,6 +3469,7 @@ const ( XDP_PACKET_HEADROOM = 0x100 XDP_PGOFF_RX_RING = 0x0 XDP_PGOFF_TX_RING = 0x80000000 + XDP_PKT_CONTD = 0x1 XDP_RING_NEED_WAKEUP = 0x1 XDP_RX_RING = 0x2 XDP_SHARED_UMEM = 0x1 @@ -3413,6 +3482,7 @@ const ( XDP_UMEM_REG = 0x4 XDP_UMEM_UNALIGNED_CHUNK_FLAG = 0x1 XDP_USE_NEED_WAKEUP = 0x8 + XDP_USE_SG = 0x10 XDP_ZEROCOPY = 0x4 XENFS_SUPER_MAGIC = 0xabba1974 XFS_SUPER_MAGIC = 0x58465342 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go index a46df0f1..4920821c 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && linux -// +build 386,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/386/include -m32 _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80041270 BLKBSZSET = 0x40041271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80041272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +325,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go index 6cd4a3ea..a0c1e411 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && linux -// +build amd64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/amd64/include -m64 _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -318,10 +326,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go index c7ebee24..c6398556 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && linux -// +build arm,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/arm/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80041270 BLKBSZSET = 0x40041271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80041272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -324,10 +332,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go index 9d5352c3..47cc62e2 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && linux -// +build arm64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/arm64/include -fsigned-char _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -314,10 +322,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 @@ -443,6 +453,7 @@ const ( TIOCSWINSZ = 0x5414 TIOCVHANGUP = 0x5437 TOSTOP = 0x100 + TPIDR2_MAGIC = 0x54504902 TUNATTACHFILTER = 0x401054d5 TUNDETACHFILTER = 0x401054d6 TUNGETDEVNETNS = 0x54e3 @@ -515,6 +526,7 @@ const ( XCASE = 0x4 XTABS = 0x1800 ZA_MAGIC = 0x54366345 + ZT_MAGIC = 0x5a544e01 _HIDIOCGRAWNAME = 0x80804804 _HIDIOCGRAWPHYS = 0x80404805 _HIDIOCGRAWUNIQ = 0x80404808 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go index f26a164f..27ac4a09 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build loong64 && linux -// +build loong64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/loong64/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -109,6 +117,9 @@ const ( IUCLC = 0x200 IXOFF = 0x1000 IXON = 0x400 + LASX_CTX_MAGIC = 0x41535801 + LBT_CTX_MAGIC = 0x42540001 + LSX_CTX_MAGIC = 0x53580001 MAP_ANON = 0x20 MAP_ANONYMOUS = 0x20 MAP_DENYWRITE = 0x800 @@ -308,10 +319,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go index 890bc3c9..54694642 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips && linux -// +build mips,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/mips/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +325,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0x100 SO_PASSCRED = 0x11 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x12 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x1028 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go index 549f26ac..3adb81d7 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && linux -// +build mips64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/mips64/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +325,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0x100 SO_PASSCRED = 0x11 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x12 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x1028 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go index e0365e32..2dfe98f0 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64le && linux -// +build mips64le,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/mips64le/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +325,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0x100 SO_PASSCRED = 0x11 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x12 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x1028 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go index fdccce15..f5398f84 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mipsle && linux -// +build mipsle,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/mipsle/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -317,10 +325,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0x100 SO_PASSCRED = 0x11 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x12 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x1028 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go index b2205c83..c54f152d 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && linux -// +build ppc,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/ppc/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40041270 BLKBSZSET = 0x80041271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40041272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 @@ -372,10 +380,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x14 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x15 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go index 81aa5ad0..76057dc7 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && linux -// +build ppc64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/ppc64/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 @@ -376,10 +384,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x14 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x15 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go index 76807a1f..e0c3725e 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64le && linux -// +build ppc64le,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/ppc64le/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x10 B576000 = 0x15 B921600 = 0x16 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1f BS1 = 0x8000 BSDLY = 0x8000 @@ -376,10 +384,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x14 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x15 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go index d4a5ab9e..18f2813e 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && linux -// +build riscv64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/riscv64/include _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -219,6 +227,9 @@ const ( PPPIOCUNBRIDGECHAN = 0x7434 PPPIOCXFERUNIT = 0x744e PR_SET_PTRACER_ANY = 0xffffffffffffffff + PTRACE_GETFDPIC = 0x21 + PTRACE_GETFDPIC_EXEC = 0x0 + PTRACE_GETFDPIC_INTERP = 0x1 RLIMIT_AS = 0x9 RLIMIT_MEMLOCK = 0x8 RLIMIT_NOFILE = 0x7 @@ -305,10 +316,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go index 66e65db9..11619d4e 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build s390x && linux -// +build s390x,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/s390x/include -fsigned-char _const.go @@ -27,22 +26,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x127a BLKBSZGET = 0x80081270 BLKBSZSET = 0x40081271 + BLKDISCARD = 0x1277 + BLKDISCARDZEROES = 0x127c BLKFLSBUF = 0x1261 BLKFRAGET = 0x1265 BLKFRASET = 0x1264 + BLKGETDISKSEQ = 0x80081280 BLKGETSIZE = 0x1260 BLKGETSIZE64 = 0x80081272 + BLKIOMIN = 0x1278 + BLKIOOPT = 0x1279 BLKPBSZGET = 0x127b BLKRAGET = 0x1263 BLKRASET = 0x1262 BLKROGET = 0x125e BLKROSET = 0x125d + BLKROTATIONAL = 0x127e BLKRRPART = 0x125f + BLKSECDISCARD = 0x127d BLKSECTGET = 0x1267 BLKSECTSET = 0x1266 BLKSSZGET = 0x1268 + BLKZEROOUT = 0x127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -380,10 +388,12 @@ const ( SO_NOFCS = 0x2b SO_OOBINLINE = 0xa SO_PASSCRED = 0x10 + SO_PASSPIDFD = 0x4c SO_PASSSEC = 0x22 SO_PEEK_OFF = 0x2a SO_PEERCRED = 0x11 SO_PEERGROUPS = 0x3b + SO_PEERPIDFD = 0x4d SO_PEERSEC = 0x1f SO_PREFER_BUSY_POLL = 0x45 SO_PROTOCOL = 0x26 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go index f6192526..396d994d 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build sparc64 && linux -// +build sparc64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -Wall -Werror -static -I/tmp/sparc64/include _const.go @@ -30,22 +29,31 @@ const ( B57600 = 0x1001 B576000 = 0x1006 B921600 = 0x1007 + BLKALIGNOFF = 0x2000127a BLKBSZGET = 0x40081270 BLKBSZSET = 0x80081271 + BLKDISCARD = 0x20001277 + BLKDISCARDZEROES = 0x2000127c BLKFLSBUF = 0x20001261 BLKFRAGET = 0x20001265 BLKFRASET = 0x20001264 + BLKGETDISKSEQ = 0x40081280 BLKGETSIZE = 0x20001260 BLKGETSIZE64 = 0x40081272 + BLKIOMIN = 0x20001278 + BLKIOOPT = 0x20001279 BLKPBSZGET = 0x2000127b BLKRAGET = 0x20001263 BLKRASET = 0x20001262 BLKROGET = 0x2000125e BLKROSET = 0x2000125d + BLKROTATIONAL = 0x2000127e BLKRRPART = 0x2000125f + BLKSECDISCARD = 0x2000127d BLKSECTGET = 0x20001267 BLKSECTSET = 0x20001266 BLKSSZGET = 0x20001268 + BLKZEROOUT = 0x2000127f BOTHER = 0x1000 BS1 = 0x2000 BSDLY = 0x2000 @@ -329,6 +337,54 @@ const ( SCM_WIFI_STATUS = 0x25 SFD_CLOEXEC = 0x400000 SFD_NONBLOCK = 0x4000 + SF_FP = 0x38 + SF_I0 = 0x20 + SF_I1 = 0x24 + SF_I2 = 0x28 + SF_I3 = 0x2c + SF_I4 = 0x30 + SF_I5 = 0x34 + SF_L0 = 0x0 + SF_L1 = 0x4 + SF_L2 = 0x8 + SF_L3 = 0xc + SF_L4 = 0x10 + SF_L5 = 0x14 + SF_L6 = 0x18 + SF_L7 = 0x1c + SF_PC = 0x3c + SF_RETP = 0x40 + SF_V9_FP = 0x70 + SF_V9_I0 = 0x40 + SF_V9_I1 = 0x48 + SF_V9_I2 = 0x50 + SF_V9_I3 = 0x58 + SF_V9_I4 = 0x60 + SF_V9_I5 = 0x68 + SF_V9_L0 = 0x0 + SF_V9_L1 = 0x8 + SF_V9_L2 = 0x10 + SF_V9_L3 = 0x18 + SF_V9_L4 = 0x20 + SF_V9_L5 = 0x28 + SF_V9_L6 = 0x30 + SF_V9_L7 = 0x38 + SF_V9_PC = 0x78 + SF_V9_RETP = 0x80 + SF_V9_XARG0 = 0x88 + SF_V9_XARG1 = 0x90 + SF_V9_XARG2 = 0x98 + SF_V9_XARG3 = 0xa0 + SF_V9_XARG4 = 0xa8 + SF_V9_XARG5 = 0xb0 + SF_V9_XXARG = 0xb8 + SF_XARG0 = 0x44 + SF_XARG1 = 0x48 + SF_XARG2 = 0x4c + SF_XARG3 = 0x50 + SF_XARG4 = 0x54 + SF_XARG5 = 0x58 + SF_XXARG = 0x5c SIOCATMARK = 0x8905 SIOCGPGRP = 0x8904 SIOCGSTAMPNS_NEW = 0x40108907 @@ -371,10 +427,12 @@ const ( SO_NOFCS = 0x27 SO_OOBINLINE = 0x100 SO_PASSCRED = 0x2 + SO_PASSPIDFD = 0x55 SO_PASSSEC = 0x1f SO_PEEK_OFF = 0x26 SO_PEERCRED = 0x40 SO_PEERGROUPS = 0x3d + SO_PEERPIDFD = 0x56 SO_PEERSEC = 0x1e SO_PREFER_BUSY_POLL = 0x48 SO_PROTOCOL = 0x1028 diff --git a/vendor/golang.org/x/sys/unix/zerrors_netbsd_386.go b/vendor/golang.org/x/sys/unix/zerrors_netbsd_386.go index 72f7420d..130085df 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_netbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && netbsd -// +build 386,netbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m32 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_netbsd_amd64.go index 8d4eb0c0..84769a1a 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_netbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && netbsd -// +build amd64,netbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm.go b/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm.go index 9eef9749..602ded00 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && netbsd -// +build arm,netbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -marm _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm64.go index 3b62ba19..efc0406e 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && netbsd -// +build arm64,netbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go index af20e474..5a6500f8 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && openbsd -// +build 386,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m32 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go index 6015fcb2..a5aeeb97 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && openbsd -// +build amd64,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go index 8d44955e..0e9748a7 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && openbsd -// +build arm,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go index ae16fe75..4f4449ab 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && openbsd -// +build arm64,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go index 03d90fe3..76a363f0 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && openbsd -// +build mips64,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go index 8e2c51b1..43ca0cdf 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && openbsd -// +build ppc64,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go index 13d40303..b1b8bb20 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && openbsd -// +build riscv64,openbsd // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_solaris_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_solaris_amd64.go index 1afee6a0..d2ddd317 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_solaris_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && solaris -// +build amd64,solaris // Code generated by cmd/cgo -godefs; DO NOT EDIT. // cgo -godefs -- -m64 _const.go diff --git a/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go b/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go index fc7d0506..4dfd2e05 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x // Hand edited based on zerrors_linux_s390x.go // TODO: auto-generate. diff --git a/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go b/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go index 97f20ca2..586317c7 100644 --- a/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go +++ b/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go @@ -1,8 +1,6 @@ // Code generated by linux/mkall.go generatePtracePair("arm", "arm64"). DO NOT EDIT. //go:build linux && (arm || arm64) -// +build linux -// +build arm arm64 package unix diff --git a/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go b/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go index 0b5f7943..d7c881be 100644 --- a/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go +++ b/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go @@ -1,8 +1,6 @@ // Code generated by linux/mkall.go generatePtracePair("mips", "mips64"). DO NOT EDIT. //go:build linux && (mips || mips64) -// +build linux -// +build mips mips64 package unix diff --git a/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go b/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go index 2807f7e6..2d2de5d2 100644 --- a/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go +++ b/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go @@ -1,8 +1,6 @@ // Code generated by linux/mkall.go generatePtracePair("mipsle", "mips64le"). DO NOT EDIT. //go:build linux && (mipsle || mips64le) -// +build linux -// +build mipsle mips64le package unix diff --git a/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go b/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go index 281ea64e..5adc79fb 100644 --- a/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go +++ b/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go @@ -1,8 +1,6 @@ // Code generated by linux/mkall.go generatePtracePair("386", "amd64"). DO NOT EDIT. //go:build linux && (386 || amd64) -// +build linux -// +build 386 amd64 package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go index ef9dcd1b..6ea64a3c 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build aix && ppc -// +build aix,ppc package unix @@ -124,7 +123,6 @@ int utime(uintptr_t, uintptr_t); unsigned long long getsystemcfg(int); int umount(uintptr_t); int getrlimit64(int, uintptr_t); -int setrlimit64(int, uintptr_t); long long lseek64(int, long long, int); uintptr_t mmap(uintptr_t, uintptr_t, int, int, int, long long); @@ -213,7 +211,7 @@ func wait4(pid Pid_t, status *_C_int, options int, rusage *Rusage) (wpid Pid_t, // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctl(fd int, req uint, arg uintptr) (err error) { +func ioctl(fd int, req int, arg uintptr) (err error) { r0, er := C.ioctl(C.int(fd), C.int(req), C.uintptr_t(arg)) if r0 == -1 && er != nil { err = er @@ -223,7 +221,7 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { +func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) { r0, er := C.ioctl(C.int(fd), C.int(req), C.uintptr_t(uintptr(arg))) if r0 == -1 && er != nil { err = er @@ -818,28 +816,6 @@ func write(fd int, p []byte) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, p *byte, np int) (n int, err error) { - r0, er := C.read(C.int(fd), C.uintptr_t(uintptr(unsafe.Pointer(p))), C.size_t(np)) - n = int(r0) - if r0 == -1 && er != nil { - err = er - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, p *byte, np int) (n int, err error) { - r0, er := C.write(C.int(fd), C.uintptr_t(uintptr(unsafe.Pointer(p))), C.size_t(np)) - n = int(r0) - if r0 == -1 && er != nil { - err = er - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Dup2(oldfd int, newfd int) (err error) { r0, er := C.dup2(C.int(oldfd), C.int(newfd)) if r0 == -1 && er != nil { @@ -1464,16 +1440,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - r0, er := C.setrlimit64(C.int(resource), C.uintptr_t(uintptr(unsafe.Pointer(rlim)))) - if r0 == -1 && er != nil { - err = er - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Seek(fd int, offset int64, whence int) (off int64, err error) { r0, er := C.lseek64(C.int(fd), C.longlong(offset), C.int(whence)) off = int64(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go index f86a9459..99ee4399 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build aix && ppc64 -// +build aix,ppc64 package unix @@ -93,8 +92,8 @@ func wait4(pid Pid_t, status *_C_int, options int, rusage *Rusage) (wpid Pid_t, // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctl(fd int, req uint, arg uintptr) (err error) { - _, e1 := callioctl(fd, int(req), arg) +func ioctl(fd int, req int, arg uintptr) (err error) { + _, e1 := callioctl(fd, req, arg) if e1 != 0 { err = errnoErr(e1) } @@ -103,8 +102,8 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { - _, e1 := callioctl_ptr(fd, int(req), arg) +func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) { + _, e1 := callioctl_ptr(fd, req, arg) if e1 != 0 { err = errnoErr(e1) } @@ -762,28 +761,6 @@ func write(fd int, p []byte) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, p *byte, np int) (n int, err error) { - r0, e1 := callread(fd, uintptr(unsafe.Pointer(p)), np) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, p *byte, np int) (n int, err error) { - r0, e1 := callwrite(fd, uintptr(unsafe.Pointer(p)), np) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Dup2(oldfd int, newfd int) (err error) { _, e1 := calldup2(oldfd, newfd) if e1 != 0 { @@ -1422,16 +1399,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, e1 := callsetrlimit(resource, uintptr(unsafe.Pointer(rlim))) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Seek(fd int, offset int64, whence int) (off int64, err error) { r0, e1 := calllseek(fd, offset, whence) off = int64(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go index d32a84ca..b68a7836 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build aix && ppc64 && gc -// +build aix,ppc64,gc package unix @@ -124,7 +123,6 @@ import ( //go:cgo_import_dynamic libc_getsystemcfg getsystemcfg "libc.a/shr_64.o" //go:cgo_import_dynamic libc_umount umount "libc.a/shr_64.o" //go:cgo_import_dynamic libc_getrlimit getrlimit "libc.a/shr_64.o" -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.a/shr_64.o" //go:cgo_import_dynamic libc_lseek lseek "libc.a/shr_64.o" //go:cgo_import_dynamic libc_mmap64 mmap64 "libc.a/shr_64.o" @@ -242,7 +240,6 @@ import ( //go:linkname libc_getsystemcfg libc_getsystemcfg //go:linkname libc_umount libc_umount //go:linkname libc_getrlimit libc_getrlimit -//go:linkname libc_setrlimit libc_setrlimit //go:linkname libc_lseek libc_lseek //go:linkname libc_mmap64 libc_mmap64 @@ -363,7 +360,6 @@ var ( libc_getsystemcfg, libc_umount, libc_getrlimit, - libc_setrlimit, libc_lseek, libc_mmap64 syscallFunc ) @@ -1179,13 +1175,6 @@ func callgetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func callsetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) { - r1, _, e1 = rawSyscall6(uintptr(unsafe.Pointer(&libc_setrlimit)), 2, uintptr(resource), rlim, 0, 0, 0, 0) - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func calllseek(fd int, offset int64, whence int) (r1 uintptr, e1 Errno) { r1, _, e1 = syscall6(uintptr(unsafe.Pointer(&libc_lseek)), 3, uintptr(fd), uintptr(offset), uintptr(whence), 0, 0, 0) return diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go index d7d8baf8..0a87450b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build aix && ppc64 && gccgo -// +build aix,ppc64,gccgo package unix @@ -123,7 +122,6 @@ int utime(uintptr_t, uintptr_t); unsigned long long getsystemcfg(int); int umount(uintptr_t); int getrlimit(int, uintptr_t); -int setrlimit(int, uintptr_t); long long lseek(int, long long, int); uintptr_t mmap64(uintptr_t, uintptr_t, int, int, int, long long); @@ -131,6 +129,7 @@ uintptr_t mmap64(uintptr_t, uintptr_t, int, int, int, long long); import "C" import ( "syscall" + "unsafe" ) // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -1055,14 +1054,6 @@ func callgetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func callsetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) { - r1 = uintptr(C.setrlimit(C.int(resource), C.uintptr_t(rlim))) - e1 = syscall.GetErrno() - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func calllseek(fd int, offset int64, whence int) (r1 uintptr, e1 Errno) { r1 = uintptr(C.lseek(C.int(fd), C.longlong(offset), C.int(whence))) e1 = syscall.GetErrno() diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go index a29ffdd5..ccb02f24 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build darwin && amd64 -// +build darwin,amd64 package unix @@ -725,6 +724,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -733,10 +738,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "/usr/lib/libSystem.B.dylib" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -1992,6 +1993,31 @@ var libc_select_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func Setattrlist(path string, attrlist *Attrlist, attrBuf []byte, options int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(attrBuf) > 0 { + _p1 = unsafe.Pointer(&attrBuf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall6(libc_setattrlist_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(attrlist)), uintptr(_p1), uintptr(len(attrBuf)), uintptr(options), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setattrlist_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setattrlist setattrlist "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Setegid(egid int) (err error) { _, _, e1 := syscall_syscall(libc_setegid_trampoline_addr, uintptr(egid), 0, 0) if e1 != 0 { @@ -2123,20 +2149,6 @@ var libc_setreuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "/usr/lib/libSystem.B.dylib" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := syscall_rawSyscall(libc_setsid_trampoline_addr, 0, 0, 0) pid = int(r0) @@ -2399,28 +2411,6 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fstat(fd int, stat *Stat_t) (err error) { _, _, e1 := syscall_syscall(libc_fstat64_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { @@ -2510,14 +2500,6 @@ func ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) { return } -func ptrace1Ptr(request int, pid int, addr uintptr, data unsafe.Pointer) (err error) { - _, _, e1 := syscall_syscall6(libc_ptrace_trampoline_addr, uintptr(request), uintptr(pid), addr, uintptr(data), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - var libc_ptrace_trampoline_addr uintptr //go:cgo_import_dynamic libc_ptrace ptrace "/usr/lib/libSystem.B.dylib" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s index 95fe4c0e..8b8bb284 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s @@ -5,900 +5,750 @@ TEXT libc_fdopendir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fdopendir(SB) - GLOBL ·libc_fdopendir_trampoline_addr(SB), RODATA, $8 DATA ·libc_fdopendir_trampoline_addr(SB)/8, $libc_fdopendir_trampoline<>(SB) TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgroups(SB) - GLOBL ·libc_getgroups_trampoline_addr(SB), RODATA, $8 DATA ·libc_getgroups_trampoline_addr(SB)/8, $libc_getgroups_trampoline<>(SB) TEXT libc_setgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setgroups(SB) - GLOBL ·libc_setgroups_trampoline_addr(SB), RODATA, $8 DATA ·libc_setgroups_trampoline_addr(SB)/8, $libc_setgroups_trampoline<>(SB) TEXT libc_wait4_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_wait4(SB) - GLOBL ·libc_wait4_trampoline_addr(SB), RODATA, $8 DATA ·libc_wait4_trampoline_addr(SB)/8, $libc_wait4_trampoline<>(SB) TEXT libc_accept_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_accept(SB) - GLOBL ·libc_accept_trampoline_addr(SB), RODATA, $8 DATA ·libc_accept_trampoline_addr(SB)/8, $libc_accept_trampoline<>(SB) TEXT libc_bind_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_bind(SB) - GLOBL ·libc_bind_trampoline_addr(SB), RODATA, $8 DATA ·libc_bind_trampoline_addr(SB)/8, $libc_bind_trampoline<>(SB) TEXT libc_connect_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_connect(SB) - GLOBL ·libc_connect_trampoline_addr(SB), RODATA, $8 DATA ·libc_connect_trampoline_addr(SB)/8, $libc_connect_trampoline<>(SB) TEXT libc_socket_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_socket(SB) - GLOBL ·libc_socket_trampoline_addr(SB), RODATA, $8 DATA ·libc_socket_trampoline_addr(SB)/8, $libc_socket_trampoline<>(SB) TEXT libc_getsockopt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsockopt(SB) - GLOBL ·libc_getsockopt_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsockopt_trampoline_addr(SB)/8, $libc_getsockopt_trampoline<>(SB) TEXT libc_setsockopt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsockopt(SB) - GLOBL ·libc_setsockopt_trampoline_addr(SB), RODATA, $8 DATA ·libc_setsockopt_trampoline_addr(SB)/8, $libc_setsockopt_trampoline<>(SB) TEXT libc_getpeername_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpeername(SB) - GLOBL ·libc_getpeername_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpeername_trampoline_addr(SB)/8, $libc_getpeername_trampoline<>(SB) TEXT libc_getsockname_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsockname(SB) - GLOBL ·libc_getsockname_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsockname_trampoline_addr(SB)/8, $libc_getsockname_trampoline<>(SB) TEXT libc_shutdown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shutdown(SB) - GLOBL ·libc_shutdown_trampoline_addr(SB), RODATA, $8 DATA ·libc_shutdown_trampoline_addr(SB)/8, $libc_shutdown_trampoline<>(SB) TEXT libc_socketpair_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_socketpair(SB) - GLOBL ·libc_socketpair_trampoline_addr(SB), RODATA, $8 DATA ·libc_socketpair_trampoline_addr(SB)/8, $libc_socketpair_trampoline<>(SB) TEXT libc_recvfrom_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_recvfrom(SB) - GLOBL ·libc_recvfrom_trampoline_addr(SB), RODATA, $8 DATA ·libc_recvfrom_trampoline_addr(SB)/8, $libc_recvfrom_trampoline<>(SB) TEXT libc_sendto_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendto(SB) - GLOBL ·libc_sendto_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendto_trampoline_addr(SB)/8, $libc_sendto_trampoline<>(SB) TEXT libc_recvmsg_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_recvmsg(SB) - GLOBL ·libc_recvmsg_trampoline_addr(SB), RODATA, $8 DATA ·libc_recvmsg_trampoline_addr(SB)/8, $libc_recvmsg_trampoline<>(SB) TEXT libc_sendmsg_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendmsg(SB) - GLOBL ·libc_sendmsg_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendmsg_trampoline_addr(SB)/8, $libc_sendmsg_trampoline<>(SB) TEXT libc_kevent_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kevent(SB) - GLOBL ·libc_kevent_trampoline_addr(SB), RODATA, $8 DATA ·libc_kevent_trampoline_addr(SB)/8, $libc_kevent_trampoline<>(SB) TEXT libc_utimes_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimes(SB) - GLOBL ·libc_utimes_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimes_trampoline_addr(SB)/8, $libc_utimes_trampoline<>(SB) TEXT libc_futimes_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_futimes(SB) - GLOBL ·libc_futimes_trampoline_addr(SB), RODATA, $8 DATA ·libc_futimes_trampoline_addr(SB)/8, $libc_futimes_trampoline<>(SB) TEXT libc_poll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_poll(SB) - GLOBL ·libc_poll_trampoline_addr(SB), RODATA, $8 DATA ·libc_poll_trampoline_addr(SB)/8, $libc_poll_trampoline<>(SB) TEXT libc_madvise_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_madvise(SB) - GLOBL ·libc_madvise_trampoline_addr(SB), RODATA, $8 DATA ·libc_madvise_trampoline_addr(SB)/8, $libc_madvise_trampoline<>(SB) TEXT libc_mlock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mlock(SB) - GLOBL ·libc_mlock_trampoline_addr(SB), RODATA, $8 DATA ·libc_mlock_trampoline_addr(SB)/8, $libc_mlock_trampoline<>(SB) TEXT libc_mlockall_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mlockall(SB) - GLOBL ·libc_mlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_mlockall_trampoline_addr(SB)/8, $libc_mlockall_trampoline<>(SB) TEXT libc_mprotect_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mprotect(SB) - GLOBL ·libc_mprotect_trampoline_addr(SB), RODATA, $8 DATA ·libc_mprotect_trampoline_addr(SB)/8, $libc_mprotect_trampoline<>(SB) TEXT libc_msync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_msync(SB) - GLOBL ·libc_msync_trampoline_addr(SB), RODATA, $8 DATA ·libc_msync_trampoline_addr(SB)/8, $libc_msync_trampoline<>(SB) TEXT libc_munlock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munlock(SB) - GLOBL ·libc_munlock_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlock_trampoline_addr(SB)/8, $libc_munlock_trampoline<>(SB) TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munlockall(SB) - GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB) TEXT libc_closedir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_closedir(SB) - GLOBL ·libc_closedir_trampoline_addr(SB), RODATA, $8 DATA ·libc_closedir_trampoline_addr(SB)/8, $libc_closedir_trampoline<>(SB) TEXT libc_readdir_r_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readdir_r(SB) - GLOBL ·libc_readdir_r_trampoline_addr(SB), RODATA, $8 DATA ·libc_readdir_r_trampoline_addr(SB)/8, $libc_readdir_r_trampoline<>(SB) TEXT libc_pipe_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pipe(SB) - GLOBL ·libc_pipe_trampoline_addr(SB), RODATA, $8 DATA ·libc_pipe_trampoline_addr(SB)/8, $libc_pipe_trampoline<>(SB) TEXT libc_getxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getxattr(SB) - GLOBL ·libc_getxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_getxattr_trampoline_addr(SB)/8, $libc_getxattr_trampoline<>(SB) TEXT libc_fgetxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fgetxattr(SB) - GLOBL ·libc_fgetxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fgetxattr_trampoline_addr(SB)/8, $libc_fgetxattr_trampoline<>(SB) TEXT libc_setxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setxattr(SB) - GLOBL ·libc_setxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_setxattr_trampoline_addr(SB)/8, $libc_setxattr_trampoline<>(SB) TEXT libc_fsetxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fsetxattr(SB) - GLOBL ·libc_fsetxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fsetxattr_trampoline_addr(SB)/8, $libc_fsetxattr_trampoline<>(SB) TEXT libc_removexattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_removexattr(SB) - GLOBL ·libc_removexattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_removexattr_trampoline_addr(SB)/8, $libc_removexattr_trampoline<>(SB) TEXT libc_fremovexattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fremovexattr(SB) - GLOBL ·libc_fremovexattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fremovexattr_trampoline_addr(SB)/8, $libc_fremovexattr_trampoline<>(SB) TEXT libc_listxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_listxattr(SB) - GLOBL ·libc_listxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_listxattr_trampoline_addr(SB)/8, $libc_listxattr_trampoline<>(SB) TEXT libc_flistxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_flistxattr(SB) - GLOBL ·libc_flistxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_flistxattr_trampoline_addr(SB)/8, $libc_flistxattr_trampoline<>(SB) TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) - GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fcntl(SB) - GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) TEXT libc_kill_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kill(SB) - GLOBL ·libc_kill_trampoline_addr(SB), RODATA, $8 DATA ·libc_kill_trampoline_addr(SB)/8, $libc_kill_trampoline<>(SB) TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) - GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_ioctl_trampoline_addr(SB)/8, $libc_ioctl_trampoline<>(SB) TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sysctl(SB) - GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) TEXT libc_sendfile_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendfile(SB) - GLOBL ·libc_sendfile_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendfile_trampoline_addr(SB)/8, $libc_sendfile_trampoline<>(SB) TEXT libc_shmat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmat(SB) - GLOBL ·libc_shmat_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmat_trampoline_addr(SB)/8, $libc_shmat_trampoline<>(SB) TEXT libc_shmctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmctl(SB) - GLOBL ·libc_shmctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmctl_trampoline_addr(SB)/8, $libc_shmctl_trampoline<>(SB) TEXT libc_shmdt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmdt(SB) - GLOBL ·libc_shmdt_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmdt_trampoline_addr(SB)/8, $libc_shmdt_trampoline<>(SB) TEXT libc_shmget_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmget(SB) - GLOBL ·libc_shmget_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmget_trampoline_addr(SB)/8, $libc_shmget_trampoline<>(SB) TEXT libc_access_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_access(SB) - GLOBL ·libc_access_trampoline_addr(SB), RODATA, $8 DATA ·libc_access_trampoline_addr(SB)/8, $libc_access_trampoline<>(SB) TEXT libc_adjtime_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_adjtime(SB) - GLOBL ·libc_adjtime_trampoline_addr(SB), RODATA, $8 DATA ·libc_adjtime_trampoline_addr(SB)/8, $libc_adjtime_trampoline<>(SB) TEXT libc_chdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chdir(SB) - GLOBL ·libc_chdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_chdir_trampoline_addr(SB)/8, $libc_chdir_trampoline<>(SB) TEXT libc_chflags_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chflags(SB) - GLOBL ·libc_chflags_trampoline_addr(SB), RODATA, $8 DATA ·libc_chflags_trampoline_addr(SB)/8, $libc_chflags_trampoline<>(SB) TEXT libc_chmod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chmod(SB) - GLOBL ·libc_chmod_trampoline_addr(SB), RODATA, $8 DATA ·libc_chmod_trampoline_addr(SB)/8, $libc_chmod_trampoline<>(SB) TEXT libc_chown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chown(SB) - GLOBL ·libc_chown_trampoline_addr(SB), RODATA, $8 DATA ·libc_chown_trampoline_addr(SB)/8, $libc_chown_trampoline<>(SB) TEXT libc_chroot_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chroot(SB) - GLOBL ·libc_chroot_trampoline_addr(SB), RODATA, $8 DATA ·libc_chroot_trampoline_addr(SB)/8, $libc_chroot_trampoline<>(SB) TEXT libc_clock_gettime_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clock_gettime(SB) - GLOBL ·libc_clock_gettime_trampoline_addr(SB), RODATA, $8 DATA ·libc_clock_gettime_trampoline_addr(SB)/8, $libc_clock_gettime_trampoline<>(SB) TEXT libc_close_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_close(SB) - GLOBL ·libc_close_trampoline_addr(SB), RODATA, $8 DATA ·libc_close_trampoline_addr(SB)/8, $libc_close_trampoline<>(SB) TEXT libc_clonefile_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clonefile(SB) - GLOBL ·libc_clonefile_trampoline_addr(SB), RODATA, $8 DATA ·libc_clonefile_trampoline_addr(SB)/8, $libc_clonefile_trampoline<>(SB) TEXT libc_clonefileat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clonefileat(SB) - GLOBL ·libc_clonefileat_trampoline_addr(SB), RODATA, $8 DATA ·libc_clonefileat_trampoline_addr(SB)/8, $libc_clonefileat_trampoline<>(SB) TEXT libc_dup_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_dup(SB) - GLOBL ·libc_dup_trampoline_addr(SB), RODATA, $8 DATA ·libc_dup_trampoline_addr(SB)/8, $libc_dup_trampoline<>(SB) TEXT libc_dup2_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_dup2(SB) - GLOBL ·libc_dup2_trampoline_addr(SB), RODATA, $8 DATA ·libc_dup2_trampoline_addr(SB)/8, $libc_dup2_trampoline<>(SB) TEXT libc_exchangedata_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_exchangedata(SB) - GLOBL ·libc_exchangedata_trampoline_addr(SB), RODATA, $8 DATA ·libc_exchangedata_trampoline_addr(SB)/8, $libc_exchangedata_trampoline<>(SB) TEXT libc_exit_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_exit(SB) - GLOBL ·libc_exit_trampoline_addr(SB), RODATA, $8 DATA ·libc_exit_trampoline_addr(SB)/8, $libc_exit_trampoline<>(SB) TEXT libc_faccessat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_faccessat(SB) - GLOBL ·libc_faccessat_trampoline_addr(SB), RODATA, $8 DATA ·libc_faccessat_trampoline_addr(SB)/8, $libc_faccessat_trampoline<>(SB) TEXT libc_fchdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchdir(SB) - GLOBL ·libc_fchdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchdir_trampoline_addr(SB)/8, $libc_fchdir_trampoline<>(SB) TEXT libc_fchflags_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchflags(SB) - GLOBL ·libc_fchflags_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchflags_trampoline_addr(SB)/8, $libc_fchflags_trampoline<>(SB) TEXT libc_fchmod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchmod(SB) - GLOBL ·libc_fchmod_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchmod_trampoline_addr(SB)/8, $libc_fchmod_trampoline<>(SB) TEXT libc_fchmodat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchmodat(SB) - GLOBL ·libc_fchmodat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchmodat_trampoline_addr(SB)/8, $libc_fchmodat_trampoline<>(SB) TEXT libc_fchown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchown(SB) - GLOBL ·libc_fchown_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchown_trampoline_addr(SB)/8, $libc_fchown_trampoline<>(SB) TEXT libc_fchownat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchownat(SB) - GLOBL ·libc_fchownat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchownat_trampoline_addr(SB)/8, $libc_fchownat_trampoline<>(SB) TEXT libc_fclonefileat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fclonefileat(SB) - GLOBL ·libc_fclonefileat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fclonefileat_trampoline_addr(SB)/8, $libc_fclonefileat_trampoline<>(SB) TEXT libc_flock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_flock(SB) - GLOBL ·libc_flock_trampoline_addr(SB), RODATA, $8 DATA ·libc_flock_trampoline_addr(SB)/8, $libc_flock_trampoline<>(SB) TEXT libc_fpathconf_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fpathconf(SB) - GLOBL ·libc_fpathconf_trampoline_addr(SB), RODATA, $8 DATA ·libc_fpathconf_trampoline_addr(SB)/8, $libc_fpathconf_trampoline<>(SB) TEXT libc_fsync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fsync(SB) - GLOBL ·libc_fsync_trampoline_addr(SB), RODATA, $8 DATA ·libc_fsync_trampoline_addr(SB)/8, $libc_fsync_trampoline<>(SB) TEXT libc_ftruncate_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ftruncate(SB) - GLOBL ·libc_ftruncate_trampoline_addr(SB), RODATA, $8 DATA ·libc_ftruncate_trampoline_addr(SB)/8, $libc_ftruncate_trampoline<>(SB) TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getcwd(SB) - GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) TEXT libc_getdtablesize_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getdtablesize(SB) - GLOBL ·libc_getdtablesize_trampoline_addr(SB), RODATA, $8 DATA ·libc_getdtablesize_trampoline_addr(SB)/8, $libc_getdtablesize_trampoline<>(SB) TEXT libc_getegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getegid(SB) - GLOBL ·libc_getegid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getegid_trampoline_addr(SB)/8, $libc_getegid_trampoline<>(SB) TEXT libc_geteuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_geteuid(SB) - GLOBL ·libc_geteuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_geteuid_trampoline_addr(SB)/8, $libc_geteuid_trampoline<>(SB) TEXT libc_getgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgid(SB) - GLOBL ·libc_getgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getgid_trampoline_addr(SB)/8, $libc_getgid_trampoline<>(SB) TEXT libc_getpgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpgid(SB) - GLOBL ·libc_getpgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpgid_trampoline_addr(SB)/8, $libc_getpgid_trampoline<>(SB) TEXT libc_getpgrp_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpgrp(SB) - GLOBL ·libc_getpgrp_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpgrp_trampoline_addr(SB)/8, $libc_getpgrp_trampoline<>(SB) TEXT libc_getpid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpid(SB) - GLOBL ·libc_getpid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpid_trampoline_addr(SB)/8, $libc_getpid_trampoline<>(SB) TEXT libc_getppid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getppid(SB) - GLOBL ·libc_getppid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getppid_trampoline_addr(SB)/8, $libc_getppid_trampoline<>(SB) TEXT libc_getpriority_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpriority(SB) - GLOBL ·libc_getpriority_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpriority_trampoline_addr(SB)/8, $libc_getpriority_trampoline<>(SB) TEXT libc_getrlimit_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getrlimit(SB) - GLOBL ·libc_getrlimit_trampoline_addr(SB), RODATA, $8 DATA ·libc_getrlimit_trampoline_addr(SB)/8, $libc_getrlimit_trampoline<>(SB) TEXT libc_getrusage_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getrusage(SB) - GLOBL ·libc_getrusage_trampoline_addr(SB), RODATA, $8 DATA ·libc_getrusage_trampoline_addr(SB)/8, $libc_getrusage_trampoline<>(SB) TEXT libc_getsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsid(SB) - GLOBL ·libc_getsid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsid_trampoline_addr(SB)/8, $libc_getsid_trampoline<>(SB) TEXT libc_gettimeofday_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_gettimeofday(SB) - GLOBL ·libc_gettimeofday_trampoline_addr(SB), RODATA, $8 DATA ·libc_gettimeofday_trampoline_addr(SB)/8, $libc_gettimeofday_trampoline<>(SB) TEXT libc_getuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getuid(SB) - GLOBL ·libc_getuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getuid_trampoline_addr(SB)/8, $libc_getuid_trampoline<>(SB) TEXT libc_issetugid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_issetugid(SB) - GLOBL ·libc_issetugid_trampoline_addr(SB), RODATA, $8 DATA ·libc_issetugid_trampoline_addr(SB)/8, $libc_issetugid_trampoline<>(SB) TEXT libc_kqueue_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kqueue(SB) - GLOBL ·libc_kqueue_trampoline_addr(SB), RODATA, $8 DATA ·libc_kqueue_trampoline_addr(SB)/8, $libc_kqueue_trampoline<>(SB) TEXT libc_lchown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lchown(SB) - GLOBL ·libc_lchown_trampoline_addr(SB), RODATA, $8 DATA ·libc_lchown_trampoline_addr(SB)/8, $libc_lchown_trampoline<>(SB) TEXT libc_link_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_link(SB) - GLOBL ·libc_link_trampoline_addr(SB), RODATA, $8 DATA ·libc_link_trampoline_addr(SB)/8, $libc_link_trampoline<>(SB) TEXT libc_linkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_linkat(SB) - GLOBL ·libc_linkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_linkat_trampoline_addr(SB)/8, $libc_linkat_trampoline<>(SB) TEXT libc_listen_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_listen(SB) - GLOBL ·libc_listen_trampoline_addr(SB), RODATA, $8 DATA ·libc_listen_trampoline_addr(SB)/8, $libc_listen_trampoline<>(SB) TEXT libc_mkdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkdir(SB) - GLOBL ·libc_mkdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkdir_trampoline_addr(SB)/8, $libc_mkdir_trampoline<>(SB) TEXT libc_mkdirat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkdirat(SB) - GLOBL ·libc_mkdirat_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkdirat_trampoline_addr(SB)/8, $libc_mkdirat_trampoline<>(SB) TEXT libc_mkfifo_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkfifo(SB) - GLOBL ·libc_mkfifo_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkfifo_trampoline_addr(SB)/8, $libc_mkfifo_trampoline<>(SB) TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mknod(SB) - GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $8 DATA ·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB) TEXT libc_mount_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mount(SB) - GLOBL ·libc_mount_trampoline_addr(SB), RODATA, $8 DATA ·libc_mount_trampoline_addr(SB)/8, $libc_mount_trampoline<>(SB) TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_open(SB) - GLOBL ·libc_open_trampoline_addr(SB), RODATA, $8 DATA ·libc_open_trampoline_addr(SB)/8, $libc_open_trampoline<>(SB) TEXT libc_openat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_openat(SB) - GLOBL ·libc_openat_trampoline_addr(SB), RODATA, $8 DATA ·libc_openat_trampoline_addr(SB)/8, $libc_openat_trampoline<>(SB) TEXT libc_pathconf_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pathconf(SB) - GLOBL ·libc_pathconf_trampoline_addr(SB), RODATA, $8 DATA ·libc_pathconf_trampoline_addr(SB)/8, $libc_pathconf_trampoline<>(SB) TEXT libc_pread_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pread(SB) - GLOBL ·libc_pread_trampoline_addr(SB), RODATA, $8 DATA ·libc_pread_trampoline_addr(SB)/8, $libc_pread_trampoline<>(SB) TEXT libc_pwrite_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pwrite(SB) - GLOBL ·libc_pwrite_trampoline_addr(SB), RODATA, $8 DATA ·libc_pwrite_trampoline_addr(SB)/8, $libc_pwrite_trampoline<>(SB) TEXT libc_read_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_read(SB) - GLOBL ·libc_read_trampoline_addr(SB), RODATA, $8 DATA ·libc_read_trampoline_addr(SB)/8, $libc_read_trampoline<>(SB) TEXT libc_readlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readlink(SB) - GLOBL ·libc_readlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_readlink_trampoline_addr(SB)/8, $libc_readlink_trampoline<>(SB) TEXT libc_readlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readlinkat(SB) - GLOBL ·libc_readlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_readlinkat_trampoline_addr(SB)/8, $libc_readlinkat_trampoline<>(SB) TEXT libc_rename_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_rename(SB) - GLOBL ·libc_rename_trampoline_addr(SB), RODATA, $8 DATA ·libc_rename_trampoline_addr(SB)/8, $libc_rename_trampoline<>(SB) TEXT libc_renameat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_renameat(SB) - GLOBL ·libc_renameat_trampoline_addr(SB), RODATA, $8 DATA ·libc_renameat_trampoline_addr(SB)/8, $libc_renameat_trampoline<>(SB) TEXT libc_revoke_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_revoke(SB) - GLOBL ·libc_revoke_trampoline_addr(SB), RODATA, $8 DATA ·libc_revoke_trampoline_addr(SB)/8, $libc_revoke_trampoline<>(SB) TEXT libc_rmdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_rmdir(SB) - GLOBL ·libc_rmdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_rmdir_trampoline_addr(SB)/8, $libc_rmdir_trampoline<>(SB) TEXT libc_lseek_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lseek(SB) - GLOBL ·libc_lseek_trampoline_addr(SB), RODATA, $8 DATA ·libc_lseek_trampoline_addr(SB)/8, $libc_lseek_trampoline<>(SB) TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_select(SB) - GLOBL ·libc_select_trampoline_addr(SB), RODATA, $8 DATA ·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB) +TEXT libc_setattrlist_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setattrlist(SB) +GLOBL ·libc_setattrlist_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setattrlist_trampoline_addr(SB)/8, $libc_setattrlist_trampoline<>(SB) + TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setegid(SB) - GLOBL ·libc_setegid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setegid_trampoline_addr(SB)/8, $libc_setegid_trampoline<>(SB) TEXT libc_seteuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_seteuid(SB) - GLOBL ·libc_seteuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_seteuid_trampoline_addr(SB)/8, $libc_seteuid_trampoline<>(SB) TEXT libc_setgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setgid(SB) - GLOBL ·libc_setgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setgid_trampoline_addr(SB)/8, $libc_setgid_trampoline<>(SB) TEXT libc_setlogin_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setlogin(SB) - GLOBL ·libc_setlogin_trampoline_addr(SB), RODATA, $8 DATA ·libc_setlogin_trampoline_addr(SB)/8, $libc_setlogin_trampoline<>(SB) TEXT libc_setpgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setpgid(SB) - GLOBL ·libc_setpgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setpgid_trampoline_addr(SB)/8, $libc_setpgid_trampoline<>(SB) TEXT libc_setpriority_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setpriority(SB) - GLOBL ·libc_setpriority_trampoline_addr(SB), RODATA, $8 DATA ·libc_setpriority_trampoline_addr(SB)/8, $libc_setpriority_trampoline<>(SB) TEXT libc_setprivexec_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setprivexec(SB) - GLOBL ·libc_setprivexec_trampoline_addr(SB), RODATA, $8 DATA ·libc_setprivexec_trampoline_addr(SB)/8, $libc_setprivexec_trampoline<>(SB) TEXT libc_setregid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setregid(SB) - GLOBL ·libc_setregid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setregid_trampoline_addr(SB)/8, $libc_setregid_trampoline<>(SB) TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setreuid(SB) - GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) - -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsid(SB) - GLOBL ·libc_setsid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setsid_trampoline_addr(SB)/8, $libc_setsid_trampoline<>(SB) TEXT libc_settimeofday_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_settimeofday(SB) - GLOBL ·libc_settimeofday_trampoline_addr(SB), RODATA, $8 DATA ·libc_settimeofday_trampoline_addr(SB)/8, $libc_settimeofday_trampoline<>(SB) TEXT libc_setuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setuid(SB) - GLOBL ·libc_setuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setuid_trampoline_addr(SB)/8, $libc_setuid_trampoline<>(SB) TEXT libc_symlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_symlink(SB) - GLOBL ·libc_symlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_symlink_trampoline_addr(SB)/8, $libc_symlink_trampoline<>(SB) TEXT libc_symlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_symlinkat(SB) - GLOBL ·libc_symlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_symlinkat_trampoline_addr(SB)/8, $libc_symlinkat_trampoline<>(SB) TEXT libc_sync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sync(SB) - GLOBL ·libc_sync_trampoline_addr(SB), RODATA, $8 DATA ·libc_sync_trampoline_addr(SB)/8, $libc_sync_trampoline<>(SB) TEXT libc_truncate_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_truncate(SB) - GLOBL ·libc_truncate_trampoline_addr(SB), RODATA, $8 DATA ·libc_truncate_trampoline_addr(SB)/8, $libc_truncate_trampoline<>(SB) TEXT libc_umask_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_umask(SB) - GLOBL ·libc_umask_trampoline_addr(SB), RODATA, $8 DATA ·libc_umask_trampoline_addr(SB)/8, $libc_umask_trampoline<>(SB) TEXT libc_undelete_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_undelete(SB) - GLOBL ·libc_undelete_trampoline_addr(SB), RODATA, $8 DATA ·libc_undelete_trampoline_addr(SB)/8, $libc_undelete_trampoline<>(SB) TEXT libc_unlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unlink(SB) - GLOBL ·libc_unlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_unlink_trampoline_addr(SB)/8, $libc_unlink_trampoline<>(SB) TEXT libc_unlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unlinkat(SB) - GLOBL ·libc_unlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_unlinkat_trampoline_addr(SB)/8, $libc_unlinkat_trampoline<>(SB) TEXT libc_unmount_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unmount(SB) - GLOBL ·libc_unmount_trampoline_addr(SB), RODATA, $8 DATA ·libc_unmount_trampoline_addr(SB)/8, $libc_unmount_trampoline<>(SB) TEXT libc_write_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_write(SB) - GLOBL ·libc_write_trampoline_addr(SB), RODATA, $8 DATA ·libc_write_trampoline_addr(SB)/8, $libc_write_trampoline<>(SB) TEXT libc_mmap_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mmap(SB) - GLOBL ·libc_mmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_mmap_trampoline_addr(SB)/8, $libc_mmap_trampoline<>(SB) TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munmap(SB) - GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) TEXT libc_fstat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstat64(SB) - GLOBL ·libc_fstat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstat64_trampoline_addr(SB)/8, $libc_fstat64_trampoline<>(SB) TEXT libc_fstatat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstatat64(SB) - GLOBL ·libc_fstatat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstatat64_trampoline_addr(SB)/8, $libc_fstatat64_trampoline<>(SB) TEXT libc_fstatfs64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstatfs64(SB) - GLOBL ·libc_fstatfs64_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstatfs64_trampoline_addr(SB)/8, $libc_fstatfs64_trampoline<>(SB) TEXT libc_getfsstat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getfsstat64(SB) - GLOBL ·libc_getfsstat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_getfsstat64_trampoline_addr(SB)/8, $libc_getfsstat64_trampoline<>(SB) TEXT libc_lstat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lstat64(SB) - GLOBL ·libc_lstat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_lstat64_trampoline_addr(SB)/8, $libc_lstat64_trampoline<>(SB) TEXT libc_ptrace_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ptrace(SB) - GLOBL ·libc_ptrace_trampoline_addr(SB), RODATA, $8 DATA ·libc_ptrace_trampoline_addr(SB)/8, $libc_ptrace_trampoline<>(SB) TEXT libc_stat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_stat64(SB) - GLOBL ·libc_stat64_trampoline_addr(SB), RODATA, $8 DATA ·libc_stat64_trampoline_addr(SB)/8, $libc_stat64_trampoline<>(SB) TEXT libc_statfs64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_statfs64(SB) - GLOBL ·libc_statfs64_trampoline_addr(SB), RODATA, $8 DATA ·libc_statfs64_trampoline_addr(SB)/8, $libc_statfs64_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go index 2fd4590b..1b40b997 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build darwin && arm64 -// +build darwin,arm64 package unix @@ -725,6 +724,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -733,10 +738,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "/usr/lib/libSystem.B.dylib" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -1992,6 +1993,31 @@ var libc_select_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func Setattrlist(path string, attrlist *Attrlist, attrBuf []byte, options int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + var _p1 unsafe.Pointer + if len(attrBuf) > 0 { + _p1 = unsafe.Pointer(&attrBuf[0]) + } else { + _p1 = unsafe.Pointer(&_zero) + } + _, _, e1 := syscall_syscall6(libc_setattrlist_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(attrlist)), uintptr(_p1), uintptr(len(attrBuf)), uintptr(options), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_setattrlist_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_setattrlist setattrlist "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Setegid(egid int) (err error) { _, _, e1 := syscall_syscall(libc_setegid_trampoline_addr, uintptr(egid), 0, 0) if e1 != 0 { @@ -2123,20 +2149,6 @@ var libc_setreuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "/usr/lib/libSystem.B.dylib" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := syscall_rawSyscall(libc_setsid_trampoline_addr, 0, 0, 0) pid = int(r0) @@ -2399,28 +2411,6 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fstat(fd int, stat *Stat_t) (err error) { _, _, e1 := syscall_syscall(libc_fstat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { @@ -2510,14 +2500,6 @@ func ptrace1(request int, pid int, addr uintptr, data uintptr) (err error) { return } -func ptrace1Ptr(request int, pid int, addr uintptr, data unsafe.Pointer) (err error) { - _, _, e1 := syscall_syscall6(libc_ptrace_trampoline_addr, uintptr(request), uintptr(pid), addr, uintptr(data), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - var libc_ptrace_trampoline_addr uintptr //go:cgo_import_dynamic libc_ptrace ptrace "/usr/lib/libSystem.B.dylib" diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s index efa5b4c9..08362c1a 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s @@ -5,900 +5,750 @@ TEXT libc_fdopendir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fdopendir(SB) - GLOBL ·libc_fdopendir_trampoline_addr(SB), RODATA, $8 DATA ·libc_fdopendir_trampoline_addr(SB)/8, $libc_fdopendir_trampoline<>(SB) TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgroups(SB) - GLOBL ·libc_getgroups_trampoline_addr(SB), RODATA, $8 DATA ·libc_getgroups_trampoline_addr(SB)/8, $libc_getgroups_trampoline<>(SB) TEXT libc_setgroups_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setgroups(SB) - GLOBL ·libc_setgroups_trampoline_addr(SB), RODATA, $8 DATA ·libc_setgroups_trampoline_addr(SB)/8, $libc_setgroups_trampoline<>(SB) TEXT libc_wait4_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_wait4(SB) - GLOBL ·libc_wait4_trampoline_addr(SB), RODATA, $8 DATA ·libc_wait4_trampoline_addr(SB)/8, $libc_wait4_trampoline<>(SB) TEXT libc_accept_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_accept(SB) - GLOBL ·libc_accept_trampoline_addr(SB), RODATA, $8 DATA ·libc_accept_trampoline_addr(SB)/8, $libc_accept_trampoline<>(SB) TEXT libc_bind_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_bind(SB) - GLOBL ·libc_bind_trampoline_addr(SB), RODATA, $8 DATA ·libc_bind_trampoline_addr(SB)/8, $libc_bind_trampoline<>(SB) TEXT libc_connect_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_connect(SB) - GLOBL ·libc_connect_trampoline_addr(SB), RODATA, $8 DATA ·libc_connect_trampoline_addr(SB)/8, $libc_connect_trampoline<>(SB) TEXT libc_socket_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_socket(SB) - GLOBL ·libc_socket_trampoline_addr(SB), RODATA, $8 DATA ·libc_socket_trampoline_addr(SB)/8, $libc_socket_trampoline<>(SB) TEXT libc_getsockopt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsockopt(SB) - GLOBL ·libc_getsockopt_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsockopt_trampoline_addr(SB)/8, $libc_getsockopt_trampoline<>(SB) TEXT libc_setsockopt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsockopt(SB) - GLOBL ·libc_setsockopt_trampoline_addr(SB), RODATA, $8 DATA ·libc_setsockopt_trampoline_addr(SB)/8, $libc_setsockopt_trampoline<>(SB) TEXT libc_getpeername_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpeername(SB) - GLOBL ·libc_getpeername_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpeername_trampoline_addr(SB)/8, $libc_getpeername_trampoline<>(SB) TEXT libc_getsockname_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsockname(SB) - GLOBL ·libc_getsockname_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsockname_trampoline_addr(SB)/8, $libc_getsockname_trampoline<>(SB) TEXT libc_shutdown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shutdown(SB) - GLOBL ·libc_shutdown_trampoline_addr(SB), RODATA, $8 DATA ·libc_shutdown_trampoline_addr(SB)/8, $libc_shutdown_trampoline<>(SB) TEXT libc_socketpair_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_socketpair(SB) - GLOBL ·libc_socketpair_trampoline_addr(SB), RODATA, $8 DATA ·libc_socketpair_trampoline_addr(SB)/8, $libc_socketpair_trampoline<>(SB) TEXT libc_recvfrom_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_recvfrom(SB) - GLOBL ·libc_recvfrom_trampoline_addr(SB), RODATA, $8 DATA ·libc_recvfrom_trampoline_addr(SB)/8, $libc_recvfrom_trampoline<>(SB) TEXT libc_sendto_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendto(SB) - GLOBL ·libc_sendto_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendto_trampoline_addr(SB)/8, $libc_sendto_trampoline<>(SB) TEXT libc_recvmsg_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_recvmsg(SB) - GLOBL ·libc_recvmsg_trampoline_addr(SB), RODATA, $8 DATA ·libc_recvmsg_trampoline_addr(SB)/8, $libc_recvmsg_trampoline<>(SB) TEXT libc_sendmsg_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendmsg(SB) - GLOBL ·libc_sendmsg_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendmsg_trampoline_addr(SB)/8, $libc_sendmsg_trampoline<>(SB) TEXT libc_kevent_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kevent(SB) - GLOBL ·libc_kevent_trampoline_addr(SB), RODATA, $8 DATA ·libc_kevent_trampoline_addr(SB)/8, $libc_kevent_trampoline<>(SB) TEXT libc_utimes_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimes(SB) - GLOBL ·libc_utimes_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimes_trampoline_addr(SB)/8, $libc_utimes_trampoline<>(SB) TEXT libc_futimes_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_futimes(SB) - GLOBL ·libc_futimes_trampoline_addr(SB), RODATA, $8 DATA ·libc_futimes_trampoline_addr(SB)/8, $libc_futimes_trampoline<>(SB) TEXT libc_poll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_poll(SB) - GLOBL ·libc_poll_trampoline_addr(SB), RODATA, $8 DATA ·libc_poll_trampoline_addr(SB)/8, $libc_poll_trampoline<>(SB) TEXT libc_madvise_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_madvise(SB) - GLOBL ·libc_madvise_trampoline_addr(SB), RODATA, $8 DATA ·libc_madvise_trampoline_addr(SB)/8, $libc_madvise_trampoline<>(SB) TEXT libc_mlock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mlock(SB) - GLOBL ·libc_mlock_trampoline_addr(SB), RODATA, $8 DATA ·libc_mlock_trampoline_addr(SB)/8, $libc_mlock_trampoline<>(SB) TEXT libc_mlockall_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mlockall(SB) - GLOBL ·libc_mlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_mlockall_trampoline_addr(SB)/8, $libc_mlockall_trampoline<>(SB) TEXT libc_mprotect_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mprotect(SB) - GLOBL ·libc_mprotect_trampoline_addr(SB), RODATA, $8 DATA ·libc_mprotect_trampoline_addr(SB)/8, $libc_mprotect_trampoline<>(SB) TEXT libc_msync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_msync(SB) - GLOBL ·libc_msync_trampoline_addr(SB), RODATA, $8 DATA ·libc_msync_trampoline_addr(SB)/8, $libc_msync_trampoline<>(SB) TEXT libc_munlock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munlock(SB) - GLOBL ·libc_munlock_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlock_trampoline_addr(SB)/8, $libc_munlock_trampoline<>(SB) TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munlockall(SB) - GLOBL ·libc_munlockall_trampoline_addr(SB), RODATA, $8 DATA ·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB) TEXT libc_closedir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_closedir(SB) - GLOBL ·libc_closedir_trampoline_addr(SB), RODATA, $8 DATA ·libc_closedir_trampoline_addr(SB)/8, $libc_closedir_trampoline<>(SB) TEXT libc_readdir_r_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readdir_r(SB) - GLOBL ·libc_readdir_r_trampoline_addr(SB), RODATA, $8 DATA ·libc_readdir_r_trampoline_addr(SB)/8, $libc_readdir_r_trampoline<>(SB) TEXT libc_pipe_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pipe(SB) - GLOBL ·libc_pipe_trampoline_addr(SB), RODATA, $8 DATA ·libc_pipe_trampoline_addr(SB)/8, $libc_pipe_trampoline<>(SB) TEXT libc_getxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getxattr(SB) - GLOBL ·libc_getxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_getxattr_trampoline_addr(SB)/8, $libc_getxattr_trampoline<>(SB) TEXT libc_fgetxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fgetxattr(SB) - GLOBL ·libc_fgetxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fgetxattr_trampoline_addr(SB)/8, $libc_fgetxattr_trampoline<>(SB) TEXT libc_setxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setxattr(SB) - GLOBL ·libc_setxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_setxattr_trampoline_addr(SB)/8, $libc_setxattr_trampoline<>(SB) TEXT libc_fsetxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fsetxattr(SB) - GLOBL ·libc_fsetxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fsetxattr_trampoline_addr(SB)/8, $libc_fsetxattr_trampoline<>(SB) TEXT libc_removexattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_removexattr(SB) - GLOBL ·libc_removexattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_removexattr_trampoline_addr(SB)/8, $libc_removexattr_trampoline<>(SB) TEXT libc_fremovexattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fremovexattr(SB) - GLOBL ·libc_fremovexattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_fremovexattr_trampoline_addr(SB)/8, $libc_fremovexattr_trampoline<>(SB) TEXT libc_listxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_listxattr(SB) - GLOBL ·libc_listxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_listxattr_trampoline_addr(SB)/8, $libc_listxattr_trampoline<>(SB) TEXT libc_flistxattr_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_flistxattr(SB) - GLOBL ·libc_flistxattr_trampoline_addr(SB), RODATA, $8 DATA ·libc_flistxattr_trampoline_addr(SB)/8, $libc_flistxattr_trampoline<>(SB) TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) - GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fcntl(SB) - GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) TEXT libc_kill_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kill(SB) - GLOBL ·libc_kill_trampoline_addr(SB), RODATA, $8 DATA ·libc_kill_trampoline_addr(SB)/8, $libc_kill_trampoline<>(SB) TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) - GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_ioctl_trampoline_addr(SB)/8, $libc_ioctl_trampoline<>(SB) TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sysctl(SB) - GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) TEXT libc_sendfile_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sendfile(SB) - GLOBL ·libc_sendfile_trampoline_addr(SB), RODATA, $8 DATA ·libc_sendfile_trampoline_addr(SB)/8, $libc_sendfile_trampoline<>(SB) TEXT libc_shmat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmat(SB) - GLOBL ·libc_shmat_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmat_trampoline_addr(SB)/8, $libc_shmat_trampoline<>(SB) TEXT libc_shmctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmctl(SB) - GLOBL ·libc_shmctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmctl_trampoline_addr(SB)/8, $libc_shmctl_trampoline<>(SB) TEXT libc_shmdt_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmdt(SB) - GLOBL ·libc_shmdt_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmdt_trampoline_addr(SB)/8, $libc_shmdt_trampoline<>(SB) TEXT libc_shmget_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_shmget(SB) - GLOBL ·libc_shmget_trampoline_addr(SB), RODATA, $8 DATA ·libc_shmget_trampoline_addr(SB)/8, $libc_shmget_trampoline<>(SB) TEXT libc_access_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_access(SB) - GLOBL ·libc_access_trampoline_addr(SB), RODATA, $8 DATA ·libc_access_trampoline_addr(SB)/8, $libc_access_trampoline<>(SB) TEXT libc_adjtime_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_adjtime(SB) - GLOBL ·libc_adjtime_trampoline_addr(SB), RODATA, $8 DATA ·libc_adjtime_trampoline_addr(SB)/8, $libc_adjtime_trampoline<>(SB) TEXT libc_chdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chdir(SB) - GLOBL ·libc_chdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_chdir_trampoline_addr(SB)/8, $libc_chdir_trampoline<>(SB) TEXT libc_chflags_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chflags(SB) - GLOBL ·libc_chflags_trampoline_addr(SB), RODATA, $8 DATA ·libc_chflags_trampoline_addr(SB)/8, $libc_chflags_trampoline<>(SB) TEXT libc_chmod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chmod(SB) - GLOBL ·libc_chmod_trampoline_addr(SB), RODATA, $8 DATA ·libc_chmod_trampoline_addr(SB)/8, $libc_chmod_trampoline<>(SB) TEXT libc_chown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chown(SB) - GLOBL ·libc_chown_trampoline_addr(SB), RODATA, $8 DATA ·libc_chown_trampoline_addr(SB)/8, $libc_chown_trampoline<>(SB) TEXT libc_chroot_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_chroot(SB) - GLOBL ·libc_chroot_trampoline_addr(SB), RODATA, $8 DATA ·libc_chroot_trampoline_addr(SB)/8, $libc_chroot_trampoline<>(SB) TEXT libc_clock_gettime_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clock_gettime(SB) - GLOBL ·libc_clock_gettime_trampoline_addr(SB), RODATA, $8 DATA ·libc_clock_gettime_trampoline_addr(SB)/8, $libc_clock_gettime_trampoline<>(SB) TEXT libc_close_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_close(SB) - GLOBL ·libc_close_trampoline_addr(SB), RODATA, $8 DATA ·libc_close_trampoline_addr(SB)/8, $libc_close_trampoline<>(SB) TEXT libc_clonefile_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clonefile(SB) - GLOBL ·libc_clonefile_trampoline_addr(SB), RODATA, $8 DATA ·libc_clonefile_trampoline_addr(SB)/8, $libc_clonefile_trampoline<>(SB) TEXT libc_clonefileat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_clonefileat(SB) - GLOBL ·libc_clonefileat_trampoline_addr(SB), RODATA, $8 DATA ·libc_clonefileat_trampoline_addr(SB)/8, $libc_clonefileat_trampoline<>(SB) TEXT libc_dup_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_dup(SB) - GLOBL ·libc_dup_trampoline_addr(SB), RODATA, $8 DATA ·libc_dup_trampoline_addr(SB)/8, $libc_dup_trampoline<>(SB) TEXT libc_dup2_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_dup2(SB) - GLOBL ·libc_dup2_trampoline_addr(SB), RODATA, $8 DATA ·libc_dup2_trampoline_addr(SB)/8, $libc_dup2_trampoline<>(SB) TEXT libc_exchangedata_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_exchangedata(SB) - GLOBL ·libc_exchangedata_trampoline_addr(SB), RODATA, $8 DATA ·libc_exchangedata_trampoline_addr(SB)/8, $libc_exchangedata_trampoline<>(SB) TEXT libc_exit_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_exit(SB) - GLOBL ·libc_exit_trampoline_addr(SB), RODATA, $8 DATA ·libc_exit_trampoline_addr(SB)/8, $libc_exit_trampoline<>(SB) TEXT libc_faccessat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_faccessat(SB) - GLOBL ·libc_faccessat_trampoline_addr(SB), RODATA, $8 DATA ·libc_faccessat_trampoline_addr(SB)/8, $libc_faccessat_trampoline<>(SB) TEXT libc_fchdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchdir(SB) - GLOBL ·libc_fchdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchdir_trampoline_addr(SB)/8, $libc_fchdir_trampoline<>(SB) TEXT libc_fchflags_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchflags(SB) - GLOBL ·libc_fchflags_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchflags_trampoline_addr(SB)/8, $libc_fchflags_trampoline<>(SB) TEXT libc_fchmod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchmod(SB) - GLOBL ·libc_fchmod_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchmod_trampoline_addr(SB)/8, $libc_fchmod_trampoline<>(SB) TEXT libc_fchmodat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchmodat(SB) - GLOBL ·libc_fchmodat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchmodat_trampoline_addr(SB)/8, $libc_fchmodat_trampoline<>(SB) TEXT libc_fchown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchown(SB) - GLOBL ·libc_fchown_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchown_trampoline_addr(SB)/8, $libc_fchown_trampoline<>(SB) TEXT libc_fchownat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fchownat(SB) - GLOBL ·libc_fchownat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fchownat_trampoline_addr(SB)/8, $libc_fchownat_trampoline<>(SB) TEXT libc_fclonefileat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fclonefileat(SB) - GLOBL ·libc_fclonefileat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fclonefileat_trampoline_addr(SB)/8, $libc_fclonefileat_trampoline<>(SB) TEXT libc_flock_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_flock(SB) - GLOBL ·libc_flock_trampoline_addr(SB), RODATA, $8 DATA ·libc_flock_trampoline_addr(SB)/8, $libc_flock_trampoline<>(SB) TEXT libc_fpathconf_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fpathconf(SB) - GLOBL ·libc_fpathconf_trampoline_addr(SB), RODATA, $8 DATA ·libc_fpathconf_trampoline_addr(SB)/8, $libc_fpathconf_trampoline<>(SB) TEXT libc_fsync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fsync(SB) - GLOBL ·libc_fsync_trampoline_addr(SB), RODATA, $8 DATA ·libc_fsync_trampoline_addr(SB)/8, $libc_fsync_trampoline<>(SB) TEXT libc_ftruncate_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ftruncate(SB) - GLOBL ·libc_ftruncate_trampoline_addr(SB), RODATA, $8 DATA ·libc_ftruncate_trampoline_addr(SB)/8, $libc_ftruncate_trampoline<>(SB) TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getcwd(SB) - GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) TEXT libc_getdtablesize_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getdtablesize(SB) - GLOBL ·libc_getdtablesize_trampoline_addr(SB), RODATA, $8 DATA ·libc_getdtablesize_trampoline_addr(SB)/8, $libc_getdtablesize_trampoline<>(SB) TEXT libc_getegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getegid(SB) - GLOBL ·libc_getegid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getegid_trampoline_addr(SB)/8, $libc_getegid_trampoline<>(SB) TEXT libc_geteuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_geteuid(SB) - GLOBL ·libc_geteuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_geteuid_trampoline_addr(SB)/8, $libc_geteuid_trampoline<>(SB) TEXT libc_getgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getgid(SB) - GLOBL ·libc_getgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getgid_trampoline_addr(SB)/8, $libc_getgid_trampoline<>(SB) TEXT libc_getpgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpgid(SB) - GLOBL ·libc_getpgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpgid_trampoline_addr(SB)/8, $libc_getpgid_trampoline<>(SB) TEXT libc_getpgrp_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpgrp(SB) - GLOBL ·libc_getpgrp_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpgrp_trampoline_addr(SB)/8, $libc_getpgrp_trampoline<>(SB) TEXT libc_getpid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpid(SB) - GLOBL ·libc_getpid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpid_trampoline_addr(SB)/8, $libc_getpid_trampoline<>(SB) TEXT libc_getppid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getppid(SB) - GLOBL ·libc_getppid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getppid_trampoline_addr(SB)/8, $libc_getppid_trampoline<>(SB) TEXT libc_getpriority_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getpriority(SB) - GLOBL ·libc_getpriority_trampoline_addr(SB), RODATA, $8 DATA ·libc_getpriority_trampoline_addr(SB)/8, $libc_getpriority_trampoline<>(SB) TEXT libc_getrlimit_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getrlimit(SB) - GLOBL ·libc_getrlimit_trampoline_addr(SB), RODATA, $8 DATA ·libc_getrlimit_trampoline_addr(SB)/8, $libc_getrlimit_trampoline<>(SB) TEXT libc_getrusage_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getrusage(SB) - GLOBL ·libc_getrusage_trampoline_addr(SB), RODATA, $8 DATA ·libc_getrusage_trampoline_addr(SB)/8, $libc_getrusage_trampoline<>(SB) TEXT libc_getsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getsid(SB) - GLOBL ·libc_getsid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getsid_trampoline_addr(SB)/8, $libc_getsid_trampoline<>(SB) TEXT libc_gettimeofday_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_gettimeofday(SB) - GLOBL ·libc_gettimeofday_trampoline_addr(SB), RODATA, $8 DATA ·libc_gettimeofday_trampoline_addr(SB)/8, $libc_gettimeofday_trampoline<>(SB) TEXT libc_getuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getuid(SB) - GLOBL ·libc_getuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_getuid_trampoline_addr(SB)/8, $libc_getuid_trampoline<>(SB) TEXT libc_issetugid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_issetugid(SB) - GLOBL ·libc_issetugid_trampoline_addr(SB), RODATA, $8 DATA ·libc_issetugid_trampoline_addr(SB)/8, $libc_issetugid_trampoline<>(SB) TEXT libc_kqueue_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_kqueue(SB) - GLOBL ·libc_kqueue_trampoline_addr(SB), RODATA, $8 DATA ·libc_kqueue_trampoline_addr(SB)/8, $libc_kqueue_trampoline<>(SB) TEXT libc_lchown_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lchown(SB) - GLOBL ·libc_lchown_trampoline_addr(SB), RODATA, $8 DATA ·libc_lchown_trampoline_addr(SB)/8, $libc_lchown_trampoline<>(SB) TEXT libc_link_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_link(SB) - GLOBL ·libc_link_trampoline_addr(SB), RODATA, $8 DATA ·libc_link_trampoline_addr(SB)/8, $libc_link_trampoline<>(SB) TEXT libc_linkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_linkat(SB) - GLOBL ·libc_linkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_linkat_trampoline_addr(SB)/8, $libc_linkat_trampoline<>(SB) TEXT libc_listen_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_listen(SB) - GLOBL ·libc_listen_trampoline_addr(SB), RODATA, $8 DATA ·libc_listen_trampoline_addr(SB)/8, $libc_listen_trampoline<>(SB) TEXT libc_mkdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkdir(SB) - GLOBL ·libc_mkdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkdir_trampoline_addr(SB)/8, $libc_mkdir_trampoline<>(SB) TEXT libc_mkdirat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkdirat(SB) - GLOBL ·libc_mkdirat_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkdirat_trampoline_addr(SB)/8, $libc_mkdirat_trampoline<>(SB) TEXT libc_mkfifo_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mkfifo(SB) - GLOBL ·libc_mkfifo_trampoline_addr(SB), RODATA, $8 DATA ·libc_mkfifo_trampoline_addr(SB)/8, $libc_mkfifo_trampoline<>(SB) TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mknod(SB) - GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $8 DATA ·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB) TEXT libc_mount_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mount(SB) - GLOBL ·libc_mount_trampoline_addr(SB), RODATA, $8 DATA ·libc_mount_trampoline_addr(SB)/8, $libc_mount_trampoline<>(SB) TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_open(SB) - GLOBL ·libc_open_trampoline_addr(SB), RODATA, $8 DATA ·libc_open_trampoline_addr(SB)/8, $libc_open_trampoline<>(SB) TEXT libc_openat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_openat(SB) - GLOBL ·libc_openat_trampoline_addr(SB), RODATA, $8 DATA ·libc_openat_trampoline_addr(SB)/8, $libc_openat_trampoline<>(SB) TEXT libc_pathconf_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pathconf(SB) - GLOBL ·libc_pathconf_trampoline_addr(SB), RODATA, $8 DATA ·libc_pathconf_trampoline_addr(SB)/8, $libc_pathconf_trampoline<>(SB) TEXT libc_pread_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pread(SB) - GLOBL ·libc_pread_trampoline_addr(SB), RODATA, $8 DATA ·libc_pread_trampoline_addr(SB)/8, $libc_pread_trampoline<>(SB) TEXT libc_pwrite_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_pwrite(SB) - GLOBL ·libc_pwrite_trampoline_addr(SB), RODATA, $8 DATA ·libc_pwrite_trampoline_addr(SB)/8, $libc_pwrite_trampoline<>(SB) TEXT libc_read_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_read(SB) - GLOBL ·libc_read_trampoline_addr(SB), RODATA, $8 DATA ·libc_read_trampoline_addr(SB)/8, $libc_read_trampoline<>(SB) TEXT libc_readlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readlink(SB) - GLOBL ·libc_readlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_readlink_trampoline_addr(SB)/8, $libc_readlink_trampoline<>(SB) TEXT libc_readlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_readlinkat(SB) - GLOBL ·libc_readlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_readlinkat_trampoline_addr(SB)/8, $libc_readlinkat_trampoline<>(SB) TEXT libc_rename_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_rename(SB) - GLOBL ·libc_rename_trampoline_addr(SB), RODATA, $8 DATA ·libc_rename_trampoline_addr(SB)/8, $libc_rename_trampoline<>(SB) TEXT libc_renameat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_renameat(SB) - GLOBL ·libc_renameat_trampoline_addr(SB), RODATA, $8 DATA ·libc_renameat_trampoline_addr(SB)/8, $libc_renameat_trampoline<>(SB) TEXT libc_revoke_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_revoke(SB) - GLOBL ·libc_revoke_trampoline_addr(SB), RODATA, $8 DATA ·libc_revoke_trampoline_addr(SB)/8, $libc_revoke_trampoline<>(SB) TEXT libc_rmdir_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_rmdir(SB) - GLOBL ·libc_rmdir_trampoline_addr(SB), RODATA, $8 DATA ·libc_rmdir_trampoline_addr(SB)/8, $libc_rmdir_trampoline<>(SB) TEXT libc_lseek_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lseek(SB) - GLOBL ·libc_lseek_trampoline_addr(SB), RODATA, $8 DATA ·libc_lseek_trampoline_addr(SB)/8, $libc_lseek_trampoline<>(SB) TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_select(SB) - GLOBL ·libc_select_trampoline_addr(SB), RODATA, $8 DATA ·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB) +TEXT libc_setattrlist_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_setattrlist(SB) +GLOBL ·libc_setattrlist_trampoline_addr(SB), RODATA, $8 +DATA ·libc_setattrlist_trampoline_addr(SB)/8, $libc_setattrlist_trampoline<>(SB) + TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setegid(SB) - GLOBL ·libc_setegid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setegid_trampoline_addr(SB)/8, $libc_setegid_trampoline<>(SB) TEXT libc_seteuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_seteuid(SB) - GLOBL ·libc_seteuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_seteuid_trampoline_addr(SB)/8, $libc_seteuid_trampoline<>(SB) TEXT libc_setgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setgid(SB) - GLOBL ·libc_setgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setgid_trampoline_addr(SB)/8, $libc_setgid_trampoline<>(SB) TEXT libc_setlogin_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setlogin(SB) - GLOBL ·libc_setlogin_trampoline_addr(SB), RODATA, $8 DATA ·libc_setlogin_trampoline_addr(SB)/8, $libc_setlogin_trampoline<>(SB) TEXT libc_setpgid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setpgid(SB) - GLOBL ·libc_setpgid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setpgid_trampoline_addr(SB)/8, $libc_setpgid_trampoline<>(SB) TEXT libc_setpriority_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setpriority(SB) - GLOBL ·libc_setpriority_trampoline_addr(SB), RODATA, $8 DATA ·libc_setpriority_trampoline_addr(SB)/8, $libc_setpriority_trampoline<>(SB) TEXT libc_setprivexec_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setprivexec(SB) - GLOBL ·libc_setprivexec_trampoline_addr(SB), RODATA, $8 DATA ·libc_setprivexec_trampoline_addr(SB)/8, $libc_setprivexec_trampoline<>(SB) TEXT libc_setregid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setregid(SB) - GLOBL ·libc_setregid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setregid_trampoline_addr(SB)/8, $libc_setregid_trampoline<>(SB) TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setreuid(SB) - GLOBL ·libc_setreuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) - -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setsid(SB) - GLOBL ·libc_setsid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setsid_trampoline_addr(SB)/8, $libc_setsid_trampoline<>(SB) TEXT libc_settimeofday_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_settimeofday(SB) - GLOBL ·libc_settimeofday_trampoline_addr(SB), RODATA, $8 DATA ·libc_settimeofday_trampoline_addr(SB)/8, $libc_settimeofday_trampoline<>(SB) TEXT libc_setuid_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setuid(SB) - GLOBL ·libc_setuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setuid_trampoline_addr(SB)/8, $libc_setuid_trampoline<>(SB) TEXT libc_symlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_symlink(SB) - GLOBL ·libc_symlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_symlink_trampoline_addr(SB)/8, $libc_symlink_trampoline<>(SB) TEXT libc_symlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_symlinkat(SB) - GLOBL ·libc_symlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_symlinkat_trampoline_addr(SB)/8, $libc_symlinkat_trampoline<>(SB) TEXT libc_sync_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_sync(SB) - GLOBL ·libc_sync_trampoline_addr(SB), RODATA, $8 DATA ·libc_sync_trampoline_addr(SB)/8, $libc_sync_trampoline<>(SB) TEXT libc_truncate_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_truncate(SB) - GLOBL ·libc_truncate_trampoline_addr(SB), RODATA, $8 DATA ·libc_truncate_trampoline_addr(SB)/8, $libc_truncate_trampoline<>(SB) TEXT libc_umask_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_umask(SB) - GLOBL ·libc_umask_trampoline_addr(SB), RODATA, $8 DATA ·libc_umask_trampoline_addr(SB)/8, $libc_umask_trampoline<>(SB) TEXT libc_undelete_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_undelete(SB) - GLOBL ·libc_undelete_trampoline_addr(SB), RODATA, $8 DATA ·libc_undelete_trampoline_addr(SB)/8, $libc_undelete_trampoline<>(SB) TEXT libc_unlink_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unlink(SB) - GLOBL ·libc_unlink_trampoline_addr(SB), RODATA, $8 DATA ·libc_unlink_trampoline_addr(SB)/8, $libc_unlink_trampoline<>(SB) TEXT libc_unlinkat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unlinkat(SB) - GLOBL ·libc_unlinkat_trampoline_addr(SB), RODATA, $8 DATA ·libc_unlinkat_trampoline_addr(SB)/8, $libc_unlinkat_trampoline<>(SB) TEXT libc_unmount_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_unmount(SB) - GLOBL ·libc_unmount_trampoline_addr(SB), RODATA, $8 DATA ·libc_unmount_trampoline_addr(SB)/8, $libc_unmount_trampoline<>(SB) TEXT libc_write_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_write(SB) - GLOBL ·libc_write_trampoline_addr(SB), RODATA, $8 DATA ·libc_write_trampoline_addr(SB)/8, $libc_write_trampoline<>(SB) TEXT libc_mmap_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_mmap(SB) - GLOBL ·libc_mmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_mmap_trampoline_addr(SB)/8, $libc_mmap_trampoline<>(SB) TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_munmap(SB) - GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) TEXT libc_fstat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstat(SB) - GLOBL ·libc_fstat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstat_trampoline_addr(SB)/8, $libc_fstat_trampoline<>(SB) TEXT libc_fstatat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstatat(SB) - GLOBL ·libc_fstatat_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstatat_trampoline_addr(SB)/8, $libc_fstatat_trampoline<>(SB) TEXT libc_fstatfs_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstatfs(SB) - GLOBL ·libc_fstatfs_trampoline_addr(SB), RODATA, $8 DATA ·libc_fstatfs_trampoline_addr(SB)/8, $libc_fstatfs_trampoline<>(SB) TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_getfsstat(SB) - GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $8 DATA ·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB) TEXT libc_lstat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_lstat(SB) - GLOBL ·libc_lstat_trampoline_addr(SB), RODATA, $8 DATA ·libc_lstat_trampoline_addr(SB)/8, $libc_lstat_trampoline<>(SB) TEXT libc_ptrace_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ptrace(SB) - GLOBL ·libc_ptrace_trampoline_addr(SB), RODATA, $8 DATA ·libc_ptrace_trampoline_addr(SB)/8, $libc_ptrace_trampoline<>(SB) TEXT libc_stat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_stat(SB) - GLOBL ·libc_stat_trampoline_addr(SB), RODATA, $8 DATA ·libc_stat_trampoline_addr(SB)/8, $libc_stat_trampoline<>(SB) TEXT libc_statfs_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_statfs(SB) - GLOBL ·libc_statfs_trampoline_addr(SB), RODATA, $8 DATA ·libc_statfs_trampoline_addr(SB)/8, $libc_statfs_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go index 3b851347..aad65fc7 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build dragonfly && amd64 -// +build dragonfly,amd64 package unix @@ -1410,16 +1409,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1652,28 +1641,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go index 11290656..c0096391 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build freebsd && 386 -// +build freebsd,386 package unix @@ -1645,16 +1644,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1872,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go index 55f5abfe..7664df74 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build freebsd && amd64 -// +build freebsd,amd64 package unix @@ -1645,16 +1644,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1872,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go index d39651c2..ae099182 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build freebsd && arm -// +build freebsd,arm package unix @@ -1645,16 +1644,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1872,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go index ddb74086..11fd5d45 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build freebsd && arm64 -// +build freebsd,arm64 package unix @@ -1645,16 +1644,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1872,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go index 09a53a61..c3d2d653 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build freebsd && riscv64 -// +build freebsd,riscv64 package unix @@ -1645,16 +1644,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1872,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) { r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) nfd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go index b57c7050..c698cbc0 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build illumos && amd64 -// +build illumos,amd64 package unix @@ -40,7 +39,7 @@ func readv(fd int, iovs []Iovec) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procreadv)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -55,7 +54,7 @@ func preadv(fd int, iovs []Iovec, off int64) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpreadv)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), uintptr(off), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -70,7 +69,7 @@ func writev(fd int, iovs []Iovec) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwritev)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -85,7 +84,7 @@ func pwritev(fd int, iovs []Iovec, off int64) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpwritev)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), uintptr(off), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -96,7 +95,7 @@ func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int, r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procaccept4)), 4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux.go b/vendor/golang.org/x/sys/unix/zsyscall_linux.go index 430cb24d..1488d271 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux.go @@ -1,7 +1,6 @@ // Code generated by mkmerge; DO NOT EDIT. //go:build linux -// +build linux package unix @@ -38,6 +37,21 @@ func fchmodat(dirfd int, path string, mode uint32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fchmodat2(dirfd int, path string, mode uint32, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return + } + _, _, e1 := Syscall6(SYS_FCHMODAT2, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -1346,16 +1360,6 @@ func PivotRoot(newroot string, putold string) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Prlimit(pid int, resource int, newlimit *Rlimit, old *Rlimit) (err error) { - _, _, e1 := RawSyscall6(SYS_PRLIMIT64, uintptr(pid), uintptr(resource), uintptr(unsafe.Pointer(newlimit)), uintptr(unsafe.Pointer(old)), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (err error) { _, _, e1 := Syscall6(SYS_PRCTL, uintptr(option), uintptr(arg2), uintptr(arg3), uintptr(arg4), uintptr(arg5), 0) if e1 != 0 { @@ -1366,7 +1370,7 @@ func Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) ( // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { +func pselect6(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *sigset_argpack) (n int, err error) { r0, _, e1 := Syscall6(SYS_PSELECT6, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask))) n = int(r0) if e1 != 0 { @@ -1744,28 +1748,6 @@ func exitThread(code int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, p *byte, np int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(p)), uintptr(np)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, p *byte, np int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(p)), uintptr(np)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func readv(fd int, iovs []Iovec) (n int, err error) { var _p0 unsafe.Pointer if len(iovs) > 0 { @@ -1878,6 +1860,17 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldaddr), uintptr(oldlength), uintptr(newlength), uintptr(flags), uintptr(newaddr), 0) + xaddr = uintptr(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Madvise(b []byte, advice int) (err error) { var _p0 unsafe.Pointer if len(b) > 0 { @@ -2182,3 +2175,47 @@ func rtSigprocmask(how int, set *Sigset_t, oldset *Sigset_t, sigsetsize uintptr) } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + RawSyscallNoError(SYS_GETRESUID, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + RawSyscallNoError(SYS_GETRESGID, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func schedSetattr(pid int, attr *SchedAttr, flags uint) (err error) { + _, _, e1 := Syscall(SYS_SCHED_SETATTR, uintptr(pid), uintptr(unsafe.Pointer(attr)), uintptr(flags)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func schedGetattr(pid int, attr *SchedAttr, size uint, flags uint) (err error) { + _, _, e1 := Syscall6(SYS_SCHED_GETATTR, uintptr(pid), uintptr(unsafe.Pointer(attr)), uintptr(size), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func Cachestat(fd uint, crange *CachestatRange, cstat *Cachestat_t, flags uint) (err error) { + _, _, e1 := Syscall6(SYS_CACHESTAT, uintptr(fd), uintptr(unsafe.Pointer(crange)), uintptr(unsafe.Pointer(cstat)), uintptr(flags), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go index c81b0ad4..4def3e9f 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && 386 -// +build linux,386 package unix @@ -411,16 +410,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func futimesat(dirfd int, path string, times *[2]Timeval) (err error) { var _p0 *byte _p0, err = BytePtrFromString(path) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go index 2206bce7..fef2bc8b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && amd64 -// +build linux,amd64 package unix @@ -334,16 +333,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go index edf6b39f..a9fd76a8 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && arm -// +build linux,arm package unix @@ -578,16 +577,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func armSyncFileRange(fd int, flags int, off int64, n int64) (err error) { _, _, e1 := Syscall6(SYS_ARM_SYNC_FILE_RANGE, uintptr(fd), uintptr(flags), uintptr(off), uintptr(off>>32), uintptr(n), uintptr(n>>32)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go index 190609f2..46006502 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && arm64 -// +build linux,arm64 package unix @@ -289,16 +288,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go index 806ffd1e..c8987d26 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && loong64 -// +build linux,loong64 package unix diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go index 5f984cbb..921f4306 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && mips -// +build linux,mips package unix @@ -644,16 +643,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Alarm(seconds uint) (remaining uint, err error) { r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0) remaining = uint(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go index 46fc380a..44f06782 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && mips64 -// +build linux,mips64 package unix @@ -278,16 +277,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go index cbd0d4da..e7fa0abf 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && mips64le -// +build linux,mips64le package unix @@ -278,16 +277,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go index 0c13d15f..8c512567 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && mipsle -// +build linux,mipsle package unix @@ -644,16 +643,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Alarm(seconds uint) (remaining uint, err error) { r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0) remaining = uint(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go index e01432ae..7392fd45 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && ppc -// +build linux,ppc package unix @@ -624,16 +623,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func setrlimit(resource int, rlim *rlimit32) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func syncFileRange2(fd int, flags int, off int64, n int64) (err error) { _, _, e1 := Syscall6(SYS_SYNC_FILE_RANGE2, uintptr(fd), uintptr(flags), uintptr(off>>32), uintptr(off), uintptr(n>>32), uintptr(n)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go index 13c7ee7b..41180434 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && ppc64 -// +build linux,ppc64 package unix @@ -349,16 +348,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go index 02d0c0fd..40c6ce7a 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && ppc64le -// +build linux,ppc64le package unix @@ -349,16 +348,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go index 9fee3b1d..2cfe34ad 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && riscv64 -// +build linux,riscv64 package unix @@ -269,16 +268,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { @@ -541,3 +530,19 @@ func kexecFileLoad(kernelFd int, initrdFd int, cmdlineLen int, cmdline string, f } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func riscvHWProbe(pairs []RISCVHWProbePairs, cpuCount uintptr, cpus *CPUSet, flags uint) (err error) { + var _p0 unsafe.Pointer + if len(pairs) > 0 { + _p0 = unsafe.Pointer(&pairs[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, e1 := Syscall6(SYS_RISCV_HWPROBE, uintptr(_p0), uintptr(len(pairs)), uintptr(cpuCount), uintptr(unsafe.Pointer(cpus)), uintptr(flags), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go index 647bbfec..61e6f070 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && s390x -// +build linux,s390x package unix @@ -319,16 +318,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) { r0, _, e1 := Syscall6(SYS_SPLICE, uintptr(rfd), uintptr(unsafe.Pointer(roff)), uintptr(wfd), uintptr(unsafe.Pointer(woff)), uintptr(len), uintptr(flags)) n = int64(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go index ada057f8..834b8420 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build linux && sparc64 -// +build linux,sparc64 package unix @@ -329,16 +328,6 @@ func setfsuid(uid int) (prev int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(resource int, rlim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Shutdown(fd int, how int) (err error) { _, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go index 8e1d9c8f..e91ebc14 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build netbsd && 386 -// +build netbsd,386 package unix @@ -1607,16 +1606,6 @@ func Setreuid(ruid int, euid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1834,20 +1823,13 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) + _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } @@ -1856,13 +1838,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) if e1 != 0 { err = errnoErr(e1) } diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go index 21c69504..be28babb 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build netbsd && amd64 -// +build netbsd,amd64 package unix @@ -1607,16 +1606,6 @@ func Setreuid(ruid int, euid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1834,20 +1823,13 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) + _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } @@ -1856,13 +1838,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) if e1 != 0 { err = errnoErr(e1) } diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go index 298168f9..fb587e82 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build netbsd && arm -// +build netbsd,arm package unix @@ -1607,16 +1606,6 @@ func Setreuid(ruid int, euid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1834,20 +1823,13 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) + _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } @@ -1856,13 +1838,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) if e1 != 0 { err = errnoErr(e1) } diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go index 68b8bd49..d576438b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build netbsd && arm64 -// +build netbsd,arm64 package unix @@ -1607,16 +1606,6 @@ func Setreuid(ruid int, euid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setsid() (pid int, err error) { r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0) pid = int(r0) @@ -1834,20 +1823,13 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) +func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(path) + if err != nil { + return } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) + _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) if e1 != 0 { err = errnoErr(e1) } @@ -1856,13 +1838,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0) +func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) { + r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0) + xaddr = uintptr(r0) if e1 != 0 { err = errnoErr(e1) } diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go index 0b0f910e..a1d06159 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && 386 -// +build openbsd,386 package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -1894,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { @@ -2203,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2212,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2241,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" + + diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s index 08744425..41b56173 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4 DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4 @@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $4 DATA ·libc_sysctl_trampoline_addr(SB)/4, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fcntl_trampoline_addr(SB)/4, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $4 @@ -573,11 +588,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $4 DATA ·libc_setresuid_trampoline_addr(SB)/4, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $4 -DATA ·libc_setrlimit_trampoline_addr(SB)/4, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setrtable(SB) GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $4 @@ -663,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $4 DATA ·libc_munmap_trampoline_addr(SB)/4, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getfsstat(SB) +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getfsstat_trampoline_addr(SB)/4, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $4 DATA ·libc_utimensat_trampoline_addr(SB)/4, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pledge(SB) +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $4 +DATA ·libc_pledge_trampoline_addr(SB)/4, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unveil(SB) +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $4 +DATA ·libc_unveil_trampoline_addr(SB)/4, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go index 48ff5de7..5b2a7409 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && amd64 -// +build openbsd,amd64 package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -1894,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { @@ -2203,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2212,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2241,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" + + diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s index 5782cd10..4019a656 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 @@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 @@ -573,11 +588,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setrtable(SB) GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $8 @@ -663,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getfsstat(SB) +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pledge(SB) +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unveil(SB) +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go index 2452a641..f6eda134 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && arm -// +build openbsd,arm package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -1894,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { @@ -2203,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2212,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2241,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" + + diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s index cf310420..ac4af24f 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4 DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4 @@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $4 DATA ·libc_sysctl_trampoline_addr(SB)/4, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $4 +DATA ·libc_fcntl_trampoline_addr(SB)/4, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $4 @@ -573,11 +588,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $4 DATA ·libc_setresuid_trampoline_addr(SB)/4, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $4 -DATA ·libc_setrlimit_trampoline_addr(SB)/4, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setrtable(SB) GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $4 @@ -663,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $4 DATA ·libc_munmap_trampoline_addr(SB)/4, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getfsstat(SB) +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getfsstat_trampoline_addr(SB)/4, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $4 DATA ·libc_utimensat_trampoline_addr(SB)/4, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pledge(SB) +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $4 +DATA ·libc_pledge_trampoline_addr(SB)/4, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unveil(SB) +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $4 +DATA ·libc_unveil_trampoline_addr(SB)/4, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go index 5e35600a..55df20ae 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && arm64 -// +build openbsd,arm64 package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -1894,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { @@ -2203,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2212,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2241,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" + + diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s index 484bb42e..f77d5321 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 @@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 @@ -573,11 +588,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setrtable(SB) GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $8 @@ -663,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getfsstat(SB) +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pledge(SB) +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unveil(SB) +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go index b04cef1a..8c1155cb 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && mips64 -// +build openbsd,mips64 package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -1894,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { @@ -2203,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2212,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2241,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" + + diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s index 55af2726..fae140b6 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 @@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 @@ -573,11 +588,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setrtable(SB) GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $8 @@ -663,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getfsstat(SB) +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pledge(SB) +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unveil(SB) +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go index 47a07ee0..7cc80c58 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && ppc64 -// +build openbsd,ppc64 package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -1894,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { @@ -2203,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2212,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2241,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" + + diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s index 4028255b..9d1e0ff0 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s @@ -189,6 +189,18 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getresuid(SB) + RET +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getresgid(SB) + RET +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 CALL libc_ioctl(SB) RET @@ -201,6 +213,12 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_fcntl(SB) + RET +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 CALL libc_ppoll(SB) RET @@ -687,12 +705,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - CALL libc_setrlimit(SB) - RET -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 CALL libc_setrtable(SB) RET @@ -795,8 +807,26 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getfsstat(SB) + RET +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 CALL libc_utimensat(SB) RET GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_pledge(SB) + RET +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_unveil(SB) + RET +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go index 573378fd..0688737f 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build openbsd && riscv64 -// +build openbsd,riscv64 package unix @@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -527,6 +548,12 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { return } +var libc_ioctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { @@ -535,10 +562,6 @@ func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { return } -var libc_ioctl_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_ioctl ioctl "libc.so" - // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { @@ -561,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func fcntl(fd int, cmd int, arg int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_fcntl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_fcntl fcntl "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg)) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) { r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0) n = int(r0) @@ -1894,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -var libc_setrlimit_trampoline_addr uintptr - -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Setrtable(rtable int) (err error) { _, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0) if e1 != 0 { @@ -2203,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) +func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) { + r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags)) n = int(r0) if e1 != 0 { err = errnoErr(e1) @@ -2212,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) { return } -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +var libc_getfsstat_trampoline_addr uintptr -func writelen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} +//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so" // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT @@ -2241,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error var libc_utimensat_trampoline_addr uintptr //go:cgo_import_dynamic libc_utimensat utimensat "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pledge(promises *byte, execpromises *byte) (err error) { + _, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pledge_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pledge pledge "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func unveil(path *byte, flags *byte) (err error) { + _, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_unveil_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_unveil unveil "libc.so" + + diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s index e1fbd4df..da115f9a 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 @@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) +TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_fcntl(SB) +GLOBL ·libc_fcntl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB) + TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ppoll(SB) GLOBL ·libc_ppoll_trampoline_addr(SB), RODATA, $8 @@ -573,11 +588,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_setresuid_trampoline_addr(SB), RODATA, $8 DATA ·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB) -TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0 - JMP libc_setrlimit(SB) -GLOBL ·libc_setrlimit_trampoline_addr(SB), RODATA, $8 -DATA ·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB) - TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_setrtable(SB) GLOBL ·libc_setrtable_trampoline_addr(SB), RODATA, $8 @@ -663,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) +TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getfsstat(SB) +GLOBL ·libc_getfsstat_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB) + TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_utimensat(SB) GLOBL ·libc_utimensat_trampoline_addr(SB), RODATA, $8 DATA ·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB) + +TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pledge(SB) +GLOBL ·libc_pledge_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB) + +TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_unveil(SB) +GLOBL ·libc_unveil_trampoline_addr(SB), RODATA, $8 +DATA ·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go index 4873a1e5..829b87fe 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build solaris && amd64 -// +build solaris,amd64 package unix @@ -110,7 +109,6 @@ import ( //go:cgo_import_dynamic libc_setpriority setpriority "libc.so" //go:cgo_import_dynamic libc_setregid setregid "libc.so" //go:cgo_import_dynamic libc_setreuid setreuid "libc.so" -//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so" //go:cgo_import_dynamic libc_setsid setsid "libc.so" //go:cgo_import_dynamic libc_setuid setuid "libc.so" //go:cgo_import_dynamic libc_shutdown shutdown "libsocket.so" @@ -250,7 +248,6 @@ import ( //go:linkname procSetpriority libc_setpriority //go:linkname procSetregid libc_setregid //go:linkname procSetreuid libc_setreuid -//go:linkname procSetrlimit libc_setrlimit //go:linkname procSetsid libc_setsid //go:linkname procSetuid libc_setuid //go:linkname procshutdown libc_shutdown @@ -391,7 +388,6 @@ var ( procSetpriority, procSetregid, procSetreuid, - procSetrlimit, procSetsid, procSetuid, procshutdown, @@ -439,7 +435,7 @@ func pipe(p *[2]_C_int) (n int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procpipe)), 1, uintptr(unsafe.Pointer(p)), 0, 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -449,7 +445,7 @@ func pipe(p *[2]_C_int) (n int, err error) { func pipe2(p *[2]_C_int, flags int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procpipe2)), 2, uintptr(unsafe.Pointer(p)), uintptr(flags), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -459,7 +455,7 @@ func pipe2(p *[2]_C_int, flags int) (err error) { func getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procgetsockname)), 3, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -474,7 +470,7 @@ func Getcwd(buf []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procGetcwd)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -485,7 +481,7 @@ func getgroups(ngid int, gid *_Gid_t) (n int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procgetgroups)), 2, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -495,7 +491,7 @@ func getgroups(ngid int, gid *_Gid_t) (n int, err error) { func setgroups(ngid int, gid *_Gid_t) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procsetgroups)), 2, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -506,7 +502,7 @@ func wait4(pid int32, statusp *_C_int, options int, rusage *Rusage) (wpid int32, r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwait4)), 4, uintptr(pid), uintptr(unsafe.Pointer(statusp)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0) wpid = int32(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -521,7 +517,7 @@ func gethostname(buf []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procgethostname)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -536,7 +532,7 @@ func utimes(path string, times *[2]Timeval) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procutimes)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -551,7 +547,7 @@ func utimensat(fd int, path string, times *[2]Timespec, flag int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procutimensat)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flag), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -562,7 +558,7 @@ func fcntl(fd int, cmd int, arg int) (val int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procfcntl)), 3, uintptr(fd), uintptr(cmd), uintptr(arg), 0, 0, 0) val = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -572,7 +568,7 @@ func fcntl(fd int, cmd int, arg int) (val int, err error) { func futimesat(fildes int, path *byte, times *[2]Timeval) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procfutimesat)), 3, uintptr(fildes), uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(times)), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -583,7 +579,7 @@ func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procaccept)), 3, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), 0, 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -594,7 +590,7 @@ func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_recvmsg)), 3, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -605,7 +601,7 @@ func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_sendmsg)), 3, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -615,7 +611,7 @@ func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { func acct(path *byte) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procacct)), 1, uintptr(unsafe.Pointer(path)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -646,22 +642,22 @@ func __minor(version int, dev uint64) (val uint) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctlRet(fd int, req uint, arg uintptr) (ret int, err error) { +func ioctlRet(fd int, req int, arg uintptr) (ret int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procioctl)), 3, uintptr(fd), uintptr(req), uintptr(arg), 0, 0, 0) ret = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctlPtrRet(fd int, req uint, arg unsafe.Pointer) (ret int, err error) { +func ioctlPtrRet(fd int, req int, arg unsafe.Pointer) (ret int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procioctl)), 3, uintptr(fd), uintptr(req), uintptr(arg), 0, 0, 0) ret = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -672,7 +668,7 @@ func poll(fds *PollFd, nfds int, timeout int) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpoll)), 3, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -687,7 +683,7 @@ func Access(path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procAccess)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -697,7 +693,7 @@ func Access(path string, mode uint32) (err error) { func Adjtime(delta *Timeval, olddelta *Timeval) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procAdjtime)), 2, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -712,7 +708,7 @@ func Chdir(path string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChdir)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -727,7 +723,7 @@ func Chmod(path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChmod)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -742,7 +738,7 @@ func Chown(path string, uid int, gid int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChown)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -757,7 +753,7 @@ func Chroot(path string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChroot)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -767,7 +763,7 @@ func Chroot(path string) (err error) { func ClockGettime(clockid int32, time *Timespec) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procClockGettime)), 2, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -777,7 +773,7 @@ func ClockGettime(clockid int32, time *Timespec) (err error) { func Close(fd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procClose)), 1, uintptr(fd), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -793,7 +789,7 @@ func Creat(path string, mode uint32) (fd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procCreat)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -804,7 +800,7 @@ func Dup(fd int) (nfd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procDup)), 1, uintptr(fd), 0, 0, 0, 0, 0) nfd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -814,7 +810,7 @@ func Dup(fd int) (nfd int, err error) { func Dup2(oldfd int, newfd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procDup2)), 2, uintptr(oldfd), uintptr(newfd), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -836,7 +832,7 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFaccessat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -846,7 +842,7 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) { func Fchdir(fd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchdir)), 1, uintptr(fd), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -856,7 +852,7 @@ func Fchdir(fd int) (err error) { func Fchmod(fd int, mode uint32) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchmod)), 2, uintptr(fd), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -871,7 +867,7 @@ func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchmodat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -881,7 +877,7 @@ func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) { func Fchown(fd int, uid int, gid int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchown)), 3, uintptr(fd), uintptr(uid), uintptr(gid), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -896,7 +892,7 @@ func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchownat)), 5, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -906,7 +902,7 @@ func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) { func Fdatasync(fd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFdatasync)), 1, uintptr(fd), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -916,7 +912,7 @@ func Fdatasync(fd int) (err error) { func Flock(fd int, how int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFlock)), 2, uintptr(fd), uintptr(how), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -927,7 +923,7 @@ func Fpathconf(fd int, name int) (val int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFpathconf)), 2, uintptr(fd), uintptr(name), 0, 0, 0, 0) val = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -937,7 +933,7 @@ func Fpathconf(fd int, name int) (val int, err error) { func Fstat(fd int, stat *Stat_t) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFstat)), 2, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -952,7 +948,7 @@ func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFstatat)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -962,7 +958,7 @@ func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { func Fstatvfs(fd int, vfsstat *Statvfs_t) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFstatvfs)), 2, uintptr(fd), uintptr(unsafe.Pointer(vfsstat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -977,7 +973,7 @@ func Getdents(fd int, buf []byte, basep *uintptr) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procGetdents)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), uintptr(unsafe.Pointer(basep)), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1004,7 +1000,7 @@ func Getpgid(pid int) (pgid int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetpgid)), 1, uintptr(pid), 0, 0, 0, 0, 0) pgid = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1015,7 +1011,7 @@ func Getpgrp() (pgid int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetpgrp)), 0, 0, 0, 0, 0, 0, 0) pgid = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1050,7 +1046,7 @@ func Getpriority(which int, who int) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procGetpriority)), 2, uintptr(which), uintptr(who), 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1060,7 +1056,7 @@ func Getpriority(which int, who int) (n int, err error) { func Getrlimit(which int, lim *Rlimit) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetrlimit)), 2, uintptr(which), uintptr(unsafe.Pointer(lim)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1070,7 +1066,7 @@ func Getrlimit(which int, lim *Rlimit) (err error) { func Getrusage(who int, rusage *Rusage) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetrusage)), 2, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1081,7 +1077,7 @@ func Getsid(pid int) (sid int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetsid)), 1, uintptr(pid), 0, 0, 0, 0, 0) sid = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1091,7 +1087,7 @@ func Getsid(pid int) (sid int, err error) { func Gettimeofday(tv *Timeval) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGettimeofday)), 1, uintptr(unsafe.Pointer(tv)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1109,7 +1105,7 @@ func Getuid() (uid int) { func Kill(pid int, signum syscall.Signal) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procKill)), 2, uintptr(pid), uintptr(signum), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1124,7 +1120,7 @@ func Lchown(path string, uid int, gid int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procLchown)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1144,7 +1140,7 @@ func Link(path string, link string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procLink)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1154,7 +1150,7 @@ func Link(path string, link string) (err error) { func Listen(s int, backlog int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_llisten)), 2, uintptr(s), uintptr(backlog), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1169,7 +1165,7 @@ func Lstat(path string, stat *Stat_t) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procLstat)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1183,7 +1179,7 @@ func Madvise(b []byte, advice int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMadvise)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), uintptr(advice), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1198,7 +1194,7 @@ func Mkdir(path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkdir)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1213,7 +1209,7 @@ func Mkdirat(dirfd int, path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkdirat)), 3, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1228,7 +1224,7 @@ func Mkfifo(path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkfifo)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1243,7 +1239,7 @@ func Mkfifoat(dirfd int, path string, mode uint32) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkfifoat)), 3, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1258,7 +1254,7 @@ func Mknod(path string, mode uint32, dev int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMknod)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1273,7 +1269,7 @@ func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMknodat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1287,7 +1283,7 @@ func Mlock(b []byte) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMlock)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1297,7 +1293,7 @@ func Mlock(b []byte) (err error) { func Mlockall(flags int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMlockall)), 1, uintptr(flags), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1311,7 +1307,7 @@ func Mprotect(b []byte, prot int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMprotect)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), uintptr(prot), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1325,7 +1321,7 @@ func Msync(b []byte, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMsync)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), uintptr(flags), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1339,7 +1335,7 @@ func Munlock(b []byte) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMunlock)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1349,7 +1345,7 @@ func Munlock(b []byte) (err error) { func Munlockall() (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMunlockall)), 0, 0, 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1359,7 +1355,7 @@ func Munlockall() (err error) { func Nanosleep(time *Timespec, leftover *Timespec) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procNanosleep)), 2, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1375,7 +1371,7 @@ func Open(path string, mode int, perm uint32) (fd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procOpen)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1391,7 +1387,7 @@ func Openat(dirfd int, path string, flags int, mode uint32) (fd int, err error) r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procOpenat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags), uintptr(mode), 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1407,7 +1403,7 @@ func Pathconf(path string, name int) (val int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procPathconf)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0, 0, 0, 0) val = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1417,7 +1413,7 @@ func Pathconf(path string, name int) (val int, err error) { func Pause() (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procPause)), 0, 0, 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1432,7 +1428,7 @@ func pread(fd int, p []byte, offset int64) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpread)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), uintptr(offset), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1447,7 +1443,7 @@ func pwrite(fd int, p []byte, offset int64) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpwrite)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), uintptr(offset), 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1462,7 +1458,7 @@ func read(fd int, p []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procread)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1482,7 +1478,7 @@ func Readlink(path string, buf []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procReadlink)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), uintptr(len(buf)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1502,7 +1498,7 @@ func Rename(from string, to string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procRename)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1522,7 +1518,7 @@ func Renameat(olddirfd int, oldpath string, newdirfd int, newpath string) (err e } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procRenameat)), 4, uintptr(olddirfd), uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1)), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1537,7 +1533,7 @@ func Rmdir(path string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procRmdir)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1548,7 +1544,7 @@ func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proclseek)), 3, uintptr(fd), uintptr(offset), uintptr(whence), 0, 0, 0) newoffset = int64(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1559,7 +1555,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSelect)), 5, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1569,7 +1565,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err func Setegid(egid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetegid)), 1, uintptr(egid), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1579,7 +1575,7 @@ func Setegid(egid int) (err error) { func Seteuid(euid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSeteuid)), 1, uintptr(euid), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1589,7 +1585,7 @@ func Seteuid(euid int) (err error) { func Setgid(gid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetgid)), 1, uintptr(gid), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1603,7 +1599,7 @@ func Sethostname(p []byte) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSethostname)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1613,7 +1609,7 @@ func Sethostname(p []byte) (err error) { func Setpgid(pid int, pgid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetpgid)), 2, uintptr(pid), uintptr(pgid), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1623,7 +1619,7 @@ func Setpgid(pid int, pgid int) (err error) { func Setpriority(which int, who int, prio int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSetpriority)), 3, uintptr(which), uintptr(who), uintptr(prio), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1633,7 +1629,7 @@ func Setpriority(which int, who int, prio int) (err error) { func Setregid(rgid int, egid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetregid)), 2, uintptr(rgid), uintptr(egid), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1643,17 +1639,7 @@ func Setregid(rgid int, egid int) (err error) { func Setreuid(ruid int, euid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetreuid)), 2, uintptr(ruid), uintptr(euid), 0, 0, 0, 0) if e1 != 0 { - err = e1 - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Setrlimit(which int, lim *Rlimit) (err error) { - _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetrlimit)), 2, uintptr(which), uintptr(unsafe.Pointer(lim)), 0, 0, 0, 0) - if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1664,7 +1650,7 @@ func Setsid() (pid int, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetsid)), 0, 0, 0, 0, 0, 0, 0) pid = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1674,7 +1660,7 @@ func Setsid() (pid int, err error) { func Setuid(uid int) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetuid)), 1, uintptr(uid), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1684,7 +1670,7 @@ func Setuid(uid int) (err error) { func Shutdown(s int, how int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procshutdown)), 2, uintptr(s), uintptr(how), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1699,7 +1685,7 @@ func Stat(path string, stat *Stat_t) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procStat)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1714,7 +1700,7 @@ func Statvfs(path string, vfsstat *Statvfs_t) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procStatvfs)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(vfsstat)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1734,7 +1720,7 @@ func Symlink(path string, link string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSymlink)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1744,7 +1730,7 @@ func Symlink(path string, link string) (err error) { func Sync() (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSync)), 0, 0, 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1755,7 +1741,7 @@ func Sysconf(which int) (n int64, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSysconf)), 1, uintptr(which), 0, 0, 0, 0, 0) n = int64(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1766,7 +1752,7 @@ func Times(tms *Tms) (ticks uintptr, err error) { r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procTimes)), 1, uintptr(unsafe.Pointer(tms)), 0, 0, 0, 0, 0) ticks = uintptr(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1781,7 +1767,7 @@ func Truncate(path string, length int64) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procTruncate)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(length), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1791,7 +1777,7 @@ func Truncate(path string, length int64) (err error) { func Fsync(fd int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFsync)), 1, uintptr(fd), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1801,7 +1787,7 @@ func Fsync(fd int) (err error) { func Ftruncate(fd int, length int64) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFtruncate)), 2, uintptr(fd), uintptr(length), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1819,7 +1805,7 @@ func Umask(mask int) (oldmask int) { func Uname(buf *Utsname) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procUname)), 1, uintptr(unsafe.Pointer(buf)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1834,7 +1820,7 @@ func Unmount(target string, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procumount)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1849,7 +1835,7 @@ func Unlink(path string) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUnlink)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1864,7 +1850,7 @@ func Unlinkat(dirfd int, path string, flags int) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUnlinkat)), 3, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1874,7 +1860,7 @@ func Unlinkat(dirfd int, path string, flags int) (err error) { func Ustat(dev int, ubuf *Ustat_t) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUstat)), 2, uintptr(dev), uintptr(unsafe.Pointer(ubuf)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1889,7 +1875,7 @@ func Utime(path string, buf *Utimbuf) (err error) { } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUtime)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(buf)), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1899,7 +1885,7 @@ func Utime(path string, buf *Utimbuf) (err error) { func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_bind)), 3, uintptr(s), uintptr(addr), uintptr(addrlen), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1909,7 +1895,7 @@ func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { func connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_connect)), 3, uintptr(s), uintptr(addr), uintptr(addrlen), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1920,7 +1906,7 @@ func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) ( r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procmmap)), 6, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), uintptr(pos)) ret = uintptr(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1930,7 +1916,7 @@ func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) ( func munmap(addr uintptr, length uintptr) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procmunmap)), 2, uintptr(addr), uintptr(length), 0, 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1941,7 +1927,7 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procsendfile)), 4, uintptr(outfd), uintptr(infd), uintptr(unsafe.Pointer(offset)), uintptr(count), 0, 0) written = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1955,7 +1941,7 @@ func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) ( } _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_sendto)), 6, uintptr(s), uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen)) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1966,7 +1952,7 @@ func socket(domain int, typ int, proto int) (fd int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_socket)), 3, uintptr(domain), uintptr(typ), uintptr(proto), 0, 0, 0) fd = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1976,7 +1962,7 @@ func socket(domain int, typ int, proto int) (fd int, err error) { func socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&proc__xnet_socketpair)), 4, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -1991,7 +1977,7 @@ func write(fd int, p []byte) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwrite)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2001,7 +1987,7 @@ func write(fd int, p []byte) (n int, err error) { func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_getsockopt)), 5, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2011,7 +1997,7 @@ func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procgetpeername)), 3, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), 0, 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2021,7 +2007,7 @@ func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) { func setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procsetsockopt)), 5, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2036,7 +2022,7 @@ func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Sockl r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procrecvfrom)), 6, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen))) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2047,7 +2033,7 @@ func port_create() (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_create)), 0, 0, 0, 0, 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2058,7 +2044,7 @@ func port_associate(port int, source int, object uintptr, events int, user *byte r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_associate)), 5, uintptr(port), uintptr(source), uintptr(object), uintptr(events), uintptr(unsafe.Pointer(user)), 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2069,7 +2055,7 @@ func port_dissociate(port int, source int, object uintptr) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_dissociate)), 3, uintptr(port), uintptr(source), uintptr(object), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2080,7 +2066,7 @@ func port_get(port int, pe *portEvent, timeout *Timespec) (n int, err error) { r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_get)), 3, uintptr(port), uintptr(unsafe.Pointer(pe)), uintptr(unsafe.Pointer(timeout)), 0, 0, 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2091,7 +2077,7 @@ func port_getn(port int, pe *portEvent, max uint32, nget *uint32, timeout *Times r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_getn)), 5, uintptr(port), uintptr(unsafe.Pointer(pe)), uintptr(max), uintptr(unsafe.Pointer(nget)), uintptr(unsafe.Pointer(timeout)), 0) n = int(r0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2101,7 +2087,7 @@ func port_getn(port int, pe *portEvent, max uint32, nget *uint32, timeout *Times func putmsg(fd int, clptr *strbuf, dataptr *strbuf, flags int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procputmsg)), 4, uintptr(fd), uintptr(unsafe.Pointer(clptr)), uintptr(unsafe.Pointer(dataptr)), uintptr(flags), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } @@ -2111,7 +2097,7 @@ func putmsg(fd int, clptr *strbuf, dataptr *strbuf, flags int) (err error) { func getmsg(fd int, clptr *strbuf, dataptr *strbuf, flags *int) (err error) { _, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procgetmsg)), 4, uintptr(fd), uintptr(unsafe.Pointer(clptr)), uintptr(unsafe.Pointer(dataptr)), uintptr(unsafe.Pointer(flags)), 0, 0) if e1 != 0 { - err = e1 + err = errnoErr(e1) } return } diff --git a/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go b/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go index 07bfe2ef..94f01123 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build zos && s390x -// +build zos,s390x package unix @@ -40,17 +39,6 @@ func read(fd int, p []byte) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func readlen(fd int, buf *byte, nbuf int) (n int, err error) { - r0, _, e1 := syscall_syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf)) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func write(fd int, p []byte) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { @@ -257,7 +245,7 @@ func munmap(addr uintptr, length uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctl(fd int, req uint, arg uintptr) (err error) { +func ioctl(fd int, req int, arg uintptr) (err error) { _, _, e1 := syscall_syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { err = errnoErr(e1) @@ -267,7 +255,7 @@ func ioctl(fd int, req uint, arg uintptr) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { +func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) { _, _, e1 := syscall_syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { err = errnoErr(e1) diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go index 55e04847..3a58ae81 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build 386 && openbsd -// +build 386,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go index d2243cf8..dcb7a0eb 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build amd64 && openbsd -// +build amd64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go index 82dc51bd..db5a7bf1 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build arm && openbsd -// +build arm,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go index cbdda1a4..7be575a7 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build arm64 && openbsd -// +build arm64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go index f55eae1a..d6e3174c 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build mips64 && openbsd -// +build mips64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go index e4405447..ee97157d 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build ppc64 && openbsd -// +build ppc64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go index a0db82fc..35c3b91d 100644 --- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build riscv64 && openbsd -// +build riscv64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_darwin_amd64.go index f8298ff9..5edda768 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_darwin_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && darwin -// +build amd64,darwin package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_darwin_arm64.go index 5eb433bb..0dc9e8b4 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_darwin_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && darwin -// +build arm64,darwin package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_dragonfly_amd64.go index 703675c0..308ddf3a 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_dragonfly_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_dragonfly_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && dragonfly -// +build amd64,dragonfly package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go index 4e0d9610..418664e3 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && freebsd -// +build 386,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go index 01636b83..34d0b86d 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && freebsd -// +build amd64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go index ad99bc10..b71cf45e 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && freebsd -// +build arm,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go index 89dcc427..e32df1c1 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && freebsd -// +build arm64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_riscv64.go index ee37aaa0..15ad6111 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && freebsd -// +build riscv64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go index c9c4ad03..fcf3ecbd 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && linux -// +build 386,linux package unix @@ -447,4 +446,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go index 12ff3417..f56dc250 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && linux -// +build amd64,linux package unix @@ -369,4 +368,7 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 + SYS_MAP_SHADOW_STACK = 453 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go index c3fb5e77..974bf246 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && linux -// +build arm,linux package unix @@ -411,4 +410,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go index 358c847a..39a2739e 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && linux -// +build arm64,linux package unix @@ -314,4 +313,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go index 81c4849b..cf9c9d77 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build loong64 && linux -// +build loong64,linux package unix @@ -308,4 +307,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go index 202a57e9..10b7362e 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips && linux -// +build mips,linux package unix @@ -431,4 +430,6 @@ const ( SYS_PROCESS_MRELEASE = 4448 SYS_FUTEX_WAITV = 4449 SYS_SET_MEMPOLICY_HOME_NODE = 4450 + SYS_CACHESTAT = 4451 + SYS_FCHMODAT2 = 4452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go index 1fbceb52..cd4d8b4f 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && linux -// +build mips64,linux package unix @@ -361,4 +360,6 @@ const ( SYS_PROCESS_MRELEASE = 5448 SYS_FUTEX_WAITV = 5449 SYS_SET_MEMPOLICY_HOME_NODE = 5450 + SYS_CACHESTAT = 5451 + SYS_FCHMODAT2 = 5452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go index b4ffb7a2..2c0efca8 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64le && linux -// +build mips64le,linux package unix @@ -361,4 +360,6 @@ const ( SYS_PROCESS_MRELEASE = 5448 SYS_FUTEX_WAITV = 5449 SYS_SET_MEMPOLICY_HOME_NODE = 5450 + SYS_CACHESTAT = 5451 + SYS_FCHMODAT2 = 5452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go index 867985f9..a72e31d3 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mipsle && linux -// +build mipsle,linux package unix @@ -431,4 +430,6 @@ const ( SYS_PROCESS_MRELEASE = 4448 SYS_FUTEX_WAITV = 4449 SYS_SET_MEMPOLICY_HOME_NODE = 4450 + SYS_CACHESTAT = 4451 + SYS_FCHMODAT2 = 4452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go index a8cce69e..c7d1e374 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && linux -// +build ppc,linux package unix @@ -438,4 +437,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go index d44c5b39..f4d4838c 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && linux -// +build ppc64,linux package unix @@ -410,4 +409,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go index 4214dd9c..b64f0e59 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64le && linux -// +build ppc64le,linux package unix @@ -410,4 +409,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go index 3e594a8c..95711195 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && linux -// +build riscv64,linux package unix @@ -251,6 +250,8 @@ const ( SYS_ACCEPT4 = 242 SYS_RECVMMSG = 243 SYS_ARCH_SPECIFIC_SYSCALL = 244 + SYS_RISCV_HWPROBE = 258 + SYS_RISCV_FLUSH_ICACHE = 259 SYS_WAIT4 = 260 SYS_PRLIMIT64 = 261 SYS_FANOTIFY_INIT = 262 @@ -313,4 +314,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go index 7ea46520..f94e943b 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build s390x && linux -// +build s390x,linux package unix @@ -372,7 +371,10 @@ const ( SYS_LANDLOCK_CREATE_RULESET = 444 SYS_LANDLOCK_ADD_RULE = 445 SYS_LANDLOCK_RESTRICT_SELF = 446 + SYS_MEMFD_SECRET = 447 SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go index 92f628ef..ba0c2bc5 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build sparc64 && linux -// +build sparc64,linux package unix @@ -389,4 +388,6 @@ const ( SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 + SYS_CACHESTAT = 451 + SYS_FCHMODAT2 = 452 ) diff --git a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_386.go b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_386.go index 3a6699eb..b2aa8cd4 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && netbsd -// +build 386,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_amd64.go index 5677cd4f..524a1b1c 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && netbsd -// +build amd64,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm.go index e784cb6d..d59b943a 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && netbsd -// +build arm,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm64.go index bd4952ef..31e771d5 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; DO NOT EDIT. //go:build arm64 && netbsd -// +build arm64,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go index 59773381..9fd77c6c 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && openbsd -// +build 386,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go index 16af2918..af10af28 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && openbsd -// +build amd64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go index f59b18a9..cc2028af 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && openbsd -// +build arm,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go index 721ef591..c06dd441 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && openbsd -// +build arm64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go index 01c43a01..9ddbf3e0 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && openbsd -// +build mips64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go index f258cfa2..19a6ee41 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && openbsd -// +build ppc64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go index 07919e0e..05192a78 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && openbsd -// +build riscv64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go b/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go index 073daad4..b2e30858 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go index 7a8161c1..3e6d57ca 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go +++ b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && aix -// +build ppc,aix package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go index 07ed733c..3a219bdc 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && aix -// +build ppc64,aix package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go index e2a64f09..091d107f 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && darwin -// +build amd64,darwin package unix @@ -151,6 +150,16 @@ type Dirent struct { _ [3]byte } +type Attrlist struct { + Bitmapcount uint16 + Reserved uint16 + Commonattr uint32 + Volattr uint32 + Dirattr uint32 + Fileattr uint32 + Forkattr uint32 +} + const ( PathMax = 0x400 ) @@ -610,6 +619,7 @@ const ( AT_REMOVEDIR = 0x80 AT_SYMLINK_FOLLOW = 0x40 AT_SYMLINK_NOFOLLOW = 0x20 + AT_EACCESS = 0x10 ) type PollFd struct { diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go index 34aa7752..28ff4ef7 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && darwin -// +build arm64,darwin package unix @@ -151,6 +150,16 @@ type Dirent struct { _ [3]byte } +type Attrlist struct { + Bitmapcount uint16 + Reserved uint16 + Commonattr uint32 + Volattr uint32 + Dirattr uint32 + Fileattr uint32 + Forkattr uint32 +} + const ( PathMax = 0x400 ) @@ -610,6 +619,7 @@ const ( AT_REMOVEDIR = 0x80 AT_SYMLINK_FOLLOW = 0x40 AT_SYMLINK_NOFOLLOW = 0x20 + AT_EACCESS = 0x10 ) type PollFd struct { diff --git a/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go index d0ba8e9b..30e405bb 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && dragonfly -// +build amd64,dragonfly package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go index 29dc4833..6cbd094a 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && freebsd -// +build 386,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go index 0a89b289..7c03b6ee 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && freebsd -// +build amd64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go index c8666bb1..422107ee 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && freebsd -// +build arm,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go index 88fb48a8..505a12ac 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && freebsd -// +build arm64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go index 698dc975..cc986c79 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && freebsd -// +build riscv64,freebsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux.go b/vendor/golang.org/x/sys/unix/ztypes_linux.go index ca84727c..bbf8399f 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux.go @@ -1,7 +1,6 @@ // Code generated by mkmerge; DO NOT EDIT. //go:build linux -// +build linux package unix @@ -866,6 +865,11 @@ const ( POLLNVAL = 0x20 ) +type sigset_argpack struct { + ss *Sigset_t + ssLen uintptr +} + type SignalfdSiginfo struct { Signo uint32 Errno int32 @@ -1538,6 +1542,10 @@ const ( IFLA_GRO_MAX_SIZE = 0x3a IFLA_TSO_MAX_SIZE = 0x3b IFLA_TSO_MAX_SEGS = 0x3c + IFLA_ALLMULTI = 0x3d + IFLA_DEVLINK_PORT = 0x3e + IFLA_GSO_IPV4_MAX_SIZE = 0x3f + IFLA_GRO_IPV4_MAX_SIZE = 0x40 IFLA_PROTO_DOWN_REASON_UNSPEC = 0x0 IFLA_PROTO_DOWN_REASON_MASK = 0x1 IFLA_PROTO_DOWN_REASON_VALUE = 0x2 @@ -1968,7 +1976,7 @@ const ( NFT_MSG_GETFLOWTABLE = 0x17 NFT_MSG_DELFLOWTABLE = 0x18 NFT_MSG_GETRULE_RESET = 0x19 - NFT_MSG_MAX = 0x1a + NFT_MSG_MAX = 0x22 NFTA_LIST_UNSPEC = 0x0 NFTA_LIST_ELEM = 0x1 NFTA_HOOK_UNSPEC = 0x0 @@ -2555,6 +2563,11 @@ const ( BPF_REG_8 = 0x8 BPF_REG_9 = 0x9 BPF_REG_10 = 0xa + BPF_CGROUP_ITER_ORDER_UNSPEC = 0x0 + BPF_CGROUP_ITER_SELF_ONLY = 0x1 + BPF_CGROUP_ITER_DESCENDANTS_PRE = 0x2 + BPF_CGROUP_ITER_DESCENDANTS_POST = 0x3 + BPF_CGROUP_ITER_ANCESTORS_UP = 0x4 BPF_MAP_CREATE = 0x0 BPF_MAP_LOOKUP_ELEM = 0x1 BPF_MAP_UPDATE_ELEM = 0x2 @@ -2566,6 +2579,7 @@ const ( BPF_PROG_ATTACH = 0x8 BPF_PROG_DETACH = 0x9 BPF_PROG_TEST_RUN = 0xa + BPF_PROG_RUN = 0xa BPF_PROG_GET_NEXT_ID = 0xb BPF_MAP_GET_NEXT_ID = 0xc BPF_PROG_GET_FD_BY_ID = 0xd @@ -2610,6 +2624,7 @@ const ( BPF_MAP_TYPE_CPUMAP = 0x10 BPF_MAP_TYPE_XSKMAP = 0x11 BPF_MAP_TYPE_SOCKHASH = 0x12 + BPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATED = 0x13 BPF_MAP_TYPE_CGROUP_STORAGE = 0x13 BPF_MAP_TYPE_REUSEPORT_SOCKARRAY = 0x14 BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE = 0x15 @@ -2620,6 +2635,10 @@ const ( BPF_MAP_TYPE_STRUCT_OPS = 0x1a BPF_MAP_TYPE_RINGBUF = 0x1b BPF_MAP_TYPE_INODE_STORAGE = 0x1c + BPF_MAP_TYPE_TASK_STORAGE = 0x1d + BPF_MAP_TYPE_BLOOM_FILTER = 0x1e + BPF_MAP_TYPE_USER_RINGBUF = 0x1f + BPF_MAP_TYPE_CGRP_STORAGE = 0x20 BPF_PROG_TYPE_UNSPEC = 0x0 BPF_PROG_TYPE_SOCKET_FILTER = 0x1 BPF_PROG_TYPE_KPROBE = 0x2 @@ -2651,6 +2670,8 @@ const ( BPF_PROG_TYPE_EXT = 0x1c BPF_PROG_TYPE_LSM = 0x1d BPF_PROG_TYPE_SK_LOOKUP = 0x1e + BPF_PROG_TYPE_SYSCALL = 0x1f + BPF_PROG_TYPE_NETFILTER = 0x20 BPF_CGROUP_INET_INGRESS = 0x0 BPF_CGROUP_INET_EGRESS = 0x1 BPF_CGROUP_INET_SOCK_CREATE = 0x2 @@ -2689,6 +2710,17 @@ const ( BPF_XDP_CPUMAP = 0x23 BPF_SK_LOOKUP = 0x24 BPF_XDP = 0x25 + BPF_SK_SKB_VERDICT = 0x26 + BPF_SK_REUSEPORT_SELECT = 0x27 + BPF_SK_REUSEPORT_SELECT_OR_MIGRATE = 0x28 + BPF_PERF_EVENT = 0x29 + BPF_TRACE_KPROBE_MULTI = 0x2a + BPF_LSM_CGROUP = 0x2b + BPF_STRUCT_OPS = 0x2c + BPF_NETFILTER = 0x2d + BPF_TCX_INGRESS = 0x2e + BPF_TCX_EGRESS = 0x2f + BPF_TRACE_UPROBE_MULTI = 0x30 BPF_LINK_TYPE_UNSPEC = 0x0 BPF_LINK_TYPE_RAW_TRACEPOINT = 0x1 BPF_LINK_TYPE_TRACING = 0x2 @@ -2696,6 +2728,21 @@ const ( BPF_LINK_TYPE_ITER = 0x4 BPF_LINK_TYPE_NETNS = 0x5 BPF_LINK_TYPE_XDP = 0x6 + BPF_LINK_TYPE_PERF_EVENT = 0x7 + BPF_LINK_TYPE_KPROBE_MULTI = 0x8 + BPF_LINK_TYPE_STRUCT_OPS = 0x9 + BPF_LINK_TYPE_NETFILTER = 0xa + BPF_LINK_TYPE_TCX = 0xb + BPF_LINK_TYPE_UPROBE_MULTI = 0xc + BPF_PERF_EVENT_UNSPEC = 0x0 + BPF_PERF_EVENT_UPROBE = 0x1 + BPF_PERF_EVENT_URETPROBE = 0x2 + BPF_PERF_EVENT_KPROBE = 0x3 + BPF_PERF_EVENT_KRETPROBE = 0x4 + BPF_PERF_EVENT_TRACEPOINT = 0x5 + BPF_PERF_EVENT_EVENT = 0x6 + BPF_F_KPROBE_MULTI_RETURN = 0x1 + BPF_F_UPROBE_MULTI_RETURN = 0x1 BPF_ANY = 0x0 BPF_NOEXIST = 0x1 BPF_EXIST = 0x2 @@ -2713,6 +2760,8 @@ const ( BPF_F_MMAPABLE = 0x400 BPF_F_PRESERVE_ELEMS = 0x800 BPF_F_INNER_MAP = 0x1000 + BPF_F_LINK = 0x2000 + BPF_F_PATH_FD = 0x4000 BPF_STATS_RUN_TIME = 0x0 BPF_STACK_BUILD_ID_EMPTY = 0x0 BPF_STACK_BUILD_ID_VALID = 0x1 @@ -2733,6 +2782,8 @@ const ( BPF_F_ZERO_CSUM_TX = 0x2 BPF_F_DONT_FRAGMENT = 0x4 BPF_F_SEQ_NUMBER = 0x8 + BPF_F_NO_TUNNEL_KEY = 0x10 + BPF_F_TUNINFO_FLAGS = 0x10 BPF_F_INDEX_MASK = 0xffffffff BPF_F_CURRENT_CPU = 0xffffffff BPF_F_CTXLEN_MASK = 0xfffff00000000 @@ -2747,6 +2798,9 @@ const ( BPF_F_ADJ_ROOM_ENCAP_L4_GRE = 0x8 BPF_F_ADJ_ROOM_ENCAP_L4_UDP = 0x10 BPF_F_ADJ_ROOM_NO_CSUM_RESET = 0x20 + BPF_F_ADJ_ROOM_ENCAP_L2_ETH = 0x40 + BPF_F_ADJ_ROOM_DECAP_L3_IPV4 = 0x80 + BPF_F_ADJ_ROOM_DECAP_L3_IPV6 = 0x100 BPF_ADJ_ROOM_ENCAP_L2_MASK = 0xff BPF_ADJ_ROOM_ENCAP_L2_SHIFT = 0x38 BPF_F_SYSCTL_BASE_NAME = 0x1 @@ -2771,10 +2825,16 @@ const ( BPF_LWT_ENCAP_SEG6 = 0x0 BPF_LWT_ENCAP_SEG6_INLINE = 0x1 BPF_LWT_ENCAP_IP = 0x2 + BPF_F_BPRM_SECUREEXEC = 0x1 + BPF_F_BROADCAST = 0x8 + BPF_F_EXCLUDE_INGRESS = 0x10 + BPF_SKB_TSTAMP_UNSPEC = 0x0 + BPF_SKB_TSTAMP_DELIVERY_MONO = 0x1 BPF_OK = 0x0 BPF_DROP = 0x2 BPF_REDIRECT = 0x7 BPF_LWT_REROUTE = 0x80 + BPF_FLOW_DISSECTOR_CONTINUE = 0x81 BPF_SOCK_OPS_RTO_CB_FLAG = 0x1 BPF_SOCK_OPS_RETRANS_CB_FLAG = 0x2 BPF_SOCK_OPS_STATE_CB_FLAG = 0x4 @@ -2829,6 +2889,8 @@ const ( BPF_DEVCG_DEV_CHAR = 0x2 BPF_FIB_LOOKUP_DIRECT = 0x1 BPF_FIB_LOOKUP_OUTPUT = 0x2 + BPF_FIB_LOOKUP_SKIP_NEIGH = 0x4 + BPF_FIB_LOOKUP_TBID = 0x8 BPF_FIB_LKUP_RET_SUCCESS = 0x0 BPF_FIB_LKUP_RET_BLACKHOLE = 0x1 BPF_FIB_LKUP_RET_UNREACHABLE = 0x2 @@ -2838,6 +2900,10 @@ const ( BPF_FIB_LKUP_RET_UNSUPP_LWT = 0x6 BPF_FIB_LKUP_RET_NO_NEIGH = 0x7 BPF_FIB_LKUP_RET_FRAG_NEEDED = 0x8 + BPF_MTU_CHK_SEGS = 0x1 + BPF_MTU_CHK_RET_SUCCESS = 0x0 + BPF_MTU_CHK_RET_FRAG_NEEDED = 0x1 + BPF_MTU_CHK_RET_SEGS_TOOBIG = 0x2 BPF_FD_TYPE_RAW_TRACEPOINT = 0x0 BPF_FD_TYPE_TRACEPOINT = 0x1 BPF_FD_TYPE_KPROBE = 0x2 @@ -2847,6 +2913,20 @@ const ( BPF_FLOW_DISSECTOR_F_PARSE_1ST_FRAG = 0x1 BPF_FLOW_DISSECTOR_F_STOP_AT_FLOW_LABEL = 0x2 BPF_FLOW_DISSECTOR_F_STOP_AT_ENCAP = 0x4 + BPF_CORE_FIELD_BYTE_OFFSET = 0x0 + BPF_CORE_FIELD_BYTE_SIZE = 0x1 + BPF_CORE_FIELD_EXISTS = 0x2 + BPF_CORE_FIELD_SIGNED = 0x3 + BPF_CORE_FIELD_LSHIFT_U64 = 0x4 + BPF_CORE_FIELD_RSHIFT_U64 = 0x5 + BPF_CORE_TYPE_ID_LOCAL = 0x6 + BPF_CORE_TYPE_ID_TARGET = 0x7 + BPF_CORE_TYPE_EXISTS = 0x8 + BPF_CORE_TYPE_SIZE = 0x9 + BPF_CORE_ENUMVAL_EXISTS = 0xa + BPF_CORE_ENUMVAL_VALUE = 0xb + BPF_CORE_TYPE_MATCHES = 0xc + BPF_F_TIMER_ABS = 0x1 ) const ( @@ -2925,6 +3005,12 @@ type LoopInfo64 struct { Encrypt_key [32]uint8 Init [2]uint64 } +type LoopConfig struct { + Fd uint32 + Size uint32 + Info LoopInfo64 + _ [8]uint64 +} type TIPCSocketAddr struct { Ref uint32 @@ -3605,7 +3691,7 @@ const ( ETHTOOL_MSG_PSE_GET = 0x24 ETHTOOL_MSG_PSE_SET = 0x25 ETHTOOL_MSG_RSS_GET = 0x26 - ETHTOOL_MSG_USER_MAX = 0x26 + ETHTOOL_MSG_USER_MAX = 0x2b ETHTOOL_MSG_KERNEL_NONE = 0x0 ETHTOOL_MSG_STRSET_GET_REPLY = 0x1 ETHTOOL_MSG_LINKINFO_GET_REPLY = 0x2 @@ -3645,7 +3731,7 @@ const ( ETHTOOL_MSG_MODULE_NTF = 0x24 ETHTOOL_MSG_PSE_GET_REPLY = 0x25 ETHTOOL_MSG_RSS_GET_REPLY = 0x26 - ETHTOOL_MSG_KERNEL_MAX = 0x26 + ETHTOOL_MSG_KERNEL_MAX = 0x2b ETHTOOL_A_HEADER_UNSPEC = 0x0 ETHTOOL_A_HEADER_DEV_INDEX = 0x1 ETHTOOL_A_HEADER_DEV_NAME = 0x2 @@ -3749,7 +3835,7 @@ const ( ETHTOOL_A_RINGS_TCP_DATA_SPLIT = 0xb ETHTOOL_A_RINGS_CQE_SIZE = 0xc ETHTOOL_A_RINGS_TX_PUSH = 0xd - ETHTOOL_A_RINGS_MAX = 0xd + ETHTOOL_A_RINGS_MAX = 0x10 ETHTOOL_A_CHANNELS_UNSPEC = 0x0 ETHTOOL_A_CHANNELS_HEADER = 0x1 ETHTOOL_A_CHANNELS_RX_MAX = 0x2 @@ -3787,14 +3873,14 @@ const ( ETHTOOL_A_COALESCE_RATE_SAMPLE_INTERVAL = 0x17 ETHTOOL_A_COALESCE_USE_CQE_MODE_TX = 0x18 ETHTOOL_A_COALESCE_USE_CQE_MODE_RX = 0x19 - ETHTOOL_A_COALESCE_MAX = 0x19 + ETHTOOL_A_COALESCE_MAX = 0x1c ETHTOOL_A_PAUSE_UNSPEC = 0x0 ETHTOOL_A_PAUSE_HEADER = 0x1 ETHTOOL_A_PAUSE_AUTONEG = 0x2 ETHTOOL_A_PAUSE_RX = 0x3 ETHTOOL_A_PAUSE_TX = 0x4 ETHTOOL_A_PAUSE_STATS = 0x5 - ETHTOOL_A_PAUSE_MAX = 0x5 + ETHTOOL_A_PAUSE_MAX = 0x6 ETHTOOL_A_PAUSE_STAT_UNSPEC = 0x0 ETHTOOL_A_PAUSE_STAT_PAD = 0x1 ETHTOOL_A_PAUSE_STAT_TX_FRAMES = 0x2 @@ -4444,7 +4530,7 @@ const ( NL80211_ATTR_MAC_HINT = 0xc8 NL80211_ATTR_MAC_MASK = 0xd7 NL80211_ATTR_MAX_AP_ASSOC_STA = 0xca - NL80211_ATTR_MAX = 0x141 + NL80211_ATTR_MAX = 0x146 NL80211_ATTR_MAX_CRIT_PROT_DURATION = 0xb4 NL80211_ATTR_MAX_CSA_COUNTERS = 0xce NL80211_ATTR_MAX_MATCH_SETS = 0x85 @@ -4673,7 +4759,7 @@ const ( NL80211_BAND_ATTR_HT_CAPA = 0x4 NL80211_BAND_ATTR_HT_MCS_SET = 0x3 NL80211_BAND_ATTR_IFTYPE_DATA = 0x9 - NL80211_BAND_ATTR_MAX = 0xb + NL80211_BAND_ATTR_MAX = 0xd NL80211_BAND_ATTR_RATES = 0x2 NL80211_BAND_ATTR_VHT_CAPA = 0x8 NL80211_BAND_ATTR_VHT_MCS_SET = 0x7 @@ -4814,7 +4900,7 @@ const ( NL80211_CMD_LEAVE_IBSS = 0x2c NL80211_CMD_LEAVE_MESH = 0x45 NL80211_CMD_LEAVE_OCB = 0x6d - NL80211_CMD_MAX = 0x98 + NL80211_CMD_MAX = 0x9a NL80211_CMD_MICHAEL_MIC_FAILURE = 0x29 NL80211_CMD_MODIFY_LINK_STA = 0x97 NL80211_CMD_NAN_MATCH = 0x78 @@ -5448,7 +5534,7 @@ const ( NL80211_RATE_INFO_HE_RU_ALLOC_52 = 0x1 NL80211_RATE_INFO_HE_RU_ALLOC_996 = 0x5 NL80211_RATE_INFO_HE_RU_ALLOC = 0x11 - NL80211_RATE_INFO_MAX = 0x16 + NL80211_RATE_INFO_MAX = 0x1d NL80211_RATE_INFO_MCS = 0x2 NL80211_RATE_INFO_SHORT_GI = 0x4 NL80211_RATE_INFO_VHT_MCS = 0x6 @@ -5795,6 +5881,8 @@ const ( TUN_F_TSO6 = 0x4 TUN_F_TSO_ECN = 0x8 TUN_F_UFO = 0x10 + TUN_F_USO4 = 0x20 + TUN_F_USO6 = 0x40 ) const ( @@ -5804,9 +5892,37 @@ const ( ) const ( - VIRTIO_NET_HDR_GSO_NONE = 0x0 - VIRTIO_NET_HDR_GSO_TCPV4 = 0x1 - VIRTIO_NET_HDR_GSO_UDP = 0x3 - VIRTIO_NET_HDR_GSO_TCPV6 = 0x4 - VIRTIO_NET_HDR_GSO_ECN = 0x80 + VIRTIO_NET_HDR_GSO_NONE = 0x0 + VIRTIO_NET_HDR_GSO_TCPV4 = 0x1 + VIRTIO_NET_HDR_GSO_UDP = 0x3 + VIRTIO_NET_HDR_GSO_TCPV6 = 0x4 + VIRTIO_NET_HDR_GSO_UDP_L4 = 0x5 + VIRTIO_NET_HDR_GSO_ECN = 0x80 ) + +type SchedAttr struct { + Size uint32 + Policy uint32 + Flags uint64 + Nice int32 + Priority uint32 + Runtime uint64 + Deadline uint64 + Period uint64 + Util_min uint32 + Util_max uint32 +} + +const SizeofSchedAttr = 0x38 + +type Cachestat_t struct { + Cache uint64 + Dirty uint64 + Writeback uint64 + Evicted uint64 + Recently_evicted uint64 +} +type CachestatRange struct { + Off uint64 + Len uint64 +} diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go index 4ecc1495..438a30af 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && linux -// +build 386,linux package unix @@ -337,6 +336,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go index 34fddff9..adceca35 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && linux -// +build amd64,linux package unix @@ -350,6 +349,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go index 3b14a603..eeaa00a3 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && linux -// +build arm,linux package unix @@ -328,6 +327,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go index 0517651a..6739aa91 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && linux -// +build arm64,linux package unix @@ -329,6 +328,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go index 3b0c5181..9920ef63 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build loong64 && linux -// +build loong64,linux package unix @@ -330,6 +329,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go index fccdf4dd..2923b799 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips && linux -// +build mips,linux package unix @@ -333,6 +332,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go index 500de8fc..ce2750ee 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && linux -// +build mips64,linux package unix @@ -332,6 +331,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go index d0434cd2..3038811d 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64le && linux -// +build mips64le,linux package unix @@ -332,6 +331,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go index 84206ba5..efc6fed1 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mipsle && linux -// +build mipsle,linux package unix @@ -333,6 +332,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go index ab078cf1..9a654b75 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && linux -// +build ppc,linux package unix @@ -340,6 +339,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go index 42eb2c4c..40d358e3 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && linux -// +build ppc64,linux package unix @@ -339,6 +338,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go index 31304a4e..148c6ceb 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64le && linux -// +build ppc64le,linux package unix @@ -339,6 +338,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go index c311f961..72ba8154 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && linux -// +build riscv64,linux package unix @@ -357,6 +356,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 @@ -716,3 +717,30 @@ type SysvShmDesc struct { _ uint64 _ uint64 } + +type RISCVHWProbePairs struct { + Key int64 + Value uint64 +} + +const ( + RISCV_HWPROBE_KEY_MVENDORID = 0x0 + RISCV_HWPROBE_KEY_MARCHID = 0x1 + RISCV_HWPROBE_KEY_MIMPID = 0x2 + RISCV_HWPROBE_KEY_BASE_BEHAVIOR = 0x3 + RISCV_HWPROBE_BASE_BEHAVIOR_IMA = 0x1 + RISCV_HWPROBE_KEY_IMA_EXT_0 = 0x4 + RISCV_HWPROBE_IMA_FD = 0x1 + RISCV_HWPROBE_IMA_C = 0x2 + RISCV_HWPROBE_IMA_V = 0x4 + RISCV_HWPROBE_EXT_ZBA = 0x8 + RISCV_HWPROBE_EXT_ZBB = 0x10 + RISCV_HWPROBE_EXT_ZBS = 0x20 + RISCV_HWPROBE_KEY_CPUPERF_0 = 0x5 + RISCV_HWPROBE_MISALIGNED_UNKNOWN = 0x0 + RISCV_HWPROBE_MISALIGNED_EMULATED = 0x1 + RISCV_HWPROBE_MISALIGNED_SLOW = 0x2 + RISCV_HWPROBE_MISALIGNED_FAST = 0x3 + RISCV_HWPROBE_MISALIGNED_UNSUPPORTED = 0x4 + RISCV_HWPROBE_MISALIGNED_MASK = 0x7 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go index bba3cefa..71e76550 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build s390x && linux -// +build s390x,linux package unix @@ -352,6 +351,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go index ad8a0138..4abbdb9d 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build sparc64 && linux -// +build sparc64,linux package unix @@ -334,6 +333,8 @@ type Taskstats struct { Ac_exe_inode uint64 Wpcopy_count uint64 Wpcopy_delay_total uint64 + Irq_count uint64 + Irq_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go index 9bc4c8f9..f22e7947 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && netbsd -// +build 386,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go index bb05f655..066a7d83 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && netbsd -// +build amd64,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go index db40e3a1..439548ec 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && netbsd -// +build arm,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go index 11121151..16085d3b 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && netbsd -// +build arm64,netbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go index 26eba23b..afd13a3a 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && openbsd -// +build 386,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go index 5a547988..5d97f1f9 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && openbsd -// +build amd64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go index be58c4e1..34871cdc 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && openbsd -// +build arm,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go index 52338266..5911bceb 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && openbsd -// +build arm64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go index 605cfdb1..e4f24f3b 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && openbsd -// +build mips64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go index d6724c01..ca50a793 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && openbsd -// +build ppc64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go index ddfd27a4..d7d7f790 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && openbsd -// +build riscv64,openbsd package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go index 0400747c..14160576 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go @@ -2,7 +2,6 @@ // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && solaris -// +build amd64,solaris package unix diff --git a/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go index aec1efcb..54f31be6 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go +++ b/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build zos && s390x -// +build zos,s390x // Hand edited based on ztypes_linux_s390x.go // TODO: auto-generate. diff --git a/vendor/golang.org/x/sys/windows/aliases.go b/vendor/golang.org/x/sys/windows/aliases.go index a20ebea6..ce2d713d 100644 --- a/vendor/golang.org/x/sys/windows/aliases.go +++ b/vendor/golang.org/x/sys/windows/aliases.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows && go1.9 -// +build windows,go1.9 package windows diff --git a/vendor/golang.org/x/sys/windows/empty.s b/vendor/golang.org/x/sys/windows/empty.s index fdbbbcd3..ba64caca 100644 --- a/vendor/golang.org/x/sys/windows/empty.s +++ b/vendor/golang.org/x/sys/windows/empty.s @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !go1.12 -// +build !go1.12 // This file is here to allow bodyless functions with go:linkname for Go 1.11 // and earlier (see https://golang.org/issue/23311). diff --git a/vendor/golang.org/x/sys/windows/env_windows.go b/vendor/golang.org/x/sys/windows/env_windows.go index 92ac05ff..b8ad1925 100644 --- a/vendor/golang.org/x/sys/windows/env_windows.go +++ b/vendor/golang.org/x/sys/windows/env_windows.go @@ -37,14 +37,14 @@ func (token Token) Environ(inheritExisting bool) (env []string, err error) { return nil, err } defer DestroyEnvironmentBlock(block) - blockp := uintptr(unsafe.Pointer(block)) + blockp := unsafe.Pointer(block) for { - entry := UTF16PtrToString((*uint16)(unsafe.Pointer(blockp))) + entry := UTF16PtrToString((*uint16)(blockp)) if len(entry) == 0 { break } env = append(env, entry) - blockp += 2 * (uintptr(len(entry)) + 1) + blockp = unsafe.Add(blockp, 2*(len(entry)+1)) } return env, nil } diff --git a/vendor/golang.org/x/sys/windows/eventlog.go b/vendor/golang.org/x/sys/windows/eventlog.go index 2cd60645..6c366955 100644 --- a/vendor/golang.org/x/sys/windows/eventlog.go +++ b/vendor/golang.org/x/sys/windows/eventlog.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows -// +build windows package windows diff --git a/vendor/golang.org/x/sys/windows/exec_windows.go b/vendor/golang.org/x/sys/windows/exec_windows.go index 75980fd4..9cabbb69 100644 --- a/vendor/golang.org/x/sys/windows/exec_windows.go +++ b/vendor/golang.org/x/sys/windows/exec_windows.go @@ -22,7 +22,7 @@ import ( // but only if there is space or tab inside s. func EscapeArg(s string) string { if len(s) == 0 { - return "\"\"" + return `""` } n := len(s) hasSpace := false @@ -35,7 +35,7 @@ func EscapeArg(s string) string { } } if hasSpace { - n += 2 + n += 2 // Reserve space for quotes. } if n == len(s) { return s @@ -82,36 +82,106 @@ func EscapeArg(s string) string { // in CreateProcess's CommandLine argument, CreateService/ChangeServiceConfig's BinaryPathName argument, // or any program that uses CommandLineToArgv. func ComposeCommandLine(args []string) string { - var commandLine string - for i := range args { - if i > 0 { - commandLine += " " + if len(args) == 0 { + return "" + } + + // Per https://learn.microsoft.com/en-us/windows/win32/api/shellapi/nf-shellapi-commandlinetoargvw: + // “This function accepts command lines that contain a program name; the + // program name can be enclosed in quotation marks or not.” + // + // Unfortunately, it provides no means of escaping interior quotation marks + // within that program name, and we have no way to report them here. + prog := args[0] + mustQuote := len(prog) == 0 + for i := 0; i < len(prog); i++ { + c := prog[i] + if c <= ' ' || (c == '"' && i == 0) { + // Force quotes for not only the ASCII space and tab as described in the + // MSDN article, but also ASCII control characters. + // The documentation for CommandLineToArgvW doesn't say what happens when + // the first argument is not a valid program name, but it empirically + // seems to drop unquoted control characters. + mustQuote = true + break + } + } + var commandLine []byte + if mustQuote { + commandLine = make([]byte, 0, len(prog)+2) + commandLine = append(commandLine, '"') + for i := 0; i < len(prog); i++ { + c := prog[i] + if c == '"' { + // This quote would interfere with our surrounding quotes. + // We have no way to report an error, so just strip out + // the offending character instead. + continue + } + commandLine = append(commandLine, c) + } + commandLine = append(commandLine, '"') + } else { + if len(args) == 1 { + // args[0] is a valid command line representing itself. + // No need to allocate a new slice or string for it. + return prog } - commandLine += EscapeArg(args[i]) + commandLine = []byte(prog) } - return commandLine + + for _, arg := range args[1:] { + commandLine = append(commandLine, ' ') + // TODO(bcmills): since we're already appending to a slice, it would be nice + // to avoid the intermediate allocations of EscapeArg. + // Perhaps we can factor out an appendEscapedArg function. + commandLine = append(commandLine, EscapeArg(arg)...) + } + return string(commandLine) } // DecomposeCommandLine breaks apart its argument command line into unescaped parts using CommandLineToArgv, // as gathered from GetCommandLine, QUERY_SERVICE_CONFIG's BinaryPathName argument, or elsewhere that // command lines are passed around. +// DecomposeCommandLine returns an error if commandLine contains NUL. func DecomposeCommandLine(commandLine string) ([]string, error) { if len(commandLine) == 0 { return []string{}, nil } + utf16CommandLine, err := UTF16FromString(commandLine) + if err != nil { + return nil, errorspkg.New("string with NUL passed to DecomposeCommandLine") + } var argc int32 - argv, err := CommandLineToArgv(StringToUTF16Ptr(commandLine), &argc) + argv, err := commandLineToArgv(&utf16CommandLine[0], &argc) if err != nil { return nil, err } defer LocalFree(Handle(unsafe.Pointer(argv))) + var args []string - for _, v := range (*argv)[:argc] { - args = append(args, UTF16ToString((*v)[:])) + for _, p := range unsafe.Slice(argv, argc) { + args = append(args, UTF16PtrToString(p)) } return args, nil } +// CommandLineToArgv parses a Unicode command line string and sets +// argc to the number of parsed arguments. +// +// The returned memory should be freed using a single call to LocalFree. +// +// Note that although the return type of CommandLineToArgv indicates 8192 +// entries of up to 8192 characters each, the actual count of parsed arguments +// may exceed 8192, and the documentation for CommandLineToArgvW does not mention +// any bound on the lengths of the individual argument strings. +// (See https://go.dev/issue/63236.) +func CommandLineToArgv(cmd *uint16, argc *int32) (argv *[8192]*[8192]uint16, err error) { + argp, err := commandLineToArgv(cmd, argc) + argv = (*[8192]*[8192]uint16)(unsafe.Pointer(argp)) + return argv, err +} + func CloseOnExec(fd Handle) { SetHandleInformation(Handle(fd), HANDLE_FLAG_INHERIT, 0) } diff --git a/vendor/golang.org/x/sys/windows/mksyscall.go b/vendor/golang.org/x/sys/windows/mksyscall.go index 8563f79c..dbcdb090 100644 --- a/vendor/golang.org/x/sys/windows/mksyscall.go +++ b/vendor/golang.org/x/sys/windows/mksyscall.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build generate -// +build generate package windows diff --git a/vendor/golang.org/x/sys/windows/race.go b/vendor/golang.org/x/sys/windows/race.go index 9196b089..0f1bdc38 100644 --- a/vendor/golang.org/x/sys/windows/race.go +++ b/vendor/golang.org/x/sys/windows/race.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows && race -// +build windows,race package windows diff --git a/vendor/golang.org/x/sys/windows/race0.go b/vendor/golang.org/x/sys/windows/race0.go index 7bae4817..0c78da78 100644 --- a/vendor/golang.org/x/sys/windows/race0.go +++ b/vendor/golang.org/x/sys/windows/race0.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows && !race -// +build windows,!race package windows diff --git a/vendor/golang.org/x/sys/windows/security_windows.go b/vendor/golang.org/x/sys/windows/security_windows.go index d414ef13..26be94a8 100644 --- a/vendor/golang.org/x/sys/windows/security_windows.go +++ b/vendor/golang.org/x/sys/windows/security_windows.go @@ -7,8 +7,6 @@ package windows import ( "syscall" "unsafe" - - "golang.org/x/sys/internal/unsafeheader" ) const ( @@ -1341,21 +1339,14 @@ func (selfRelativeSD *SECURITY_DESCRIPTOR) copySelfRelativeSecurityDescriptor() sdLen = min } - var src []byte - h := (*unsafeheader.Slice)(unsafe.Pointer(&src)) - h.Data = unsafe.Pointer(selfRelativeSD) - h.Len = sdLen - h.Cap = sdLen - + src := unsafe.Slice((*byte)(unsafe.Pointer(selfRelativeSD)), sdLen) + // SECURITY_DESCRIPTOR has pointers in it, which means checkptr expects for it to + // be aligned properly. When we're copying a Windows-allocated struct to a + // Go-allocated one, make sure that the Go allocation is aligned to the + // pointer size. const psize = int(unsafe.Sizeof(uintptr(0))) - - var dst []byte - h = (*unsafeheader.Slice)(unsafe.Pointer(&dst)) alloc := make([]uintptr, (sdLen+psize-1)/psize) - h.Data = (*unsafeheader.Slice)(unsafe.Pointer(&alloc)).Data - h.Len = sdLen - h.Cap = sdLen - + dst := unsafe.Slice((*byte)(unsafe.Pointer(&alloc[0])), sdLen) copy(dst, src) return (*SECURITY_DESCRIPTOR)(unsafe.Pointer(&dst[0])) } diff --git a/vendor/golang.org/x/sys/windows/service.go b/vendor/golang.org/x/sys/windows/service.go index f8deca83..a9dc6308 100644 --- a/vendor/golang.org/x/sys/windows/service.go +++ b/vendor/golang.org/x/sys/windows/service.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows -// +build windows package windows @@ -141,6 +140,12 @@ const ( SERVICE_DYNAMIC_INFORMATION_LEVEL_START_REASON = 1 ) +type ENUM_SERVICE_STATUS struct { + ServiceName *uint16 + DisplayName *uint16 + ServiceStatus SERVICE_STATUS +} + type SERVICE_STATUS struct { ServiceType uint32 CurrentState uint32 @@ -212,6 +217,10 @@ type SERVICE_FAILURE_ACTIONS struct { Actions *SC_ACTION } +type SERVICE_FAILURE_ACTIONS_FLAG struct { + FailureActionsOnNonCrashFailures int32 +} + type SC_ACTION struct { Type uint32 Delay uint32 @@ -245,3 +254,4 @@ type QUERY_SERVICE_LOCK_STATUS struct { //sys UnsubscribeServiceChangeNotifications(subscription uintptr) = sechost.UnsubscribeServiceChangeNotifications? //sys RegisterServiceCtrlHandlerEx(serviceName *uint16, handlerProc uintptr, context uintptr) (handle Handle, err error) = advapi32.RegisterServiceCtrlHandlerExW //sys QueryServiceDynamicInformation(service Handle, infoLevel uint32, dynamicInfo unsafe.Pointer) (err error) = advapi32.QueryServiceDynamicInformation? +//sys EnumDependentServices(service Handle, activityState uint32, services *ENUM_SERVICE_STATUS, buffSize uint32, bytesNeeded *uint32, servicesReturned *uint32) (err error) = advapi32.EnumDependentServicesW diff --git a/vendor/golang.org/x/sys/windows/str.go b/vendor/golang.org/x/sys/windows/str.go index 4fc01434..6a4f9ce6 100644 --- a/vendor/golang.org/x/sys/windows/str.go +++ b/vendor/golang.org/x/sys/windows/str.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows -// +build windows package windows diff --git a/vendor/golang.org/x/sys/windows/syscall.go b/vendor/golang.org/x/sys/windows/syscall.go index 8732cdb9..e85ed6b9 100644 --- a/vendor/golang.org/x/sys/windows/syscall.go +++ b/vendor/golang.org/x/sys/windows/syscall.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build windows -// +build windows // Package windows contains an interface to the low-level operating system // primitives. OS details vary depending on the underlying system, and diff --git a/vendor/golang.org/x/sys/windows/syscall_windows.go b/vendor/golang.org/x/sys/windows/syscall_windows.go index 3723b2c2..47dc5796 100644 --- a/vendor/golang.org/x/sys/windows/syscall_windows.go +++ b/vendor/golang.org/x/sys/windows/syscall_windows.go @@ -15,8 +15,6 @@ import ( "time" "unicode/utf16" "unsafe" - - "golang.org/x/sys/internal/unsafeheader" ) type Handle uintptr @@ -135,14 +133,14 @@ func Getpagesize() int { return 4096 } // NewCallback converts a Go function to a function pointer conforming to the stdcall calling convention. // This is useful when interoperating with Windows code requiring callbacks. -// The argument is expected to be a function with with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. +// The argument is expected to be a function with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. func NewCallback(fn interface{}) uintptr { return syscall.NewCallback(fn) } // NewCallbackCDecl converts a Go function to a function pointer conforming to the cdecl calling convention. // This is useful when interoperating with Windows code requiring callbacks. -// The argument is expected to be a function with with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. +// The argument is expected to be a function with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr. func NewCallbackCDecl(fn interface{}) uintptr { return syscall.NewCallbackCDecl(fn) } @@ -157,6 +155,8 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys GetModuleFileName(module Handle, filename *uint16, size uint32) (n uint32, err error) = kernel32.GetModuleFileNameW //sys GetModuleHandleEx(flags uint32, moduleName *uint16, module *Handle) (err error) = kernel32.GetModuleHandleExW //sys SetDefaultDllDirectories(directoryFlags uint32) (err error) +//sys AddDllDirectory(path *uint16) (cookie uintptr, err error) = kernel32.AddDllDirectory +//sys RemoveDllDirectory(cookie uintptr) (err error) = kernel32.RemoveDllDirectory //sys SetDllDirectory(path string) (err error) = kernel32.SetDllDirectoryW //sys GetVersion() (ver uint32, err error) //sys FormatMessage(flags uint32, msgsrc uintptr, msgid uint32, langid uint32, buf []uint16, args *byte) (n uint32, err error) = FormatMessageW @@ -216,7 +216,7 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys shGetKnownFolderPath(id *KNOWNFOLDERID, flags uint32, token Token, path **uint16) (ret error) = shell32.SHGetKnownFolderPath //sys TerminateProcess(handle Handle, exitcode uint32) (err error) //sys GetExitCodeProcess(handle Handle, exitcode *uint32) (err error) -//sys GetStartupInfo(startupInfo *StartupInfo) (err error) = GetStartupInfoW +//sys getStartupInfo(startupInfo *StartupInfo) = GetStartupInfoW //sys GetProcessTimes(handle Handle, creationTime *Filetime, exitTime *Filetime, kernelTime *Filetime, userTime *Filetime) (err error) //sys DuplicateHandle(hSourceProcessHandle Handle, hSourceHandle Handle, hTargetProcessHandle Handle, lpTargetHandle *Handle, dwDesiredAccess uint32, bInheritHandle bool, dwOptions uint32) (err error) //sys WaitForSingleObject(handle Handle, waitMilliseconds uint32) (event uint32, err error) [failretval==0xffffffff] @@ -235,12 +235,13 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys CreateEnvironmentBlock(block **uint16, token Token, inheritExisting bool) (err error) = userenv.CreateEnvironmentBlock //sys DestroyEnvironmentBlock(block *uint16) (err error) = userenv.DestroyEnvironmentBlock //sys getTickCount64() (ms uint64) = kernel32.GetTickCount64 +//sys GetFileTime(handle Handle, ctime *Filetime, atime *Filetime, wtime *Filetime) (err error) //sys SetFileTime(handle Handle, ctime *Filetime, atime *Filetime, wtime *Filetime) (err error) //sys GetFileAttributes(name *uint16) (attrs uint32, err error) [failretval==INVALID_FILE_ATTRIBUTES] = kernel32.GetFileAttributesW //sys SetFileAttributes(name *uint16, attrs uint32) (err error) = kernel32.SetFileAttributesW //sys GetFileAttributesEx(name *uint16, level uint32, info *byte) (err error) = kernel32.GetFileAttributesExW //sys GetCommandLine() (cmd *uint16) = kernel32.GetCommandLineW -//sys CommandLineToArgv(cmd *uint16, argc *int32) (argv *[8192]*[8192]uint16, err error) [failretval==nil] = shell32.CommandLineToArgvW +//sys commandLineToArgv(cmd *uint16, argc *int32) (argv **uint16, err error) [failretval==nil] = shell32.CommandLineToArgvW //sys LocalFree(hmem Handle) (handle Handle, err error) [failretval!=0] //sys LocalAlloc(flags uint32, length uint32) (ptr uintptr, err error) //sys SetHandleInformation(handle Handle, mask uint32, flags uint32) (err error) @@ -299,12 +300,15 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys RegNotifyChangeKeyValue(key Handle, watchSubtree bool, notifyFilter uint32, event Handle, asynchronous bool) (regerrno error) = advapi32.RegNotifyChangeKeyValue //sys GetCurrentProcessId() (pid uint32) = kernel32.GetCurrentProcessId //sys ProcessIdToSessionId(pid uint32, sessionid *uint32) (err error) = kernel32.ProcessIdToSessionId +//sys ClosePseudoConsole(console Handle) = kernel32.ClosePseudoConsole +//sys createPseudoConsole(size uint32, in Handle, out Handle, flags uint32, pconsole *Handle) (hr error) = kernel32.CreatePseudoConsole //sys GetConsoleMode(console Handle, mode *uint32) (err error) = kernel32.GetConsoleMode //sys SetConsoleMode(console Handle, mode uint32) (err error) = kernel32.SetConsoleMode //sys GetConsoleScreenBufferInfo(console Handle, info *ConsoleScreenBufferInfo) (err error) = kernel32.GetConsoleScreenBufferInfo //sys setConsoleCursorPosition(console Handle, position uint32) (err error) = kernel32.SetConsoleCursorPosition //sys WriteConsole(console Handle, buf *uint16, towrite uint32, written *uint32, reserved *byte) (err error) = kernel32.WriteConsoleW //sys ReadConsole(console Handle, buf *uint16, toread uint32, read *uint32, inputControl *byte) (err error) = kernel32.ReadConsoleW +//sys resizePseudoConsole(pconsole Handle, size uint32) (hr error) = kernel32.ResizePseudoConsole //sys CreateToolhelp32Snapshot(flags uint32, processId uint32) (handle Handle, err error) [failretval==InvalidHandle] = kernel32.CreateToolhelp32Snapshot //sys Module32First(snapshot Handle, moduleEntry *ModuleEntry32) (err error) = kernel32.Module32FirstW //sys Module32Next(snapshot Handle, moduleEntry *ModuleEntry32) (err error) = kernel32.Module32NextW @@ -405,7 +409,7 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys VerQueryValue(block unsafe.Pointer, subBlock string, pointerToBufferPointer unsafe.Pointer, bufSize *uint32) (err error) = version.VerQueryValueW // Process Status API (PSAPI) -//sys EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses +//sys enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses //sys EnumProcessModules(process Handle, module *Handle, cb uint32, cbNeeded *uint32) (err error) = psapi.EnumProcessModules //sys EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *uint32, filterFlag uint32) (err error) = psapi.EnumProcessModulesEx //sys GetModuleInformation(process Handle, module Handle, modinfo *ModuleInfo, cb uint32) (err error) = psapi.GetModuleInformation @@ -437,6 +441,10 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys DwmGetWindowAttribute(hwnd HWND, attribute uint32, value unsafe.Pointer, size uint32) (ret error) = dwmapi.DwmGetWindowAttribute //sys DwmSetWindowAttribute(hwnd HWND, attribute uint32, value unsafe.Pointer, size uint32) (ret error) = dwmapi.DwmSetWindowAttribute +// Windows Multimedia API +//sys TimeBeginPeriod (period uint32) (err error) [failretval != 0] = winmm.timeBeginPeriod +//sys TimeEndPeriod (period uint32) (err error) [failretval != 0] = winmm.timeEndPeriod + // syscall interface implementation for other packages // GetCurrentProcess returns the handle for the current process. @@ -964,7 +972,8 @@ func (sa *SockaddrUnix) sockaddr() (unsafe.Pointer, int32, error) { if n > 0 { sl += int32(n) + 1 } - if sa.raw.Path[0] == '@' { + if sa.raw.Path[0] == '@' || (sa.raw.Path[0] == 0 && sl > 3) { + // Check sl > 3 so we don't change unnamed socket behavior. sa.raw.Path[0] = 0 // Don't count trailing NUL for abstract address. sl-- @@ -1354,6 +1363,17 @@ func SetsockoptIPv6Mreq(fd Handle, level, opt int, mreq *IPv6Mreq) (err error) { return syscall.EWINDOWS } +func EnumProcesses(processIds []uint32, bytesReturned *uint32) error { + // EnumProcesses syscall expects the size parameter to be in bytes, but the code generated with mksyscall uses + // the length of the processIds slice instead. Hence, this wrapper function is added to fix the discrepancy. + var p *uint32 + if len(processIds) > 0 { + p = &processIds[0] + } + size := uint32(len(processIds) * 4) + return enumProcesses(p, size, bytesReturned) +} + func Getpid() (pid int) { return int(GetCurrentProcessId()) } func FindFirstFile(name *uint16, data *Win32finddata) (handle Handle, err error) { @@ -1613,6 +1633,11 @@ func SetConsoleCursorPosition(console Handle, position Coord) error { return setConsoleCursorPosition(console, *((*uint32)(unsafe.Pointer(&position)))) } +func GetStartupInfo(startupInfo *StartupInfo) error { + getStartupInfo(startupInfo) + return nil +} + func (s NTStatus) Errno() syscall.Errno { return rtlNtStatusToDosErrorNoTeb(s) } @@ -1647,12 +1672,8 @@ func NewNTUnicodeString(s string) (*NTUnicodeString, error) { // Slice returns a uint16 slice that aliases the data in the NTUnicodeString. func (s *NTUnicodeString) Slice() []uint16 { - var slice []uint16 - hdr := (*unsafeheader.Slice)(unsafe.Pointer(&slice)) - hdr.Data = unsafe.Pointer(s.Buffer) - hdr.Len = int(s.Length) - hdr.Cap = int(s.MaximumLength) - return slice + slice := unsafe.Slice(s.Buffer, s.MaximumLength) + return slice[:s.Length] } func (s *NTUnicodeString) String() string { @@ -1675,12 +1696,8 @@ func NewNTString(s string) (*NTString, error) { // Slice returns a byte slice that aliases the data in the NTString. func (s *NTString) Slice() []byte { - var slice []byte - hdr := (*unsafeheader.Slice)(unsafe.Pointer(&slice)) - hdr.Data = unsafe.Pointer(s.Buffer) - hdr.Len = int(s.Length) - hdr.Cap = int(s.MaximumLength) - return slice + slice := unsafe.Slice(s.Buffer, s.MaximumLength) + return slice[:s.Length] } func (s *NTString) String() string { @@ -1732,10 +1749,7 @@ func LoadResourceData(module, resInfo Handle) (data []byte, err error) { if err != nil { return } - h := (*unsafeheader.Slice)(unsafe.Pointer(&data)) - h.Data = unsafe.Pointer(ptr) - h.Len = int(size) - h.Cap = int(size) + data = unsafe.Slice((*byte)(unsafe.Pointer(ptr)), size) return } @@ -1806,3 +1820,17 @@ type PSAPI_WORKING_SET_EX_INFORMATION struct { // A PSAPI_WORKING_SET_EX_BLOCK union that indicates the attributes of the page at VirtualAddress. VirtualAttributes PSAPI_WORKING_SET_EX_BLOCK } + +// CreatePseudoConsole creates a windows pseudo console. +func CreatePseudoConsole(size Coord, in Handle, out Handle, flags uint32, pconsole *Handle) error { + // We need this wrapper to manually cast Coord to uint32. The autogenerated wrappers only + // accept arguments that can be casted to uintptr, and Coord can't. + return createPseudoConsole(*((*uint32)(unsafe.Pointer(&size))), in, out, flags, pconsole) +} + +// ResizePseudoConsole resizes the internal buffers of the pseudo console to the width and height specified in `size`. +func ResizePseudoConsole(pconsole Handle, size Coord) error { + // We need this wrapper to manually cast Coord to uint32. The autogenerated wrappers only + // accept arguments that can be casted to uintptr, and Coord can't. + return resizePseudoConsole(pconsole, *((*uint32)(unsafe.Pointer(&size)))) +} diff --git a/vendor/golang.org/x/sys/windows/types_windows.go b/vendor/golang.org/x/sys/windows/types_windows.go index 857acf10..359780f6 100644 --- a/vendor/golang.org/x/sys/windows/types_windows.go +++ b/vendor/golang.org/x/sys/windows/types_windows.go @@ -247,6 +247,7 @@ const ( PROC_THREAD_ATTRIBUTE_MITIGATION_POLICY = 0x00020007 PROC_THREAD_ATTRIBUTE_UMS_THREAD = 0x00030006 PROC_THREAD_ATTRIBUTE_PROTECTION_LEVEL = 0x0002000b + PROC_THREAD_ATTRIBUTE_PSEUDOCONSOLE = 0x00020016 ) const ( @@ -1093,7 +1094,33 @@ const ( SOMAXCONN = 0x7fffffff - TCP_NODELAY = 1 + TCP_NODELAY = 1 + TCP_EXPEDITED_1122 = 2 + TCP_KEEPALIVE = 3 + TCP_MAXSEG = 4 + TCP_MAXRT = 5 + TCP_STDURG = 6 + TCP_NOURG = 7 + TCP_ATMARK = 8 + TCP_NOSYNRETRIES = 9 + TCP_TIMESTAMPS = 10 + TCP_OFFLOAD_PREFERENCE = 11 + TCP_CONGESTION_ALGORITHM = 12 + TCP_DELAY_FIN_ACK = 13 + TCP_MAXRTMS = 14 + TCP_FASTOPEN = 15 + TCP_KEEPCNT = 16 + TCP_KEEPIDLE = TCP_KEEPALIVE + TCP_KEEPINTVL = 17 + TCP_FAIL_CONNECT_ON_ICMP_ERROR = 18 + TCP_ICMP_ERROR_INFO = 19 + + UDP_NOCHECKSUM = 1 + UDP_SEND_MSG_SIZE = 2 + UDP_RECV_MAX_COALESCED_SIZE = 3 + UDP_CHECKSUM_COVERAGE = 20 + + UDP_COALESCED_INFO = 3 SHUT_RD = 0 SHUT_WR = 1 @@ -2139,6 +2166,12 @@ const ( ENABLE_LVB_GRID_WORLDWIDE = 0x10 ) +// Pseudo console related constants used for the flags parameter to +// CreatePseudoConsole. See: https://learn.microsoft.com/en-us/windows/console/createpseudoconsole +const ( + PSEUDOCONSOLE_INHERIT_CURSOR = 0x1 +) + type Coord struct { X int16 Y int16 @@ -2220,19 +2253,23 @@ type JOBOBJECT_BASIC_UI_RESTRICTIONS struct { } const ( - // JobObjectInformationClass + // JobObjectInformationClass for QueryInformationJobObject and SetInformationJobObject JobObjectAssociateCompletionPortInformation = 7 + JobObjectBasicAccountingInformation = 1 + JobObjectBasicAndIoAccountingInformation = 8 JobObjectBasicLimitInformation = 2 + JobObjectBasicProcessIdList = 3 JobObjectBasicUIRestrictions = 4 JobObjectCpuRateControlInformation = 15 JobObjectEndOfJobTimeInformation = 6 JobObjectExtendedLimitInformation = 9 JobObjectGroupInformation = 11 JobObjectGroupInformationEx = 14 - JobObjectLimitViolationInformation2 = 35 + JobObjectLimitViolationInformation = 13 + JobObjectLimitViolationInformation2 = 34 JobObjectNetRateControlInformation = 32 JobObjectNotificationLimitInformation = 12 - JobObjectNotificationLimitInformation2 = 34 + JobObjectNotificationLimitInformation2 = 33 JobObjectSecurityLimitInformation = 5 ) diff --git a/vendor/golang.org/x/sys/windows/zsyscall_windows.go b/vendor/golang.org/x/sys/windows/zsyscall_windows.go index 6d2a2685..146a1f01 100644 --- a/vendor/golang.org/x/sys/windows/zsyscall_windows.go +++ b/vendor/golang.org/x/sys/windows/zsyscall_windows.go @@ -55,6 +55,7 @@ var ( moduser32 = NewLazySystemDLL("user32.dll") moduserenv = NewLazySystemDLL("userenv.dll") modversion = NewLazySystemDLL("version.dll") + modwinmm = NewLazySystemDLL("winmm.dll") modwintrust = NewLazySystemDLL("wintrust.dll") modws2_32 = NewLazySystemDLL("ws2_32.dll") modwtsapi32 = NewLazySystemDLL("wtsapi32.dll") @@ -86,6 +87,7 @@ var ( procDeleteService = modadvapi32.NewProc("DeleteService") procDeregisterEventSource = modadvapi32.NewProc("DeregisterEventSource") procDuplicateTokenEx = modadvapi32.NewProc("DuplicateTokenEx") + procEnumDependentServicesW = modadvapi32.NewProc("EnumDependentServicesW") procEnumServicesStatusExW = modadvapi32.NewProc("EnumServicesStatusExW") procEqualSid = modadvapi32.NewProc("EqualSid") procFreeSid = modadvapi32.NewProc("FreeSid") @@ -182,10 +184,12 @@ var ( procGetAdaptersInfo = modiphlpapi.NewProc("GetAdaptersInfo") procGetBestInterfaceEx = modiphlpapi.NewProc("GetBestInterfaceEx") procGetIfEntry = modiphlpapi.NewProc("GetIfEntry") + procAddDllDirectory = modkernel32.NewProc("AddDllDirectory") procAssignProcessToJobObject = modkernel32.NewProc("AssignProcessToJobObject") procCancelIo = modkernel32.NewProc("CancelIo") procCancelIoEx = modkernel32.NewProc("CancelIoEx") procCloseHandle = modkernel32.NewProc("CloseHandle") + procClosePseudoConsole = modkernel32.NewProc("ClosePseudoConsole") procConnectNamedPipe = modkernel32.NewProc("ConnectNamedPipe") procCreateDirectoryW = modkernel32.NewProc("CreateDirectoryW") procCreateEventExW = modkernel32.NewProc("CreateEventExW") @@ -200,6 +204,7 @@ var ( procCreateNamedPipeW = modkernel32.NewProc("CreateNamedPipeW") procCreatePipe = modkernel32.NewProc("CreatePipe") procCreateProcessW = modkernel32.NewProc("CreateProcessW") + procCreatePseudoConsole = modkernel32.NewProc("CreatePseudoConsole") procCreateSymbolicLinkW = modkernel32.NewProc("CreateSymbolicLinkW") procCreateToolhelp32Snapshot = modkernel32.NewProc("CreateToolhelp32Snapshot") procDefineDosDeviceW = modkernel32.NewProc("DefineDosDeviceW") @@ -249,6 +254,7 @@ var ( procGetFileAttributesW = modkernel32.NewProc("GetFileAttributesW") procGetFileInformationByHandle = modkernel32.NewProc("GetFileInformationByHandle") procGetFileInformationByHandleEx = modkernel32.NewProc("GetFileInformationByHandleEx") + procGetFileTime = modkernel32.NewProc("GetFileTime") procGetFileType = modkernel32.NewProc("GetFileType") procGetFinalPathNameByHandleW = modkernel32.NewProc("GetFinalPathNameByHandleW") procGetFullPathNameW = modkernel32.NewProc("GetFullPathNameW") @@ -325,7 +331,9 @@ var ( procReadProcessMemory = modkernel32.NewProc("ReadProcessMemory") procReleaseMutex = modkernel32.NewProc("ReleaseMutex") procRemoveDirectoryW = modkernel32.NewProc("RemoveDirectoryW") + procRemoveDllDirectory = modkernel32.NewProc("RemoveDllDirectory") procResetEvent = modkernel32.NewProc("ResetEvent") + procResizePseudoConsole = modkernel32.NewProc("ResizePseudoConsole") procResumeThread = modkernel32.NewProc("ResumeThread") procSetCommTimeouts = modkernel32.NewProc("SetCommTimeouts") procSetConsoleCursorPosition = modkernel32.NewProc("SetConsoleCursorPosition") @@ -467,6 +475,8 @@ var ( procGetFileVersionInfoSizeW = modversion.NewProc("GetFileVersionInfoSizeW") procGetFileVersionInfoW = modversion.NewProc("GetFileVersionInfoW") procVerQueryValueW = modversion.NewProc("VerQueryValueW") + proctimeBeginPeriod = modwinmm.NewProc("timeBeginPeriod") + proctimeEndPeriod = modwinmm.NewProc("timeEndPeriod") procWinVerifyTrustEx = modwintrust.NewProc("WinVerifyTrustEx") procFreeAddrInfoW = modws2_32.NewProc("FreeAddrInfoW") procGetAddrInfoW = modws2_32.NewProc("GetAddrInfoW") @@ -734,6 +744,14 @@ func DuplicateTokenEx(existingToken Token, desiredAccess uint32, tokenAttributes return } +func EnumDependentServices(service Handle, activityState uint32, services *ENUM_SERVICE_STATUS, buffSize uint32, bytesNeeded *uint32, servicesReturned *uint32) (err error) { + r1, _, e1 := syscall.Syscall6(procEnumDependentServicesW.Addr(), 6, uintptr(service), uintptr(activityState), uintptr(unsafe.Pointer(services)), uintptr(buffSize), uintptr(unsafe.Pointer(bytesNeeded)), uintptr(unsafe.Pointer(servicesReturned))) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func EnumServicesStatusEx(mgr Handle, infoLevel uint32, serviceType uint32, serviceState uint32, services *byte, bufSize uint32, bytesNeeded *uint32, servicesReturned *uint32, resumeHandle *uint32, groupName *uint16) (err error) { r1, _, e1 := syscall.Syscall12(procEnumServicesStatusExW.Addr(), 10, uintptr(mgr), uintptr(infoLevel), uintptr(serviceType), uintptr(serviceState), uintptr(unsafe.Pointer(services)), uintptr(bufSize), uintptr(unsafe.Pointer(bytesNeeded)), uintptr(unsafe.Pointer(servicesReturned)), uintptr(unsafe.Pointer(resumeHandle)), uintptr(unsafe.Pointer(groupName)), 0, 0) if r1 == 0 { @@ -1589,6 +1607,15 @@ func GetIfEntry(pIfRow *MibIfRow) (errcode error) { return } +func AddDllDirectory(path *uint16) (cookie uintptr, err error) { + r0, _, e1 := syscall.Syscall(procAddDllDirectory.Addr(), 1, uintptr(unsafe.Pointer(path)), 0, 0) + cookie = uintptr(r0) + if cookie == 0 { + err = errnoErr(e1) + } + return +} + func AssignProcessToJobObject(job Handle, process Handle) (err error) { r1, _, e1 := syscall.Syscall(procAssignProcessToJobObject.Addr(), 2, uintptr(job), uintptr(process), 0) if r1 == 0 { @@ -1621,6 +1648,11 @@ func CloseHandle(handle Handle) (err error) { return } +func ClosePseudoConsole(console Handle) { + syscall.Syscall(procClosePseudoConsole.Addr(), 1, uintptr(console), 0, 0) + return +} + func ConnectNamedPipe(pipe Handle, overlapped *Overlapped) (err error) { r1, _, e1 := syscall.Syscall(procConnectNamedPipe.Addr(), 2, uintptr(pipe), uintptr(unsafe.Pointer(overlapped)), 0) if r1 == 0 { @@ -1750,6 +1782,14 @@ func CreateProcess(appName *uint16, commandLine *uint16, procSecurity *SecurityA return } +func createPseudoConsole(size uint32, in Handle, out Handle, flags uint32, pconsole *Handle) (hr error) { + r0, _, _ := syscall.Syscall6(procCreatePseudoConsole.Addr(), 5, uintptr(size), uintptr(in), uintptr(out), uintptr(flags), uintptr(unsafe.Pointer(pconsole)), 0) + if r0 != 0 { + hr = syscall.Errno(r0) + } + return +} + func CreateSymbolicLink(symlinkfilename *uint16, targetfilename *uint16, flags uint32) (err error) { r1, _, e1 := syscall.Syscall(procCreateSymbolicLinkW.Addr(), 3, uintptr(unsafe.Pointer(symlinkfilename)), uintptr(unsafe.Pointer(targetfilename)), uintptr(flags)) if r1&0xff == 0 { @@ -2157,6 +2197,14 @@ func GetFileInformationByHandleEx(handle Handle, class uint32, outBuffer *byte, return } +func GetFileTime(handle Handle, ctime *Filetime, atime *Filetime, wtime *Filetime) (err error) { + r1, _, e1 := syscall.Syscall6(procGetFileTime.Addr(), 4, uintptr(handle), uintptr(unsafe.Pointer(ctime)), uintptr(unsafe.Pointer(atime)), uintptr(unsafe.Pointer(wtime)), 0, 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func GetFileType(filehandle Handle) (n uint32, err error) { r0, _, e1 := syscall.Syscall(procGetFileType.Addr(), 1, uintptr(filehandle), 0, 0) n = uint32(r0) @@ -2358,11 +2406,8 @@ func GetShortPathName(longpath *uint16, shortpath *uint16, buflen uint32) (n uin return } -func GetStartupInfo(startupInfo *StartupInfo) (err error) { - r1, _, e1 := syscall.Syscall(procGetStartupInfoW.Addr(), 1, uintptr(unsafe.Pointer(startupInfo)), 0, 0) - if r1 == 0 { - err = errnoErr(e1) - } +func getStartupInfo(startupInfo *StartupInfo) { + syscall.Syscall(procGetStartupInfoW.Addr(), 1, uintptr(unsafe.Pointer(startupInfo)), 0, 0) return } @@ -2845,6 +2890,14 @@ func RemoveDirectory(path *uint16) (err error) { return } +func RemoveDllDirectory(cookie uintptr) (err error) { + r1, _, e1 := syscall.Syscall(procRemoveDllDirectory.Addr(), 1, uintptr(cookie), 0, 0) + if r1 == 0 { + err = errnoErr(e1) + } + return +} + func ResetEvent(event Handle) (err error) { r1, _, e1 := syscall.Syscall(procResetEvent.Addr(), 1, uintptr(event), 0, 0) if r1 == 0 { @@ -2853,6 +2906,14 @@ func ResetEvent(event Handle) (err error) { return } +func resizePseudoConsole(pconsole Handle, size uint32) (hr error) { + r0, _, _ := syscall.Syscall(procResizePseudoConsole.Addr(), 2, uintptr(pconsole), uintptr(size), 0) + if r0 != 0 { + hr = syscall.Errno(r0) + } + return +} + func ResumeThread(thread Handle) (ret uint32, err error) { r0, _, e1 := syscall.Syscall(procResumeThread.Addr(), 1, uintptr(thread), 0, 0) ret = uint32(r0) @@ -3507,12 +3568,8 @@ func EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *u return } -func EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) { - var _p0 *uint32 - if len(processIds) > 0 { - _p0 = &processIds[0] - } - r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(processIds)), uintptr(unsafe.Pointer(bytesReturned))) +func enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) { + r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(processIds)), uintptr(nSize), uintptr(unsafe.Pointer(bytesReturned))) if r1 == 0 { err = errnoErr(e1) } @@ -3815,9 +3872,9 @@ func setupUninstallOEMInf(infFileName *uint16, flags SUOI, reserved uintptr) (er return } -func CommandLineToArgv(cmd *uint16, argc *int32) (argv *[8192]*[8192]uint16, err error) { +func commandLineToArgv(cmd *uint16, argc *int32) (argv **uint16, err error) { r0, _, e1 := syscall.Syscall(procCommandLineToArgvW.Addr(), 2, uintptr(unsafe.Pointer(cmd)), uintptr(unsafe.Pointer(argc)), 0) - argv = (*[8192]*[8192]uint16)(unsafe.Pointer(r0)) + argv = (**uint16)(unsafe.Pointer(r0)) if argv == nil { err = errnoErr(e1) } @@ -4012,6 +4069,22 @@ func _VerQueryValue(block unsafe.Pointer, subBlock *uint16, pointerToBufferPoint return } +func TimeBeginPeriod(period uint32) (err error) { + r1, _, e1 := syscall.Syscall(proctimeBeginPeriod.Addr(), 1, uintptr(period), 0, 0) + if r1 != 0 { + err = errnoErr(e1) + } + return +} + +func TimeEndPeriod(period uint32) (err error) { + r1, _, e1 := syscall.Syscall(proctimeEndPeriod.Addr(), 1, uintptr(period), 0, 0) + if r1 != 0 { + err = errnoErr(e1) + } + return +} + func WinVerifyTrustEx(hwnd HWND, actionId *GUID, data *WinTrustData) (ret error) { r0, _, _ := syscall.Syscall(procWinVerifyTrustEx.Addr(), 3, uintptr(hwnd), uintptr(unsafe.Pointer(actionId)), uintptr(unsafe.Pointer(data))) if r0 != 0 { diff --git a/vendor/golang.org/x/term/term_unix.go b/vendor/golang.org/x/term/term_unix.go index a4e31ab1..1ad0ddfe 100644 --- a/vendor/golang.org/x/term/term_unix.go +++ b/vendor/golang.org/x/term/term_unix.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos -// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos package term @@ -60,7 +59,7 @@ func restore(fd int, state *State) error { func getSize(fd int) (width, height int, err error) { ws, err := unix.IoctlGetWinsize(fd, unix.TIOCGWINSZ) if err != nil { - return -1, -1, err + return 0, 0, err } return int(ws.Col), int(ws.Row), nil } diff --git a/vendor/golang.org/x/term/term_unix_bsd.go b/vendor/golang.org/x/term/term_unix_bsd.go index 853b3d69..9dbf5462 100644 --- a/vendor/golang.org/x/term/term_unix_bsd.go +++ b/vendor/golang.org/x/term/term_unix_bsd.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build darwin || dragonfly || freebsd || netbsd || openbsd -// +build darwin dragonfly freebsd netbsd openbsd package term diff --git a/vendor/golang.org/x/term/term_unix_other.go b/vendor/golang.org/x/term/term_unix_other.go index 1e8955c9..1b36de79 100644 --- a/vendor/golang.org/x/term/term_unix_other.go +++ b/vendor/golang.org/x/term/term_unix_other.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build aix || linux || solaris || zos -// +build aix linux solaris zos package term diff --git a/vendor/golang.org/x/term/term_unsupported.go b/vendor/golang.org/x/term/term_unsupported.go index f1df8506..3c409e58 100644 --- a/vendor/golang.org/x/term/term_unsupported.go +++ b/vendor/golang.org/x/term/term_unsupported.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !zos && !windows && !solaris && !plan9 -// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!zos,!windows,!solaris,!plan9 package term diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go index 32af9de5..a09ed198 100644 --- a/vendor/golang.org/x/text/internal/language/compact/tables.go +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -790,226 +790,226 @@ const ( var coreTags = []language.CompactCoreInfo{ // 773 elements // Entry 0 - 1F - 0x00000000, 0x01600000, 0x016000d2, 0x01600161, - 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, - 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, - 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, - 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, - 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, - 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, - 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + 0x00000000, 0x01600000, 0x016000d3, 0x01600162, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, + 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, + 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, + 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, + 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, + 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, // Entry 20 - 3F - 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, - 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, - 0x04300000, 0x04300099, 0x04400000, 0x0440012f, - 0x04800000, 0x0480006e, 0x05800000, 0x05820000, - 0x05820032, 0x0585a000, 0x0585a032, 0x05e00000, + 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, + 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, + 0x04300000, 0x0430009a, 0x04400000, 0x04400130, + 0x04800000, 0x0480006f, 0x05800000, 0x05820000, + 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, 0x05e00052, 0x07100000, 0x07100047, 0x07500000, - 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, - 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + 0x07500163, 0x07900000, 0x07900130, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, // Entry 40 - 5F - 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, - 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, - 0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000, - 0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000, - 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, - 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, - 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, - 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, + 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, + 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, + 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, + 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, + 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, + 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, // Entry 60 - 7F - 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, - 0x10000000, 0x1000007b, 0x10100000, 0x10100063, - 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, - 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, - 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, - 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, - 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, - 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, + 0x10000000, 0x1000007c, 0x10100000, 0x10100064, + 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, + 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, + 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, // Entry 80 - 9F - 0x13000000, 0x13000080, 0x13000122, 0x13600000, - 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x13000000, 0x13000081, 0x13000123, 0x13600000, + 0x1360005e, 0x13600088, 0x13900000, 0x13900001, 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, - 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, - 0x13900060, 0x13900061, 0x13900063, 0x13900064, + 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, + 0x13900061, 0x13900062, 0x13900064, 0x13900065, // Entry A0 - BF - 0x1390006d, 0x13900072, 0x13900073, 0x13900074, - 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, - 0x13900080, 0x13900081, 0x13900083, 0x1390008a, - 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, - 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, - 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, - 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, - 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + 0x1390006e, 0x13900073, 0x13900074, 0x13900075, + 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, + 0x13900081, 0x13900082, 0x13900084, 0x1390008b, + 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, + 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, + 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, + 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, + 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, // Entry C0 - DF - 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, - 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, - 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, - 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, - 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, - 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, - 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, - 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, + 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, + 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, + 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, + 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, + 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, + 0x1390010f, 0x13900110, 0x13900113, 0x13900118, + 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, // Entry E0 - FF - 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, - 0x13900131, 0x13900133, 0x13900135, 0x13900139, - 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, - 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, + 0x13900132, 0x13900134, 0x13900136, 0x1390013a, + 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, + 0x13900162, 0x13900163, 0x13900165, 0x13c00000, 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, - 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, - 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, + 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, // Entry 100 - 11F - 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, - 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, - 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, - 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, - 0x14500000, 0x1450006e, 0x14600000, 0x14600052, - 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, - 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, - 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, + 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, + 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, + 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, + 0x14500000, 0x1450006f, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, + 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, + 0x15100000, 0x15100073, 0x15300000, 0x153000e8, // Entry 120 - 13F - 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15800000, 0x15800064, 0x15800077, 0x15e00000, 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, - 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, - 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, - 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, - 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, + 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, + 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, + 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, // Entry 140 - 15F - 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, - 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, - 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, - 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, - 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, - 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, - 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, - 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, + 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, + 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, + 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, + 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, + 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, + 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, + 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, // Entry 160 - 17F - 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, - 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, - 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, - 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, - 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, - 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, - 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, - 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, + 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, + 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, + 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, + 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, + 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, + 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, // Entry 180 - 19F - 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, - 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, - 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, - 0x200000a2, 0x20300000, 0x20700000, 0x20700052, - 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, - 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, - 0x21200067, 0x21600000, 0x21700000, 0x217000a4, - 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, + 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, + 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a3, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, + 0x21200068, 0x21600000, 0x21700000, 0x217000a5, + 0x21f00000, 0x22300000, 0x22300130, 0x22700000, // Entry 1A0 - 1BF - 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, - 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, - 0x24400052, 0x24500000, 0x24500082, 0x24600000, - 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, - 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, - 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, - 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, - 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, + 0x239000a5, 0x24200000, 0x242000af, 0x24400000, + 0x24400052, 0x24500000, 0x24500083, 0x24600000, + 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, + 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, + 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, + 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, // Entry 1C0 - 1DF - 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, - 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, - 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, + 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, + 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, - 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, - 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, - 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, - 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, + 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, + 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, // Entry 1E0 - 1FF - 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, - 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, - 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, - 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, - 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, - 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, - 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, - 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, + 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, + 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, + 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, + 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, + 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, + 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, // Entry 200 - 21F - 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, - 0x34700000, 0x347000da, 0x34700110, 0x34e00000, - 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, - 0x35100000, 0x35100099, 0x351000db, 0x36700000, - 0x36700030, 0x36700036, 0x36700040, 0x3670005b, - 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, - 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, + 0x34700000, 0x347000db, 0x34700111, 0x34e00000, + 0x34e00165, 0x35000000, 0x35000061, 0x350000da, + 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005c, + 0x367000da, 0x36700117, 0x3670011c, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, // Entry 220 - 23F - 0x37a00000, 0x38000000, 0x38000117, 0x38700000, - 0x38900000, 0x38900131, 0x39000000, 0x3900006f, - 0x390000a4, 0x39500000, 0x39500099, 0x39800000, - 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, - 0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000, - 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x37a00000, 0x38000000, 0x38000118, 0x38700000, + 0x38900000, 0x38900132, 0x39000000, 0x39000070, + 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, + 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, + 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, + 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, - 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, // Entry 240 - 25F - 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, - 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, - 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, + 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, + 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, - 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, - 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, - 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, - 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, + 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, + 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, + 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, // Entry 260 - 27F - 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, - 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, - 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, - 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, + 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, + 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, + 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, 0x40200000, 0x4020004c, 0x40700000, 0x40800000, - 0x4085a000, 0x4085a0ba, 0x408e8000, 0x408e80ba, - 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, - 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, + 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, + 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, // Entry 280 - 29F - 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, - 0x42300000, 0x42300164, 0x42900000, 0x42900062, - 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, - 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, - 0x43220000, 0x43220033, 0x432200bd, 0x43220105, - 0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd, - 0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000, - 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, + 0x42300000, 0x42300165, 0x42900000, 0x42900063, + 0x42900070, 0x429000a5, 0x42900116, 0x43100000, + 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, + 0x43220000, 0x43220033, 0x432200be, 0x43220106, + 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, + 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400073, // Entry 2A0 - 2BF - 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, - 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, - 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, - 0x46100000, 0x46100099, 0x46400000, 0x464000a4, - 0x46400131, 0x46700000, 0x46700124, 0x46b00000, - 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, - 0x47100000, 0x47600000, 0x47600127, 0x47a00000, - 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, + 0x44500130, 0x44500132, 0x44e00000, 0x45000000, + 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, + 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, + 0x46400132, 0x46700000, 0x46700125, 0x46b00000, + 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, + 0x47100000, 0x47600000, 0x47600128, 0x47a00000, + 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, // Entry 2C0 - 2DF - 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, - 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, - 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, - 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, + 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, + 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, - 0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000, - 0x4be5a000, 0x4be5a0b4, 0x4bef1000, 0x4bef10b4, - 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, + 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, + 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, // Entry 2E0 - 2FF - 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, - 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, - 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, + 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, 0x50900052, 0x51200000, 0x51200001, 0x51800000, - 0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000, - 0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000, - 0x528000ba, 0x52900000, 0x5293b000, 0x5293b053, - 0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000, + 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, + 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, // Entry 300 - 31F - 0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000, - 0x52f00161, + 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, + 0x52f00162, } // Size: 3116 bytes const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" -// Total table size 3147 bytes (3KiB); checksum: 6772C83C +// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go index fb6b5837..14167e74 100644 --- a/vendor/golang.org/x/text/internal/language/tables.go +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -7,11 +7,11 @@ import "golang.org/x/text/internal/tag" // CLDRVersion is the CLDR version from which the tables in this package are derived. const CLDRVersion = "32" -const NumLanguages = 8752 +const NumLanguages = 8798 -const NumScripts = 258 +const NumScripts = 261 -const NumRegions = 357 +const NumRegions = 358 type FromTo struct { From uint16 @@ -263,7 +263,7 @@ var langNoIndex = [2197]uint8{ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, @@ -278,7 +278,7 @@ var langNoIndex = [2197]uint8{ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x6f, 0xff, 0xff, + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, @@ -289,11 +289,11 @@ var langNoIndex = [2197]uint8{ // Entry C0 - FF 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, // Entry 100 - 13F 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, @@ -303,20 +303,20 @@ var langNoIndex = [2197]uint8{ 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, // Entry 140 - 17F 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, - 0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, // Entry 180 - 1BF 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, @@ -337,7 +337,7 @@ var langNoIndex = [2197]uint8{ 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, // Entry 240 - 27F @@ -359,13 +359,13 @@ var langNoIndex = [2197]uint8{ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, // Entry 300 - 33F 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, @@ -392,14 +392,14 @@ var langNoIndex = [2197]uint8{ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, // Entry 3C0 - 3FF 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xdb, 0xf9, 0x2e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, + 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, @@ -424,12 +424,12 @@ var langNoIndex = [2197]uint8{ // Entry 480 - 4BF 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05, + 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, + 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, // Entry 4C0 - 4FF 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, @@ -441,7 +441,7 @@ var langNoIndex = [2197]uint8{ 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, // Entry 500 - 53F 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, @@ -449,7 +449,7 @@ var langNoIndex = [2197]uint8{ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, @@ -464,13 +464,13 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, @@ -491,20 +491,20 @@ var langNoIndex = [2197]uint8{ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, // Entry 680 - 6BF 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -513,7 +513,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, // Entry 700 - 73F 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, @@ -522,7 +522,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 740 - 77F 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, @@ -530,12 +530,12 @@ var langNoIndex = [2197]uint8{ 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, // Entry 7C0 - 7FF @@ -545,11 +545,11 @@ var langNoIndex = [2197]uint8{ 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, // Entry 800 - 83F 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, @@ -557,11 +557,11 @@ var langNoIndex = [2197]uint8{ 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x14, 0xf1, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, @@ -583,8 +583,8 @@ var altLangIndex = [6]uint16{ } // AliasMap maps langIDs to their suggested replacements. -// Size: 716 bytes, 179 elements -var AliasMap = [179]FromTo{ +// Size: 772 bytes, 193 elements +var AliasMap = [193]FromTo{ 0: {From: 0x82, To: 0x88}, 1: {From: 0x187, To: 0x1ae}, 2: {From: 0x1f3, To: 0x1e1}, @@ -599,223 +599,239 @@ var AliasMap = [179]FromTo{ 11: {From: 0x4a2, To: 0x21}, 12: {From: 0x53e, To: 0x544}, 13: {From: 0x58f, To: 0x12d}, - 14: {From: 0x630, To: 0x1eb1}, - 15: {From: 0x651, To: 0x431}, - 16: {From: 0x662, To: 0x431}, - 17: {From: 0x6ed, To: 0x3a}, - 18: {From: 0x6f8, To: 0x1d7}, - 19: {From: 0x709, To: 0x3625}, - 20: {From: 0x73e, To: 0x21a1}, - 21: {From: 0x7b3, To: 0x56}, - 22: {From: 0x7b9, To: 0x299b}, - 23: {From: 0x7c5, To: 0x58}, - 24: {From: 0x7e6, To: 0x145}, - 25: {From: 0x80c, To: 0x5a}, - 26: {From: 0x815, To: 0x8d}, - 27: {From: 0x87e, To: 0x810}, - 28: {From: 0x8a8, To: 0x8b7}, - 29: {From: 0x8c3, To: 0xee3}, - 30: {From: 0x8fa, To: 0x1dc}, - 31: {From: 0x9ef, To: 0x331}, - 32: {From: 0xa36, To: 0x2c5}, - 33: {From: 0xa3d, To: 0xbf}, - 34: {From: 0xabe, To: 0x3322}, - 35: {From: 0xb38, To: 0x529}, - 36: {From: 0xb75, To: 0x265a}, - 37: {From: 0xb7e, To: 0xbc3}, - 38: {From: 0xb9b, To: 0x44e}, - 39: {From: 0xbbc, To: 0x4229}, - 40: {From: 0xbbf, To: 0x529}, - 41: {From: 0xbfe, To: 0x2da7}, - 42: {From: 0xc2e, To: 0x3181}, - 43: {From: 0xcb9, To: 0xf3}, - 44: {From: 0xd08, To: 0xfa}, - 45: {From: 0xdc8, To: 0x11a}, - 46: {From: 0xdd7, To: 0x32d}, - 47: {From: 0xdf8, To: 0xdfb}, - 48: {From: 0xdfe, To: 0x531}, - 49: {From: 0xe01, To: 0xdf3}, - 50: {From: 0xedf, To: 0x205a}, - 51: {From: 0xee9, To: 0x222e}, - 52: {From: 0xeee, To: 0x2e9a}, - 53: {From: 0xf39, To: 0x367}, - 54: {From: 0x10d0, To: 0x140}, - 55: {From: 0x1104, To: 0x2d0}, - 56: {From: 0x11a0, To: 0x1ec}, - 57: {From: 0x1279, To: 0x21}, - 58: {From: 0x1424, To: 0x15e}, - 59: {From: 0x1470, To: 0x14e}, - 60: {From: 0x151f, To: 0xd9b}, - 61: {From: 0x1523, To: 0x390}, - 62: {From: 0x1532, To: 0x19f}, - 63: {From: 0x1580, To: 0x210}, - 64: {From: 0x1583, To: 0x10d}, - 65: {From: 0x15a3, To: 0x3caf}, - 66: {From: 0x1630, To: 0x222e}, - 67: {From: 0x166a, To: 0x19b}, - 68: {From: 0x16c8, To: 0x136}, - 69: {From: 0x1700, To: 0x29f8}, - 70: {From: 0x1718, To: 0x194}, - 71: {From: 0x1727, To: 0xf3f}, - 72: {From: 0x177a, To: 0x178}, - 73: {From: 0x1809, To: 0x17b6}, - 74: {From: 0x1816, To: 0x18f3}, - 75: {From: 0x188a, To: 0x436}, - 76: {From: 0x1979, To: 0x1d01}, - 77: {From: 0x1a74, To: 0x2bb0}, - 78: {From: 0x1a8a, To: 0x1f8}, - 79: {From: 0x1b5a, To: 0x1fa}, - 80: {From: 0x1b86, To: 0x1515}, - 81: {From: 0x1d64, To: 0x2c9b}, - 82: {From: 0x2038, To: 0x37b1}, - 83: {From: 0x203d, To: 0x20dd}, - 84: {From: 0x205a, To: 0x30b}, - 85: {From: 0x20e3, To: 0x274}, - 86: {From: 0x20ee, To: 0x263}, - 87: {From: 0x20f2, To: 0x22d}, - 88: {From: 0x20f9, To: 0x256}, - 89: {From: 0x210f, To: 0x21eb}, - 90: {From: 0x2135, To: 0x27d}, - 91: {From: 0x2160, To: 0x913}, - 92: {From: 0x2199, To: 0x121}, - 93: {From: 0x21ce, To: 0x1561}, - 94: {From: 0x21e6, To: 0x504}, - 95: {From: 0x21f4, To: 0x49f}, - 96: {From: 0x21fb, To: 0x269}, - 97: {From: 0x222d, To: 0x121}, - 98: {From: 0x2237, To: 0x121}, - 99: {From: 0x2262, To: 0x92a}, - 100: {From: 0x2316, To: 0x3226}, - 101: {From: 0x236a, To: 0x2835}, - 102: {From: 0x2382, To: 0x3365}, - 103: {From: 0x2472, To: 0x2c7}, - 104: {From: 0x24e4, To: 0x2ff}, - 105: {From: 0x24f0, To: 0x2fa}, - 106: {From: 0x24fa, To: 0x31f}, - 107: {From: 0x2550, To: 0xb5b}, - 108: {From: 0x25a9, To: 0xe2}, - 109: {From: 0x263e, To: 0x2d0}, - 110: {From: 0x26c9, To: 0x26b4}, - 111: {From: 0x26f9, To: 0x3c8}, - 112: {From: 0x2727, To: 0x3caf}, - 113: {From: 0x2755, To: 0x6a4}, - 114: {From: 0x2765, To: 0x26b4}, - 115: {From: 0x2789, To: 0x4358}, - 116: {From: 0x27c9, To: 0x2001}, - 117: {From: 0x28ea, To: 0x27b1}, - 118: {From: 0x28ef, To: 0x2837}, - 119: {From: 0x2914, To: 0x351}, - 120: {From: 0x2986, To: 0x2da7}, - 121: {From: 0x29f0, To: 0x96b}, - 122: {From: 0x2b1a, To: 0x38d}, - 123: {From: 0x2bfc, To: 0x395}, - 124: {From: 0x2c3f, To: 0x3caf}, - 125: {From: 0x2ce1, To: 0x2201}, - 126: {From: 0x2cfc, To: 0x3be}, - 127: {From: 0x2d13, To: 0x597}, - 128: {From: 0x2d47, To: 0x148}, - 129: {From: 0x2d48, To: 0x148}, - 130: {From: 0x2dff, To: 0x2f1}, - 131: {From: 0x2e08, To: 0x19cc}, - 132: {From: 0x2e1a, To: 0x2d95}, - 133: {From: 0x2e21, To: 0x292}, - 134: {From: 0x2e54, To: 0x7d}, - 135: {From: 0x2e65, To: 0x2282}, - 136: {From: 0x2ea0, To: 0x2e9b}, - 137: {From: 0x2eef, To: 0x2ed7}, - 138: {From: 0x3193, To: 0x3c4}, - 139: {From: 0x3366, To: 0x338e}, - 140: {From: 0x342a, To: 0x3dc}, - 141: {From: 0x34ee, To: 0x18d0}, - 142: {From: 0x35c8, To: 0x2c9b}, - 143: {From: 0x35e6, To: 0x412}, - 144: {From: 0x3658, To: 0x246}, - 145: {From: 0x3676, To: 0x3f4}, - 146: {From: 0x36fd, To: 0x445}, - 147: {From: 0x37c0, To: 0x121}, - 148: {From: 0x3816, To: 0x38f2}, - 149: {From: 0x382a, To: 0x2b48}, - 150: {From: 0x382b, To: 0x2c9b}, - 151: {From: 0x382f, To: 0xa9}, - 152: {From: 0x3832, To: 0x3228}, - 153: {From: 0x386c, To: 0x39a6}, - 154: {From: 0x3892, To: 0x3fc0}, - 155: {From: 0x38a5, To: 0x39d7}, - 156: {From: 0x38b4, To: 0x1fa4}, - 157: {From: 0x38b5, To: 0x2e9a}, - 158: {From: 0x395c, To: 0x47e}, - 159: {From: 0x3b4e, To: 0xd91}, - 160: {From: 0x3b78, To: 0x137}, - 161: {From: 0x3c99, To: 0x4bc}, - 162: {From: 0x3fbd, To: 0x100}, - 163: {From: 0x4208, To: 0xa91}, - 164: {From: 0x42be, To: 0x573}, - 165: {From: 0x42f9, To: 0x3f60}, - 166: {From: 0x4378, To: 0x25a}, - 167: {From: 0x43b8, To: 0xe6c}, - 168: {From: 0x43cd, To: 0x10f}, - 169: {From: 0x44af, To: 0x3322}, - 170: {From: 0x44e3, To: 0x512}, - 171: {From: 0x45ca, To: 0x2409}, - 172: {From: 0x45dd, To: 0x26dc}, - 173: {From: 0x4610, To: 0x48ae}, - 174: {From: 0x46ae, To: 0x46a0}, - 175: {From: 0x473e, To: 0x4745}, - 176: {From: 0x4817, To: 0x3503}, - 177: {From: 0x4916, To: 0x31f}, - 178: {From: 0x49a7, To: 0x523}, + 14: {From: 0x62b, To: 0x34}, + 15: {From: 0x62f, To: 0x14}, + 16: {From: 0x630, To: 0x1eb1}, + 17: {From: 0x651, To: 0x431}, + 18: {From: 0x662, To: 0x431}, + 19: {From: 0x6ed, To: 0x3a}, + 20: {From: 0x6f8, To: 0x1d7}, + 21: {From: 0x709, To: 0x3625}, + 22: {From: 0x73e, To: 0x21a1}, + 23: {From: 0x7b3, To: 0x56}, + 24: {From: 0x7b9, To: 0x299b}, + 25: {From: 0x7c5, To: 0x58}, + 26: {From: 0x7e6, To: 0x145}, + 27: {From: 0x80c, To: 0x5a}, + 28: {From: 0x815, To: 0x8d}, + 29: {From: 0x87e, To: 0x810}, + 30: {From: 0x8a8, To: 0x8b7}, + 31: {From: 0x8c3, To: 0xee3}, + 32: {From: 0x8fa, To: 0x1dc}, + 33: {From: 0x9ef, To: 0x331}, + 34: {From: 0xa36, To: 0x2c5}, + 35: {From: 0xa3d, To: 0xbf}, + 36: {From: 0xabe, To: 0x3322}, + 37: {From: 0xb38, To: 0x529}, + 38: {From: 0xb75, To: 0x265a}, + 39: {From: 0xb7e, To: 0xbc3}, + 40: {From: 0xb9b, To: 0x44e}, + 41: {From: 0xbbc, To: 0x4229}, + 42: {From: 0xbbf, To: 0x529}, + 43: {From: 0xbfe, To: 0x2da7}, + 44: {From: 0xc2e, To: 0x3181}, + 45: {From: 0xcb9, To: 0xf3}, + 46: {From: 0xd08, To: 0xfa}, + 47: {From: 0xdc8, To: 0x11a}, + 48: {From: 0xdd7, To: 0x32d}, + 49: {From: 0xdf8, To: 0xdfb}, + 50: {From: 0xdfe, To: 0x531}, + 51: {From: 0xe01, To: 0xdf3}, + 52: {From: 0xedf, To: 0x205a}, + 53: {From: 0xee9, To: 0x222e}, + 54: {From: 0xeee, To: 0x2e9a}, + 55: {From: 0xf39, To: 0x367}, + 56: {From: 0x10d0, To: 0x140}, + 57: {From: 0x1104, To: 0x2d0}, + 58: {From: 0x11a0, To: 0x1ec}, + 59: {From: 0x1279, To: 0x21}, + 60: {From: 0x1424, To: 0x15e}, + 61: {From: 0x1470, To: 0x14e}, + 62: {From: 0x151f, To: 0xd9b}, + 63: {From: 0x1523, To: 0x390}, + 64: {From: 0x1532, To: 0x19f}, + 65: {From: 0x1580, To: 0x210}, + 66: {From: 0x1583, To: 0x10d}, + 67: {From: 0x15a3, To: 0x3caf}, + 68: {From: 0x1630, To: 0x222e}, + 69: {From: 0x166a, To: 0x19b}, + 70: {From: 0x16c8, To: 0x136}, + 71: {From: 0x1700, To: 0x29f8}, + 72: {From: 0x1718, To: 0x194}, + 73: {From: 0x1727, To: 0xf3f}, + 74: {From: 0x177a, To: 0x178}, + 75: {From: 0x1809, To: 0x17b6}, + 76: {From: 0x1816, To: 0x18f3}, + 77: {From: 0x188a, To: 0x436}, + 78: {From: 0x1979, To: 0x1d01}, + 79: {From: 0x1a74, To: 0x2bb0}, + 80: {From: 0x1a8a, To: 0x1f8}, + 81: {From: 0x1b5a, To: 0x1fa}, + 82: {From: 0x1b86, To: 0x1515}, + 83: {From: 0x1d64, To: 0x2c9b}, + 84: {From: 0x2038, To: 0x37b1}, + 85: {From: 0x203d, To: 0x20dd}, + 86: {From: 0x2042, To: 0x2e00}, + 87: {From: 0x205a, To: 0x30b}, + 88: {From: 0x20e3, To: 0x274}, + 89: {From: 0x20ee, To: 0x263}, + 90: {From: 0x20f2, To: 0x22d}, + 91: {From: 0x20f9, To: 0x256}, + 92: {From: 0x210f, To: 0x21eb}, + 93: {From: 0x2135, To: 0x27d}, + 94: {From: 0x2160, To: 0x913}, + 95: {From: 0x2199, To: 0x121}, + 96: {From: 0x21ce, To: 0x1561}, + 97: {From: 0x21e6, To: 0x504}, + 98: {From: 0x21f4, To: 0x49f}, + 99: {From: 0x21fb, To: 0x269}, + 100: {From: 0x222d, To: 0x121}, + 101: {From: 0x2237, To: 0x121}, + 102: {From: 0x2248, To: 0x217d}, + 103: {From: 0x2262, To: 0x92a}, + 104: {From: 0x2316, To: 0x3226}, + 105: {From: 0x236a, To: 0x2835}, + 106: {From: 0x2382, To: 0x3365}, + 107: {From: 0x2472, To: 0x2c7}, + 108: {From: 0x24e4, To: 0x2ff}, + 109: {From: 0x24f0, To: 0x2fa}, + 110: {From: 0x24fa, To: 0x31f}, + 111: {From: 0x2550, To: 0xb5b}, + 112: {From: 0x25a9, To: 0xe2}, + 113: {From: 0x263e, To: 0x2d0}, + 114: {From: 0x26c9, To: 0x26b4}, + 115: {From: 0x26f9, To: 0x3c8}, + 116: {From: 0x2727, To: 0x3caf}, + 117: {From: 0x2755, To: 0x6a4}, + 118: {From: 0x2765, To: 0x26b4}, + 119: {From: 0x2789, To: 0x4358}, + 120: {From: 0x27c9, To: 0x2001}, + 121: {From: 0x28ea, To: 0x27b1}, + 122: {From: 0x28ef, To: 0x2837}, + 123: {From: 0x28fe, To: 0xaa5}, + 124: {From: 0x2914, To: 0x351}, + 125: {From: 0x2986, To: 0x2da7}, + 126: {From: 0x29f0, To: 0x96b}, + 127: {From: 0x2b1a, To: 0x38d}, + 128: {From: 0x2bfc, To: 0x395}, + 129: {From: 0x2c3f, To: 0x3caf}, + 130: {From: 0x2ce1, To: 0x2201}, + 131: {From: 0x2cfc, To: 0x3be}, + 132: {From: 0x2d13, To: 0x597}, + 133: {From: 0x2d47, To: 0x148}, + 134: {From: 0x2d48, To: 0x148}, + 135: {From: 0x2dff, To: 0x2f1}, + 136: {From: 0x2e08, To: 0x19cc}, + 137: {From: 0x2e10, To: 0xc45}, + 138: {From: 0x2e1a, To: 0x2d95}, + 139: {From: 0x2e21, To: 0x292}, + 140: {From: 0x2e54, To: 0x7d}, + 141: {From: 0x2e65, To: 0x2282}, + 142: {From: 0x2e97, To: 0x1a4}, + 143: {From: 0x2ea0, To: 0x2e9b}, + 144: {From: 0x2eef, To: 0x2ed7}, + 145: {From: 0x3193, To: 0x3c4}, + 146: {From: 0x3366, To: 0x338e}, + 147: {From: 0x342a, To: 0x3dc}, + 148: {From: 0x34ee, To: 0x18d0}, + 149: {From: 0x35c8, To: 0x2c9b}, + 150: {From: 0x35e6, To: 0x412}, + 151: {From: 0x35f5, To: 0x24b}, + 152: {From: 0x360d, To: 0x1dc}, + 153: {From: 0x3658, To: 0x246}, + 154: {From: 0x3676, To: 0x3f4}, + 155: {From: 0x36fd, To: 0x445}, + 156: {From: 0x3747, To: 0x3b42}, + 157: {From: 0x37c0, To: 0x121}, + 158: {From: 0x3816, To: 0x38f2}, + 159: {From: 0x382a, To: 0x2b48}, + 160: {From: 0x382b, To: 0x2c9b}, + 161: {From: 0x382f, To: 0xa9}, + 162: {From: 0x3832, To: 0x3228}, + 163: {From: 0x386c, To: 0x39a6}, + 164: {From: 0x3892, To: 0x3fc0}, + 165: {From: 0x38a0, To: 0x45f}, + 166: {From: 0x38a5, To: 0x39d7}, + 167: {From: 0x38b4, To: 0x1fa4}, + 168: {From: 0x38b5, To: 0x2e9a}, + 169: {From: 0x38fa, To: 0x38f1}, + 170: {From: 0x395c, To: 0x47e}, + 171: {From: 0x3b4e, To: 0xd91}, + 172: {From: 0x3b78, To: 0x137}, + 173: {From: 0x3c99, To: 0x4bc}, + 174: {From: 0x3fbd, To: 0x100}, + 175: {From: 0x4208, To: 0xa91}, + 176: {From: 0x42be, To: 0x573}, + 177: {From: 0x42f9, To: 0x3f60}, + 178: {From: 0x4378, To: 0x25a}, + 179: {From: 0x43b8, To: 0xe6c}, + 180: {From: 0x43cd, To: 0x10f}, + 181: {From: 0x43d4, To: 0x4848}, + 182: {From: 0x44af, To: 0x3322}, + 183: {From: 0x44e3, To: 0x512}, + 184: {From: 0x45ca, To: 0x2409}, + 185: {From: 0x45dd, To: 0x26dc}, + 186: {From: 0x4610, To: 0x48ae}, + 187: {From: 0x46ae, To: 0x46a0}, + 188: {From: 0x473e, To: 0x4745}, + 189: {From: 0x4817, To: 0x3503}, + 190: {From: 0x483b, To: 0x208b}, + 191: {From: 0x4916, To: 0x31f}, + 192: {From: 0x49a7, To: 0x523}, } -// Size: 179 bytes, 179 elements -var AliasTypes = [179]AliasType{ +// Size: 193 bytes, 193 elements +var AliasTypes = [193]AliasType{ // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, 0, 2, - 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, - 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, + 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, + 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, + 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, // Entry 40 - 7F - 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, - 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, - 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, - 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 0, 1, 0, + 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, + 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, // Entry 80 - BF - 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, - 1, 1, 1, 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, - 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, - 0, 1, 1, + 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, + 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, + 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, + 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry C0 - FF + 1, } const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) // script is an alphabetically sorted list of ISO 15924 codes. The index // of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 1040 bytes +const script tag.Index = "" + // Size: 1052 bytes "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + - "JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" + - "LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" + - "MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" + - "OgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlvPhnxPiqd" + - "PlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaao" + - "QaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabg" + - "QabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRanj" + - "RjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSora" + - "SoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglg" + - "ThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsuxYeziYiiiZanb" + - "ZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + + "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + + "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + + "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + + "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + + "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + + "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + + "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + + "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + + "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + + "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" // suppressScript is an index from langID to the dominant script for that language, // if it exists. If a script is given, it should be suppressed from the language tag. @@ -824,7 +840,7 @@ var suppressScript = [1330]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -833,7 +849,7 @@ var suppressScript = [1330]uint8{ // Entry 40 - 7F 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -846,53 +862,53 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry C0 - FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F - 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xea, 0x00, 0x00, 0x00, 0x00, 0xec, 0x00, 0x00, + 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, // Entry 140 - 17F - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 180 - 1BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, // Entry 1C0 - 1FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08, + 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, // Entry 200 - 23F 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -903,9 +919,9 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 240 - 27F - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -913,93 +929,93 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 280 - 2BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 2C0 - 2FF - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, // Entry 3C0 - 3FF - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 400 - 43F - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe3, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe6, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xeb, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 480 - 4BF - 0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 4C0 - 4FF - 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 500 - 53F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1007,7 +1023,7 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, } @@ -1016,16 +1032,16 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) // isoRegionOffset needs to be added to the index of regionISO to obtain the regionID @@ -1034,8 +1050,8 @@ const ( const isoRegionOffset = 32 // regionTypes defines the status of a region for various standards. -// Size: 358 bytes, 358 elements -var regionTypes = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionTypes = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1048,45 +1064,45 @@ var regionTypes = [358]uint8{ // Entry 40 - 7F 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, + 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry 80 - BF 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry C0 - FF - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, // Entry 100 - 13F - 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, // Entry 140 - 17F - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, } // regionISO holds a list of alphabetically sorted 2-letter ISO region codes. @@ -1094,27 +1110,27 @@ var regionTypes = [358]uint8{ // - [A-Z}{2}: the first letter of the 2-letter code plus these two // letters form the 3-letter ISO code. // - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes +const regionISO tag.Index = "" + // Size: 1312 bytes "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + + "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + + "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + + "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + + "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + + "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + + "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + + "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + + "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + + "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + + "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + + "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + + "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + + "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + + "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + + "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + + "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" // altRegionISO3 holds a list of 3-letter region codes that cannot be // mapped to 2-letter codes using the default algorithm. This is a short list. @@ -1124,38 +1140,38 @@ const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" // of the 3-letter ISO codes in altRegionISO3. // Size: 22 bytes, 11 elements var altRegionIDs = [11]uint16{ - 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, - 0x0121, 0x015f, 0x00dc, + 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, + 0x0122, 0x0160, 0x00dd, } // Size: 80 bytes, 20 elements var regionOldMap = [20]FromTo{ - 0: {From: 0x44, To: 0xc4}, - 1: {From: 0x58, To: 0xa7}, - 2: {From: 0x5f, To: 0x60}, - 3: {From: 0x66, To: 0x3b}, - 4: {From: 0x79, To: 0x78}, - 5: {From: 0x93, To: 0x37}, - 6: {From: 0xa3, To: 0x133}, - 7: {From: 0xc1, To: 0x133}, - 8: {From: 0xd7, To: 0x13f}, - 9: {From: 0xdc, To: 0x2b}, - 10: {From: 0xef, To: 0x133}, - 11: {From: 0xf2, To: 0xe2}, - 12: {From: 0xfc, To: 0x70}, - 13: {From: 0x103, To: 0x164}, - 14: {From: 0x12a, To: 0x126}, - 15: {From: 0x132, To: 0x7b}, - 16: {From: 0x13a, To: 0x13e}, - 17: {From: 0x141, To: 0x133}, - 18: {From: 0x15d, To: 0x15e}, - 19: {From: 0x163, To: 0x4b}, + 0: {From: 0x44, To: 0xc5}, + 1: {From: 0x59, To: 0xa8}, + 2: {From: 0x60, To: 0x61}, + 3: {From: 0x67, To: 0x3b}, + 4: {From: 0x7a, To: 0x79}, + 5: {From: 0x94, To: 0x37}, + 6: {From: 0xa4, To: 0x134}, + 7: {From: 0xc2, To: 0x134}, + 8: {From: 0xd8, To: 0x140}, + 9: {From: 0xdd, To: 0x2b}, + 10: {From: 0xf0, To: 0x134}, + 11: {From: 0xf3, To: 0xe3}, + 12: {From: 0xfd, To: 0x71}, + 13: {From: 0x104, To: 0x165}, + 14: {From: 0x12b, To: 0x127}, + 15: {From: 0x133, To: 0x7c}, + 16: {From: 0x13b, To: 0x13f}, + 17: {From: 0x142, To: 0x134}, + 18: {From: 0x15e, To: 0x15f}, + 19: {From: 0x164, To: 0x4b}, } // m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are // codes indicating collections of regions. -// Size: 716 bytes, 358 elements -var m49 = [358]int16{ +// Size: 718 bytes, 359 elements +var m49 = [359]int16{ // Entry 0 - 3F 0, 1, 2, 3, 5, 9, 11, 13, 14, 15, 17, 18, 19, 21, 29, 30, @@ -1168,45 +1184,45 @@ var m49 = [358]int16{ // Entry 40 - 7F 535, 76, 44, 64, 104, 74, 72, 112, 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 188, 891, - 296, 192, 132, 531, 162, 196, 203, 278, - 276, 0, 262, 208, 212, 214, 204, 12, - 0, 218, 233, 818, 732, 232, 724, 231, - 967, 0, 246, 242, 238, 583, 234, 0, - 250, 249, 266, 826, 308, 268, 254, 831, + 184, 152, 120, 156, 170, 0, 0, 188, + 891, 296, 192, 132, 531, 162, 196, 203, + 278, 276, 0, 262, 208, 212, 214, 204, + 12, 0, 218, 233, 818, 732, 232, 724, + 231, 967, 0, 246, 242, 238, 583, 234, + 0, 250, 249, 266, 826, 308, 268, 254, // Entry 80 - BF - 288, 292, 304, 270, 324, 312, 226, 300, - 239, 320, 316, 624, 328, 344, 334, 340, - 191, 332, 348, 854, 0, 360, 372, 376, - 833, 356, 86, 368, 364, 352, 380, 832, - 388, 400, 392, 581, 404, 417, 116, 296, - 174, 659, 408, 410, 414, 136, 398, 418, - 422, 662, 438, 144, 430, 426, 440, 442, - 428, 434, 504, 492, 498, 499, 663, 450, + 831, 288, 292, 304, 270, 324, 312, 226, + 300, 239, 320, 316, 624, 328, 344, 334, + 340, 191, 332, 348, 854, 0, 360, 372, + 376, 833, 356, 86, 368, 364, 352, 380, + 832, 388, 400, 392, 581, 404, 417, 116, + 296, 174, 659, 408, 410, 414, 136, 398, + 418, 422, 662, 438, 144, 430, 426, 440, + 442, 428, 434, 504, 492, 498, 499, 663, // Entry C0 - FF - 584, 581, 807, 466, 104, 496, 446, 580, - 474, 478, 500, 470, 480, 462, 454, 484, - 458, 508, 516, 540, 562, 574, 566, 548, - 558, 528, 578, 524, 10, 520, 536, 570, - 554, 512, 591, 0, 604, 258, 598, 608, - 586, 616, 666, 612, 630, 275, 620, 581, - 585, 600, 591, 634, 959, 960, 961, 962, - 963, 964, 965, 966, 967, 968, 969, 970, + 450, 584, 581, 807, 466, 104, 496, 446, + 580, 474, 478, 500, 470, 480, 462, 454, + 484, 458, 508, 516, 540, 562, 574, 566, + 548, 558, 528, 578, 524, 10, 520, 536, + 570, 554, 512, 591, 0, 604, 258, 598, + 608, 586, 616, 666, 612, 630, 275, 620, + 581, 585, 600, 591, 634, 959, 960, 961, + 962, 963, 964, 965, 966, 967, 968, 969, // Entry 100 - 13F - 971, 972, 638, 716, 642, 688, 643, 646, - 682, 90, 690, 729, 752, 702, 654, 705, - 744, 703, 694, 674, 686, 706, 740, 728, - 678, 810, 222, 534, 760, 748, 0, 796, - 148, 260, 768, 764, 762, 772, 626, 795, - 788, 776, 626, 792, 780, 798, 158, 834, - 804, 800, 826, 581, 0, 840, 858, 860, - 336, 670, 704, 862, 92, 850, 704, 548, + 970, 971, 972, 638, 716, 642, 688, 643, + 646, 682, 90, 690, 729, 752, 702, 654, + 705, 744, 703, 694, 674, 686, 706, 740, + 728, 678, 810, 222, 534, 760, 748, 0, + 796, 148, 260, 768, 764, 762, 772, 626, + 795, 788, 776, 626, 792, 780, 798, 158, + 834, 804, 800, 826, 581, 0, 840, 858, + 860, 336, 670, 704, 862, 92, 850, 704, // Entry 140 - 17F - 876, 581, 882, 973, 974, 975, 976, 977, - 978, 979, 980, 981, 982, 983, 984, 985, - 986, 987, 988, 989, 990, 991, 992, 993, - 994, 995, 996, 997, 998, 720, 887, 175, - 891, 710, 894, 180, 716, 999, + 548, 876, 581, 882, 973, 974, 975, 976, + 977, 978, 979, 980, 981, 982, 983, 984, + 985, 986, 987, 988, 989, 990, 991, 992, + 993, 994, 995, 996, 997, 998, 720, 887, + 175, 891, 710, 894, 180, 716, 999, } // m49Index gives indexes into fromM49 based on the three most significant bits @@ -1227,65 +1243,65 @@ var m49Index = [9]int16{ var fromM49 = [333]uint16{ // Entry 0 - 3F 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, - 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, + 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, // Entry 40 - 7F - 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, - 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, - 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, - 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, - 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, - 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, - 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, + 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, + 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, + 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, + 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, + 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, + 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, // Entry 80 - BF - 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, - 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, - 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, - 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, - 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, - 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, - 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, - 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, + 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, + 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, + 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, + 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, + 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, + 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, + 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, // Entry C0 - FF - 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, - 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, - 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, - 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, - 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, - 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, - 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, - 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, + 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, + 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, + 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, + 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, + 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, + 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, + 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, // Entry 100 - 13F - 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, - 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, - 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, - 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, - 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, - 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, - 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, - 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, + 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, + 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, + 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, + 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, + 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, + 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, + 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, // Entry 140 - 17F - 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, - 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, + 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, + 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, } -// Size: 2014 bytes +// Size: 2128 bytes var variantIndex = map[string]uint8{ "1606nict": 0x0, "1694acad": 0x1, "1901": 0x2, "1959acad": 0x3, - "1994": 0x61, + "1994": 0x67, "1996": 0x4, "abl1943": 0x5, "akuapem": 0x6, - "alalc97": 0x63, + "alalc97": 0x69, "aluku": 0x7, "ao1990": 0x8, "aranes": 0x9, @@ -1299,94 +1315,100 @@ var variantIndex = map[string]uint8{ "barla": 0x11, "basiceng": 0x12, "bauddha": 0x13, - "biscayan": 0x14, - "biske": 0x5c, - "bohoric": 0x15, - "boont": 0x16, - "bornholm": 0x17, - "cisaup": 0x18, - "colb1945": 0x19, - "cornu": 0x1a, - "creiss": 0x1b, - "dajnko": 0x1c, - "ekavsk": 0x1d, - "emodeng": 0x1e, - "fonipa": 0x64, - "fonkirsh": 0x65, - "fonnapa": 0x66, - "fonupa": 0x67, - "fonxsamp": 0x68, - "gascon": 0x1f, - "grclass": 0x20, - "grital": 0x21, - "grmistr": 0x22, - "hepburn": 0x23, - "heploc": 0x62, - "hognorsk": 0x24, - "hsistemo": 0x25, - "ijekavsk": 0x26, - "itihasa": 0x27, - "ivanchov": 0x28, - "jauer": 0x29, - "jyutping": 0x2a, - "kkcor": 0x2b, - "kociewie": 0x2c, - "kscor": 0x2d, - "laukika": 0x2e, - "lemosin": 0x2f, - "lengadoc": 0x30, - "lipaw": 0x5d, - "luna1918": 0x31, - "metelko": 0x32, - "monoton": 0x33, - "ndyuka": 0x34, - "nedis": 0x35, - "newfound": 0x36, - "nicard": 0x37, - "njiva": 0x5e, - "nulik": 0x38, - "osojs": 0x5f, - "oxendict": 0x39, - "pahawh2": 0x3a, - "pahawh3": 0x3b, - "pahawh4": 0x3c, - "pamaka": 0x3d, - "peano": 0x3e, - "petr1708": 0x3f, - "pinyin": 0x40, - "polyton": 0x41, - "provenc": 0x42, - "puter": 0x43, - "rigik": 0x44, - "rozaj": 0x45, - "rumgr": 0x46, - "scotland": 0x47, - "scouse": 0x48, - "simple": 0x69, - "solba": 0x60, - "sotav": 0x49, - "spanglis": 0x4a, - "surmiran": 0x4b, - "sursilv": 0x4c, - "sutsilv": 0x4d, - "tarask": 0x4e, - "tongyong": 0x4f, - "tunumiit": 0x50, - "uccor": 0x51, - "ucrcor": 0x52, - "ulster": 0x53, - "unifon": 0x54, - "vaidika": 0x55, - "valencia": 0x56, - "vallader": 0x57, - "vecdruka": 0x58, - "vivaraup": 0x59, - "wadegile": 0x5a, - "xsistemo": 0x5b, + "bciav": 0x14, + "bcizbl": 0x15, + "biscayan": 0x16, + "biske": 0x62, + "bohoric": 0x17, + "boont": 0x18, + "bornholm": 0x19, + "cisaup": 0x1a, + "colb1945": 0x1b, + "cornu": 0x1c, + "creiss": 0x1d, + "dajnko": 0x1e, + "ekavsk": 0x1f, + "emodeng": 0x20, + "fonipa": 0x6a, + "fonkirsh": 0x6b, + "fonnapa": 0x6c, + "fonupa": 0x6d, + "fonxsamp": 0x6e, + "gallo": 0x21, + "gascon": 0x22, + "grclass": 0x23, + "grital": 0x24, + "grmistr": 0x25, + "hepburn": 0x26, + "heploc": 0x68, + "hognorsk": 0x27, + "hsistemo": 0x28, + "ijekavsk": 0x29, + "itihasa": 0x2a, + "ivanchov": 0x2b, + "jauer": 0x2c, + "jyutping": 0x2d, + "kkcor": 0x2e, + "kociewie": 0x2f, + "kscor": 0x30, + "laukika": 0x31, + "lemosin": 0x32, + "lengadoc": 0x33, + "lipaw": 0x63, + "ltg1929": 0x34, + "ltg2007": 0x35, + "luna1918": 0x36, + "metelko": 0x37, + "monoton": 0x38, + "ndyuka": 0x39, + "nedis": 0x3a, + "newfound": 0x3b, + "nicard": 0x3c, + "njiva": 0x64, + "nulik": 0x3d, + "osojs": 0x65, + "oxendict": 0x3e, + "pahawh2": 0x3f, + "pahawh3": 0x40, + "pahawh4": 0x41, + "pamaka": 0x42, + "peano": 0x43, + "petr1708": 0x44, + "pinyin": 0x45, + "polyton": 0x46, + "provenc": 0x47, + "puter": 0x48, + "rigik": 0x49, + "rozaj": 0x4a, + "rumgr": 0x4b, + "scotland": 0x4c, + "scouse": 0x4d, + "simple": 0x6f, + "solba": 0x66, + "sotav": 0x4e, + "spanglis": 0x4f, + "surmiran": 0x50, + "sursilv": 0x51, + "sutsilv": 0x52, + "synnejyl": 0x53, + "tarask": 0x54, + "tongyong": 0x55, + "tunumiit": 0x56, + "uccor": 0x57, + "ucrcor": 0x58, + "ulster": 0x59, + "unifon": 0x5a, + "vaidika": 0x5b, + "valencia": 0x5c, + "vallader": 0x5d, + "vecdruka": 0x5e, + "vivaraup": 0x5f, + "wadegile": 0x60, + "xsistemo": 0x61, } // variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 99 +const variantNumSpecialized = 105 // nRegionGroups is the number of region groups. const nRegionGroups = 33 @@ -1398,151 +1420,151 @@ type likelyLangRegion struct { // likelyScript is a lookup table, indexed by scriptID, for the most likely // languages and regions given a script. -// Size: 1040 bytes, 260 elements -var likelyScript = [260]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x84}, - 3: {lang: 0x2a2, region: 0x106}, - 4: {lang: 0x1f, region: 0x99}, - 5: {lang: 0x3a, region: 0x6b}, - 7: {lang: 0x3b, region: 0x9c}, +// Size: 1052 bytes, 263 elements +var likelyScript = [263]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x85}, + 3: {lang: 0x2a2, region: 0x107}, + 4: {lang: 0x1f, region: 0x9a}, + 5: {lang: 0x3a, region: 0x6c}, + 7: {lang: 0x3b, region: 0x9d}, 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9c}, - 10: {lang: 0x5b, region: 0x95}, + 9: {lang: 0x13, region: 0x9d}, + 10: {lang: 0x5b, region: 0x96}, 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb4}, - 13: {lang: 0x63, region: 0x95}, + 12: {lang: 0xb9, region: 0xb5}, + 13: {lang: 0x63, region: 0x96}, 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x99}, - 17: {lang: 0x529, region: 0x12e}, - 18: {lang: 0x3b1, region: 0x99}, - 19: {lang: 0x15e, region: 0x78}, - 20: {lang: 0xc2, region: 0x95}, - 21: {lang: 0x9d, region: 0xe7}, + 15: {lang: 0x3e9, region: 0x9a}, + 17: {lang: 0x529, region: 0x12f}, + 18: {lang: 0x3b1, region: 0x9a}, + 19: {lang: 0x15e, region: 0x79}, + 20: {lang: 0xc2, region: 0x96}, + 21: {lang: 0x9d, region: 0xe8}, 22: {lang: 0xdb, region: 0x35}, 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12b}, - 25: {lang: 0xe7, region: 0x13e}, - 26: {lang: 0xe5, region: 0x135}, - 29: {lang: 0xf1, region: 0x6b}, - 31: {lang: 0x1a0, region: 0x5d}, - 32: {lang: 0x3e2, region: 0x106}, - 34: {lang: 0x1be, region: 0x99}, - 38: {lang: 0x15e, region: 0x78}, - 41: {lang: 0x133, region: 0x6b}, + 24: {lang: 0x4f0, region: 0x12c}, + 25: {lang: 0xe7, region: 0x13f}, + 26: {lang: 0xe5, region: 0x136}, + 29: {lang: 0xf1, region: 0x6c}, + 31: {lang: 0x1a0, region: 0x5e}, + 32: {lang: 0x3e2, region: 0x107}, + 34: {lang: 0x1be, region: 0x9a}, + 38: {lang: 0x15e, region: 0x79}, + 41: {lang: 0x133, region: 0x6c}, 42: {lang: 0x431, region: 0x27}, - 44: {lang: 0x27, region: 0x6f}, - 46: {lang: 0x210, region: 0x7d}, + 44: {lang: 0x27, region: 0x70}, + 46: {lang: 0x210, region: 0x7e}, 47: {lang: 0xfe, region: 0x38}, - 49: {lang: 0x19b, region: 0x99}, - 50: {lang: 0x19e, region: 0x130}, - 51: {lang: 0x3e9, region: 0x99}, - 52: {lang: 0x136, region: 0x87}, - 53: {lang: 0x1a4, region: 0x99}, - 54: {lang: 0x39d, region: 0x99}, - 55: {lang: 0x529, region: 0x12e}, - 56: {lang: 0x254, region: 0xab}, + 49: {lang: 0x19b, region: 0x9a}, + 50: {lang: 0x19e, region: 0x131}, + 51: {lang: 0x3e9, region: 0x9a}, + 52: {lang: 0x136, region: 0x88}, + 53: {lang: 0x1a4, region: 0x9a}, + 54: {lang: 0x39d, region: 0x9a}, + 55: {lang: 0x529, region: 0x12f}, + 56: {lang: 0x254, region: 0xac}, 57: {lang: 0x529, region: 0x53}, - 58: {lang: 0x1cb, region: 0xe7}, + 58: {lang: 0x1cb, region: 0xe8}, 59: {lang: 0x529, region: 0x53}, - 60: {lang: 0x529, region: 0x12e}, - 61: {lang: 0x2fd, region: 0x9b}, - 62: {lang: 0x1bc, region: 0x97}, - 63: {lang: 0x200, region: 0xa2}, - 64: {lang: 0x1c5, region: 0x12b}, - 65: {lang: 0x1ca, region: 0xaf}, - 68: {lang: 0x1d5, region: 0x92}, - 70: {lang: 0x142, region: 0x9e}, - 71: {lang: 0x254, region: 0xab}, - 72: {lang: 0x20e, region: 0x95}, - 73: {lang: 0x200, region: 0xa2}, - 75: {lang: 0x135, region: 0xc4}, - 76: {lang: 0x200, region: 0xa2}, - 77: {lang: 0x3bb, region: 0xe8}, - 78: {lang: 0x24a, region: 0xa6}, - 79: {lang: 0x3fa, region: 0x99}, - 82: {lang: 0x251, region: 0x99}, - 83: {lang: 0x254, region: 0xab}, - 85: {lang: 0x88, region: 0x99}, - 86: {lang: 0x370, region: 0x123}, - 87: {lang: 0x2b8, region: 0xaf}, - 92: {lang: 0x29f, region: 0x99}, - 93: {lang: 0x2a8, region: 0x99}, - 94: {lang: 0x28f, region: 0x87}, - 95: {lang: 0x1a0, region: 0x87}, - 96: {lang: 0x2ac, region: 0x53}, - 98: {lang: 0x4f4, region: 0x12b}, - 99: {lang: 0x4f5, region: 0x12b}, - 100: {lang: 0x1be, region: 0x99}, - 102: {lang: 0x337, region: 0x9c}, - 103: {lang: 0x4f7, region: 0x53}, - 104: {lang: 0xa9, region: 0x53}, - 107: {lang: 0x2e8, region: 0x112}, - 108: {lang: 0x4f8, region: 0x10b}, - 109: {lang: 0x4f8, region: 0x10b}, - 110: {lang: 0x304, region: 0x99}, - 111: {lang: 0x31b, region: 0x99}, - 112: {lang: 0x30b, region: 0x53}, - 114: {lang: 0x31e, region: 0x35}, - 115: {lang: 0x30e, region: 0x99}, - 116: {lang: 0x414, region: 0xe8}, - 117: {lang: 0x331, region: 0xc4}, - 119: {lang: 0x4f9, region: 0x108}, - 120: {lang: 0x3b, region: 0xa1}, - 121: {lang: 0x353, region: 0xdb}, - 124: {lang: 0x2d0, region: 0x84}, - 125: {lang: 0x52a, region: 0x53}, - 126: {lang: 0x403, region: 0x96}, - 127: {lang: 0x3ee, region: 0x99}, - 128: {lang: 0x39b, region: 0xc5}, - 129: {lang: 0x395, region: 0x99}, - 130: {lang: 0x399, region: 0x135}, - 131: {lang: 0x429, region: 0x115}, - 133: {lang: 0x3b, region: 0x11c}, - 134: {lang: 0xfd, region: 0xc4}, - 137: {lang: 0x27d, region: 0x106}, - 138: {lang: 0x2c9, region: 0x53}, - 139: {lang: 0x39f, region: 0x9c}, - 140: {lang: 0x39f, region: 0x53}, - 142: {lang: 0x3ad, region: 0xb0}, - 144: {lang: 0x1c6, region: 0x53}, - 145: {lang: 0x4fd, region: 0x9c}, - 198: {lang: 0x3cb, region: 0x95}, - 201: {lang: 0x372, region: 0x10c}, - 202: {lang: 0x420, region: 0x97}, - 204: {lang: 0x4ff, region: 0x15e}, - 205: {lang: 0x3f0, region: 0x99}, - 206: {lang: 0x45, region: 0x135}, - 207: {lang: 0x139, region: 0x7b}, - 208: {lang: 0x3e9, region: 0x99}, - 210: {lang: 0x3e9, region: 0x99}, - 211: {lang: 0x3fa, region: 0x99}, - 212: {lang: 0x40c, region: 0xb3}, - 215: {lang: 0x433, region: 0x99}, - 216: {lang: 0xef, region: 0xc5}, - 217: {lang: 0x43e, region: 0x95}, - 218: {lang: 0x44d, region: 0x35}, - 219: {lang: 0x44e, region: 0x9b}, - 223: {lang: 0x45a, region: 0xe7}, - 224: {lang: 0x11a, region: 0x99}, - 225: {lang: 0x45e, region: 0x53}, - 226: {lang: 0x232, region: 0x53}, - 227: {lang: 0x450, region: 0x99}, - 228: {lang: 0x4a5, region: 0x53}, - 229: {lang: 0x9f, region: 0x13e}, - 230: {lang: 0x461, region: 0x99}, - 232: {lang: 0x528, region: 0xba}, - 233: {lang: 0x153, region: 0xe7}, - 234: {lang: 0x128, region: 0xcd}, - 235: {lang: 0x46b, region: 0x123}, - 236: {lang: 0xa9, region: 0x53}, - 237: {lang: 0x2ce, region: 0x99}, - 240: {lang: 0x4ad, region: 0x11c}, - 241: {lang: 0x4be, region: 0xb4}, - 244: {lang: 0x1ce, region: 0x99}, - 247: {lang: 0x3a9, region: 0x9c}, - 248: {lang: 0x22, region: 0x9b}, - 250: {lang: 0x1ea, region: 0x53}, - 251: {lang: 0xef, region: 0xc5}, + 60: {lang: 0x529, region: 0x12f}, + 61: {lang: 0x2fd, region: 0x9c}, + 62: {lang: 0x1bc, region: 0x98}, + 63: {lang: 0x200, region: 0xa3}, + 64: {lang: 0x1c5, region: 0x12c}, + 65: {lang: 0x1ca, region: 0xb0}, + 68: {lang: 0x1d5, region: 0x93}, + 70: {lang: 0x142, region: 0x9f}, + 71: {lang: 0x254, region: 0xac}, + 72: {lang: 0x20e, region: 0x96}, + 73: {lang: 0x200, region: 0xa3}, + 75: {lang: 0x135, region: 0xc5}, + 76: {lang: 0x200, region: 0xa3}, + 78: {lang: 0x3bb, region: 0xe9}, + 79: {lang: 0x24a, region: 0xa7}, + 80: {lang: 0x3fa, region: 0x9a}, + 83: {lang: 0x251, region: 0x9a}, + 84: {lang: 0x254, region: 0xac}, + 86: {lang: 0x88, region: 0x9a}, + 87: {lang: 0x370, region: 0x124}, + 88: {lang: 0x2b8, region: 0xb0}, + 93: {lang: 0x29f, region: 0x9a}, + 94: {lang: 0x2a8, region: 0x9a}, + 95: {lang: 0x28f, region: 0x88}, + 96: {lang: 0x1a0, region: 0x88}, + 97: {lang: 0x2ac, region: 0x53}, + 99: {lang: 0x4f4, region: 0x12c}, + 100: {lang: 0x4f5, region: 0x12c}, + 101: {lang: 0x1be, region: 0x9a}, + 103: {lang: 0x337, region: 0x9d}, + 104: {lang: 0x4f7, region: 0x53}, + 105: {lang: 0xa9, region: 0x53}, + 108: {lang: 0x2e8, region: 0x113}, + 109: {lang: 0x4f8, region: 0x10c}, + 110: {lang: 0x4f8, region: 0x10c}, + 111: {lang: 0x304, region: 0x9a}, + 112: {lang: 0x31b, region: 0x9a}, + 113: {lang: 0x30b, region: 0x53}, + 115: {lang: 0x31e, region: 0x35}, + 116: {lang: 0x30e, region: 0x9a}, + 117: {lang: 0x414, region: 0xe9}, + 118: {lang: 0x331, region: 0xc5}, + 121: {lang: 0x4f9, region: 0x109}, + 122: {lang: 0x3b, region: 0xa2}, + 123: {lang: 0x353, region: 0xdc}, + 126: {lang: 0x2d0, region: 0x85}, + 127: {lang: 0x52a, region: 0x53}, + 128: {lang: 0x403, region: 0x97}, + 129: {lang: 0x3ee, region: 0x9a}, + 130: {lang: 0x39b, region: 0xc6}, + 131: {lang: 0x395, region: 0x9a}, + 132: {lang: 0x399, region: 0x136}, + 133: {lang: 0x429, region: 0x116}, + 135: {lang: 0x3b, region: 0x11d}, + 136: {lang: 0xfd, region: 0xc5}, + 139: {lang: 0x27d, region: 0x107}, + 140: {lang: 0x2c9, region: 0x53}, + 141: {lang: 0x39f, region: 0x9d}, + 142: {lang: 0x39f, region: 0x53}, + 144: {lang: 0x3ad, region: 0xb1}, + 146: {lang: 0x1c6, region: 0x53}, + 147: {lang: 0x4fd, region: 0x9d}, + 200: {lang: 0x3cb, region: 0x96}, + 203: {lang: 0x372, region: 0x10d}, + 204: {lang: 0x420, region: 0x98}, + 206: {lang: 0x4ff, region: 0x15f}, + 207: {lang: 0x3f0, region: 0x9a}, + 208: {lang: 0x45, region: 0x136}, + 209: {lang: 0x139, region: 0x7c}, + 210: {lang: 0x3e9, region: 0x9a}, + 212: {lang: 0x3e9, region: 0x9a}, + 213: {lang: 0x3fa, region: 0x9a}, + 214: {lang: 0x40c, region: 0xb4}, + 217: {lang: 0x433, region: 0x9a}, + 218: {lang: 0xef, region: 0xc6}, + 219: {lang: 0x43e, region: 0x96}, + 221: {lang: 0x44d, region: 0x35}, + 222: {lang: 0x44e, region: 0x9c}, + 226: {lang: 0x45a, region: 0xe8}, + 227: {lang: 0x11a, region: 0x9a}, + 228: {lang: 0x45e, region: 0x53}, + 229: {lang: 0x232, region: 0x53}, + 230: {lang: 0x450, region: 0x9a}, + 231: {lang: 0x4a5, region: 0x53}, + 232: {lang: 0x9f, region: 0x13f}, + 233: {lang: 0x461, region: 0x9a}, + 235: {lang: 0x528, region: 0xbb}, + 236: {lang: 0x153, region: 0xe8}, + 237: {lang: 0x128, region: 0xce}, + 238: {lang: 0x46b, region: 0x124}, + 239: {lang: 0xa9, region: 0x53}, + 240: {lang: 0x2ce, region: 0x9a}, + 243: {lang: 0x4ad, region: 0x11d}, + 244: {lang: 0x4be, region: 0xb5}, + 247: {lang: 0x1ce, region: 0x9a}, + 250: {lang: 0x3a9, region: 0x9d}, + 251: {lang: 0x22, region: 0x9c}, + 253: {lang: 0x1ea, region: 0x53}, + 254: {lang: 0xef, region: 0xc6}, } type likelyScriptRegion struct { @@ -1557,1423 +1579,1423 @@ type likelyScriptRegion struct { // of the list in likelyLangList. // Size: 7980 bytes, 1330 elements var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x135, script: 0x5a, flags: 0x0}, - 1: {region: 0x6f, script: 0x5a, flags: 0x0}, - 2: {region: 0x165, script: 0x5a, flags: 0x0}, - 3: {region: 0x165, script: 0x5a, flags: 0x0}, - 4: {region: 0x165, script: 0x5a, flags: 0x0}, - 5: {region: 0x7d, script: 0x20, flags: 0x0}, - 6: {region: 0x165, script: 0x5a, flags: 0x0}, - 7: {region: 0x165, script: 0x20, flags: 0x0}, - 8: {region: 0x80, script: 0x5a, flags: 0x0}, - 9: {region: 0x165, script: 0x5a, flags: 0x0}, - 10: {region: 0x165, script: 0x5a, flags: 0x0}, - 11: {region: 0x165, script: 0x5a, flags: 0x0}, - 12: {region: 0x95, script: 0x5a, flags: 0x0}, - 13: {region: 0x131, script: 0x5a, flags: 0x0}, - 14: {region: 0x80, script: 0x5a, flags: 0x0}, - 15: {region: 0x165, script: 0x5a, flags: 0x0}, - 16: {region: 0x165, script: 0x5a, flags: 0x0}, - 17: {region: 0x106, script: 0x20, flags: 0x0}, - 18: {region: 0x165, script: 0x5a, flags: 0x0}, - 19: {region: 0x9c, script: 0x9, flags: 0x0}, - 20: {region: 0x128, script: 0x5, flags: 0x0}, - 21: {region: 0x165, script: 0x5a, flags: 0x0}, - 22: {region: 0x161, script: 0x5a, flags: 0x0}, - 23: {region: 0x165, script: 0x5a, flags: 0x0}, - 24: {region: 0x165, script: 0x5a, flags: 0x0}, - 25: {region: 0x165, script: 0x5a, flags: 0x0}, - 26: {region: 0x165, script: 0x5a, flags: 0x0}, - 27: {region: 0x165, script: 0x5a, flags: 0x0}, - 28: {region: 0x52, script: 0x5a, flags: 0x0}, - 29: {region: 0x165, script: 0x5a, flags: 0x0}, - 30: {region: 0x165, script: 0x5a, flags: 0x0}, - 31: {region: 0x99, script: 0x4, flags: 0x0}, - 32: {region: 0x165, script: 0x5a, flags: 0x0}, - 33: {region: 0x80, script: 0x5a, flags: 0x0}, - 34: {region: 0x9b, script: 0xf8, flags: 0x0}, - 35: {region: 0x165, script: 0x5a, flags: 0x0}, - 36: {region: 0x165, script: 0x5a, flags: 0x0}, - 37: {region: 0x14d, script: 0x5a, flags: 0x0}, - 38: {region: 0x106, script: 0x20, flags: 0x0}, - 39: {region: 0x6f, script: 0x2c, flags: 0x0}, - 40: {region: 0x165, script: 0x5a, flags: 0x0}, - 41: {region: 0x165, script: 0x5a, flags: 0x0}, - 42: {region: 0xd6, script: 0x5a, flags: 0x0}, - 43: {region: 0x165, script: 0x5a, flags: 0x0}, - 45: {region: 0x165, script: 0x5a, flags: 0x0}, - 46: {region: 0x165, script: 0x5a, flags: 0x0}, - 47: {region: 0x165, script: 0x5a, flags: 0x0}, - 48: {region: 0x165, script: 0x5a, flags: 0x0}, - 49: {region: 0x165, script: 0x5a, flags: 0x0}, - 50: {region: 0x165, script: 0x5a, flags: 0x0}, - 51: {region: 0x95, script: 0x5a, flags: 0x0}, - 52: {region: 0x165, script: 0x5, flags: 0x0}, - 53: {region: 0x122, script: 0x5, flags: 0x0}, - 54: {region: 0x165, script: 0x5a, flags: 0x0}, - 55: {region: 0x165, script: 0x5a, flags: 0x0}, - 56: {region: 0x165, script: 0x5a, flags: 0x0}, - 57: {region: 0x165, script: 0x5a, flags: 0x0}, - 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 0: {region: 0x136, script: 0x5b, flags: 0x0}, + 1: {region: 0x70, script: 0x5b, flags: 0x0}, + 2: {region: 0x166, script: 0x5b, flags: 0x0}, + 3: {region: 0x166, script: 0x5b, flags: 0x0}, + 4: {region: 0x166, script: 0x5b, flags: 0x0}, + 5: {region: 0x7e, script: 0x20, flags: 0x0}, + 6: {region: 0x166, script: 0x5b, flags: 0x0}, + 7: {region: 0x166, script: 0x20, flags: 0x0}, + 8: {region: 0x81, script: 0x5b, flags: 0x0}, + 9: {region: 0x166, script: 0x5b, flags: 0x0}, + 10: {region: 0x166, script: 0x5b, flags: 0x0}, + 11: {region: 0x166, script: 0x5b, flags: 0x0}, + 12: {region: 0x96, script: 0x5b, flags: 0x0}, + 13: {region: 0x132, script: 0x5b, flags: 0x0}, + 14: {region: 0x81, script: 0x5b, flags: 0x0}, + 15: {region: 0x166, script: 0x5b, flags: 0x0}, + 16: {region: 0x166, script: 0x5b, flags: 0x0}, + 17: {region: 0x107, script: 0x20, flags: 0x0}, + 18: {region: 0x166, script: 0x5b, flags: 0x0}, + 19: {region: 0x9d, script: 0x9, flags: 0x0}, + 20: {region: 0x129, script: 0x5, flags: 0x0}, + 21: {region: 0x166, script: 0x5b, flags: 0x0}, + 22: {region: 0x162, script: 0x5b, flags: 0x0}, + 23: {region: 0x166, script: 0x5b, flags: 0x0}, + 24: {region: 0x166, script: 0x5b, flags: 0x0}, + 25: {region: 0x166, script: 0x5b, flags: 0x0}, + 26: {region: 0x166, script: 0x5b, flags: 0x0}, + 27: {region: 0x166, script: 0x5b, flags: 0x0}, + 28: {region: 0x52, script: 0x5b, flags: 0x0}, + 29: {region: 0x166, script: 0x5b, flags: 0x0}, + 30: {region: 0x166, script: 0x5b, flags: 0x0}, + 31: {region: 0x9a, script: 0x4, flags: 0x0}, + 32: {region: 0x166, script: 0x5b, flags: 0x0}, + 33: {region: 0x81, script: 0x5b, flags: 0x0}, + 34: {region: 0x9c, script: 0xfb, flags: 0x0}, + 35: {region: 0x166, script: 0x5b, flags: 0x0}, + 36: {region: 0x166, script: 0x5b, flags: 0x0}, + 37: {region: 0x14e, script: 0x5b, flags: 0x0}, + 38: {region: 0x107, script: 0x20, flags: 0x0}, + 39: {region: 0x70, script: 0x2c, flags: 0x0}, + 40: {region: 0x166, script: 0x5b, flags: 0x0}, + 41: {region: 0x166, script: 0x5b, flags: 0x0}, + 42: {region: 0xd7, script: 0x5b, flags: 0x0}, + 43: {region: 0x166, script: 0x5b, flags: 0x0}, + 45: {region: 0x166, script: 0x5b, flags: 0x0}, + 46: {region: 0x166, script: 0x5b, flags: 0x0}, + 47: {region: 0x166, script: 0x5b, flags: 0x0}, + 48: {region: 0x166, script: 0x5b, flags: 0x0}, + 49: {region: 0x166, script: 0x5b, flags: 0x0}, + 50: {region: 0x166, script: 0x5b, flags: 0x0}, + 51: {region: 0x96, script: 0x5b, flags: 0x0}, + 52: {region: 0x166, script: 0x5, flags: 0x0}, + 53: {region: 0x123, script: 0x5, flags: 0x0}, + 54: {region: 0x166, script: 0x5b, flags: 0x0}, + 55: {region: 0x166, script: 0x5b, flags: 0x0}, + 56: {region: 0x166, script: 0x5b, flags: 0x0}, + 57: {region: 0x166, script: 0x5b, flags: 0x0}, + 58: {region: 0x6c, script: 0x5, flags: 0x0}, 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x165, script: 0x5a, flags: 0x0}, - 61: {region: 0x51, script: 0x5a, flags: 0x0}, - 62: {region: 0x3f, script: 0x5a, flags: 0x0}, - 63: {region: 0x67, script: 0x5, flags: 0x0}, - 65: {region: 0xba, script: 0x5, flags: 0x0}, - 66: {region: 0x6b, script: 0x5, flags: 0x0}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0x12f, script: 0x5a, flags: 0x0}, - 69: {region: 0x135, script: 0xce, flags: 0x0}, - 70: {region: 0x165, script: 0x5a, flags: 0x0}, - 71: {region: 0x165, script: 0x5a, flags: 0x0}, - 72: {region: 0x6e, script: 0x5a, flags: 0x0}, - 73: {region: 0x165, script: 0x5a, flags: 0x0}, - 74: {region: 0x165, script: 0x5a, flags: 0x0}, - 75: {region: 0x49, script: 0x5a, flags: 0x0}, - 76: {region: 0x165, script: 0x5a, flags: 0x0}, - 77: {region: 0x106, script: 0x20, flags: 0x0}, - 78: {region: 0x165, script: 0x5, flags: 0x0}, - 79: {region: 0x165, script: 0x5a, flags: 0x0}, - 80: {region: 0x165, script: 0x5a, flags: 0x0}, - 81: {region: 0x165, script: 0x5a, flags: 0x0}, - 82: {region: 0x99, script: 0x22, flags: 0x0}, - 83: {region: 0x165, script: 0x5a, flags: 0x0}, - 84: {region: 0x165, script: 0x5a, flags: 0x0}, - 85: {region: 0x165, script: 0x5a, flags: 0x0}, - 86: {region: 0x3f, script: 0x5a, flags: 0x0}, - 87: {region: 0x165, script: 0x5a, flags: 0x0}, + 60: {region: 0x166, script: 0x5b, flags: 0x0}, + 61: {region: 0x51, script: 0x5b, flags: 0x0}, + 62: {region: 0x3f, script: 0x5b, flags: 0x0}, + 63: {region: 0x68, script: 0x5, flags: 0x0}, + 65: {region: 0xbb, script: 0x5, flags: 0x0}, + 66: {region: 0x6c, script: 0x5, flags: 0x0}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0x130, script: 0x5b, flags: 0x0}, + 69: {region: 0x136, script: 0xd0, flags: 0x0}, + 70: {region: 0x166, script: 0x5b, flags: 0x0}, + 71: {region: 0x166, script: 0x5b, flags: 0x0}, + 72: {region: 0x6f, script: 0x5b, flags: 0x0}, + 73: {region: 0x166, script: 0x5b, flags: 0x0}, + 74: {region: 0x166, script: 0x5b, flags: 0x0}, + 75: {region: 0x49, script: 0x5b, flags: 0x0}, + 76: {region: 0x166, script: 0x5b, flags: 0x0}, + 77: {region: 0x107, script: 0x20, flags: 0x0}, + 78: {region: 0x166, script: 0x5, flags: 0x0}, + 79: {region: 0x166, script: 0x5b, flags: 0x0}, + 80: {region: 0x166, script: 0x5b, flags: 0x0}, + 81: {region: 0x166, script: 0x5b, flags: 0x0}, + 82: {region: 0x9a, script: 0x22, flags: 0x0}, + 83: {region: 0x166, script: 0x5b, flags: 0x0}, + 84: {region: 0x166, script: 0x5b, flags: 0x0}, + 85: {region: 0x166, script: 0x5b, flags: 0x0}, + 86: {region: 0x3f, script: 0x5b, flags: 0x0}, + 87: {region: 0x166, script: 0x5b, flags: 0x0}, 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x106, script: 0x20, flags: 0x0}, - 90: {region: 0xe8, script: 0x5, flags: 0x0}, - 91: {region: 0x95, script: 0x5a, flags: 0x0}, - 92: {region: 0xdb, script: 0x22, flags: 0x0}, - 93: {region: 0x2e, script: 0x5a, flags: 0x0}, - 94: {region: 0x52, script: 0x5a, flags: 0x0}, - 95: {region: 0x165, script: 0x5a, flags: 0x0}, + 89: {region: 0x107, script: 0x20, flags: 0x0}, + 90: {region: 0xe9, script: 0x5, flags: 0x0}, + 91: {region: 0x96, script: 0x5b, flags: 0x0}, + 92: {region: 0xdc, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5b, flags: 0x0}, + 94: {region: 0x52, script: 0x5b, flags: 0x0}, + 95: {region: 0x166, script: 0x5b, flags: 0x0}, 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x165, script: 0x5a, flags: 0x0}, - 98: {region: 0x165, script: 0x5a, flags: 0x0}, - 99: {region: 0x95, script: 0x5a, flags: 0x0}, - 100: {region: 0x165, script: 0x5a, flags: 0x0}, - 101: {region: 0x52, script: 0x5a, flags: 0x0}, - 102: {region: 0x165, script: 0x5a, flags: 0x0}, - 103: {region: 0x165, script: 0x5a, flags: 0x0}, - 104: {region: 0x165, script: 0x5a, flags: 0x0}, - 105: {region: 0x165, script: 0x5a, flags: 0x0}, - 106: {region: 0x4f, script: 0x5a, flags: 0x0}, - 107: {region: 0x165, script: 0x5a, flags: 0x0}, - 108: {region: 0x165, script: 0x5a, flags: 0x0}, - 109: {region: 0x165, script: 0x5a, flags: 0x0}, - 110: {region: 0x165, script: 0x2c, flags: 0x0}, - 111: {region: 0x165, script: 0x5a, flags: 0x0}, - 112: {region: 0x165, script: 0x5a, flags: 0x0}, + 97: {region: 0x166, script: 0x5b, flags: 0x0}, + 98: {region: 0x166, script: 0x5b, flags: 0x0}, + 99: {region: 0x96, script: 0x5b, flags: 0x0}, + 100: {region: 0x166, script: 0x5b, flags: 0x0}, + 101: {region: 0x52, script: 0x5b, flags: 0x0}, + 102: {region: 0x166, script: 0x5b, flags: 0x0}, + 103: {region: 0x166, script: 0x5b, flags: 0x0}, + 104: {region: 0x166, script: 0x5b, flags: 0x0}, + 105: {region: 0x166, script: 0x5b, flags: 0x0}, + 106: {region: 0x4f, script: 0x5b, flags: 0x0}, + 107: {region: 0x166, script: 0x5b, flags: 0x0}, + 108: {region: 0x166, script: 0x5b, flags: 0x0}, + 109: {region: 0x166, script: 0x5b, flags: 0x0}, + 110: {region: 0x166, script: 0x2c, flags: 0x0}, + 111: {region: 0x166, script: 0x5b, flags: 0x0}, + 112: {region: 0x166, script: 0x5b, flags: 0x0}, 113: {region: 0x47, script: 0x20, flags: 0x0}, - 114: {region: 0x165, script: 0x5a, flags: 0x0}, - 115: {region: 0x165, script: 0x5a, flags: 0x0}, - 116: {region: 0x10b, script: 0x5, flags: 0x0}, - 117: {region: 0x162, script: 0x5a, flags: 0x0}, - 118: {region: 0x165, script: 0x5a, flags: 0x0}, - 119: {region: 0x95, script: 0x5a, flags: 0x0}, - 120: {region: 0x165, script: 0x5a, flags: 0x0}, - 121: {region: 0x12f, script: 0x5a, flags: 0x0}, - 122: {region: 0x52, script: 0x5a, flags: 0x0}, - 123: {region: 0x99, script: 0xe3, flags: 0x0}, - 124: {region: 0xe8, script: 0x5, flags: 0x0}, - 125: {region: 0x99, script: 0x22, flags: 0x0}, + 114: {region: 0x166, script: 0x5b, flags: 0x0}, + 115: {region: 0x166, script: 0x5b, flags: 0x0}, + 116: {region: 0x10c, script: 0x5, flags: 0x0}, + 117: {region: 0x163, script: 0x5b, flags: 0x0}, + 118: {region: 0x166, script: 0x5b, flags: 0x0}, + 119: {region: 0x96, script: 0x5b, flags: 0x0}, + 120: {region: 0x166, script: 0x5b, flags: 0x0}, + 121: {region: 0x130, script: 0x5b, flags: 0x0}, + 122: {region: 0x52, script: 0x5b, flags: 0x0}, + 123: {region: 0x9a, script: 0xe6, flags: 0x0}, + 124: {region: 0xe9, script: 0x5, flags: 0x0}, + 125: {region: 0x9a, script: 0x22, flags: 0x0}, 126: {region: 0x38, script: 0x20, flags: 0x0}, - 127: {region: 0x99, script: 0x22, flags: 0x0}, - 128: {region: 0xe8, script: 0x5, flags: 0x0}, - 129: {region: 0x12b, script: 0x34, flags: 0x0}, - 131: {region: 0x99, script: 0x22, flags: 0x0}, - 132: {region: 0x165, script: 0x5a, flags: 0x0}, - 133: {region: 0x99, script: 0x22, flags: 0x0}, - 134: {region: 0xe7, script: 0x5a, flags: 0x0}, - 135: {region: 0x165, script: 0x5a, flags: 0x0}, - 136: {region: 0x99, script: 0x22, flags: 0x0}, - 137: {region: 0x165, script: 0x5a, flags: 0x0}, - 138: {region: 0x13f, script: 0x5a, flags: 0x0}, - 139: {region: 0x165, script: 0x5a, flags: 0x0}, - 140: {region: 0x165, script: 0x5a, flags: 0x0}, - 141: {region: 0xe7, script: 0x5a, flags: 0x0}, - 142: {region: 0x165, script: 0x5a, flags: 0x0}, - 143: {region: 0xd6, script: 0x5a, flags: 0x0}, - 144: {region: 0x165, script: 0x5a, flags: 0x0}, - 145: {region: 0x165, script: 0x5a, flags: 0x0}, - 146: {region: 0x165, script: 0x5a, flags: 0x0}, - 147: {region: 0x165, script: 0x2c, flags: 0x0}, - 148: {region: 0x99, script: 0x22, flags: 0x0}, - 149: {region: 0x95, script: 0x5a, flags: 0x0}, - 150: {region: 0x165, script: 0x5a, flags: 0x0}, - 151: {region: 0x165, script: 0x5a, flags: 0x0}, - 152: {region: 0x114, script: 0x5a, flags: 0x0}, - 153: {region: 0x165, script: 0x5a, flags: 0x0}, - 154: {region: 0x165, script: 0x5a, flags: 0x0}, - 155: {region: 0x52, script: 0x5a, flags: 0x0}, - 156: {region: 0x165, script: 0x5a, flags: 0x0}, - 157: {region: 0xe7, script: 0x5a, flags: 0x0}, - 158: {region: 0x165, script: 0x5a, flags: 0x0}, - 159: {region: 0x13e, script: 0xe5, flags: 0x0}, - 160: {region: 0xc3, script: 0x5a, flags: 0x0}, - 161: {region: 0x165, script: 0x5a, flags: 0x0}, - 162: {region: 0x165, script: 0x5a, flags: 0x0}, - 163: {region: 0xc3, script: 0x5a, flags: 0x0}, - 164: {region: 0x165, script: 0x5a, flags: 0x0}, + 127: {region: 0x9a, script: 0x22, flags: 0x0}, + 128: {region: 0xe9, script: 0x5, flags: 0x0}, + 129: {region: 0x12c, script: 0x34, flags: 0x0}, + 131: {region: 0x9a, script: 0x22, flags: 0x0}, + 132: {region: 0x166, script: 0x5b, flags: 0x0}, + 133: {region: 0x9a, script: 0x22, flags: 0x0}, + 134: {region: 0xe8, script: 0x5b, flags: 0x0}, + 135: {region: 0x166, script: 0x5b, flags: 0x0}, + 136: {region: 0x9a, script: 0x22, flags: 0x0}, + 137: {region: 0x166, script: 0x5b, flags: 0x0}, + 138: {region: 0x140, script: 0x5b, flags: 0x0}, + 139: {region: 0x166, script: 0x5b, flags: 0x0}, + 140: {region: 0x166, script: 0x5b, flags: 0x0}, + 141: {region: 0xe8, script: 0x5b, flags: 0x0}, + 142: {region: 0x166, script: 0x5b, flags: 0x0}, + 143: {region: 0xd7, script: 0x5b, flags: 0x0}, + 144: {region: 0x166, script: 0x5b, flags: 0x0}, + 145: {region: 0x166, script: 0x5b, flags: 0x0}, + 146: {region: 0x166, script: 0x5b, flags: 0x0}, + 147: {region: 0x166, script: 0x2c, flags: 0x0}, + 148: {region: 0x9a, script: 0x22, flags: 0x0}, + 149: {region: 0x96, script: 0x5b, flags: 0x0}, + 150: {region: 0x166, script: 0x5b, flags: 0x0}, + 151: {region: 0x166, script: 0x5b, flags: 0x0}, + 152: {region: 0x115, script: 0x5b, flags: 0x0}, + 153: {region: 0x166, script: 0x5b, flags: 0x0}, + 154: {region: 0x166, script: 0x5b, flags: 0x0}, + 155: {region: 0x52, script: 0x5b, flags: 0x0}, + 156: {region: 0x166, script: 0x5b, flags: 0x0}, + 157: {region: 0xe8, script: 0x5b, flags: 0x0}, + 158: {region: 0x166, script: 0x5b, flags: 0x0}, + 159: {region: 0x13f, script: 0xe8, flags: 0x0}, + 160: {region: 0xc4, script: 0x5b, flags: 0x0}, + 161: {region: 0x166, script: 0x5b, flags: 0x0}, + 162: {region: 0x166, script: 0x5b, flags: 0x0}, + 163: {region: 0xc4, script: 0x5b, flags: 0x0}, + 164: {region: 0x166, script: 0x5b, flags: 0x0}, 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x165, script: 0x5a, flags: 0x0}, - 167: {region: 0x165, script: 0x5a, flags: 0x0}, - 168: {region: 0x165, script: 0x5a, flags: 0x0}, - 169: {region: 0x53, script: 0xec, flags: 0x0}, - 170: {region: 0x165, script: 0x5a, flags: 0x0}, - 171: {region: 0x165, script: 0x5a, flags: 0x0}, - 172: {region: 0x165, script: 0x5a, flags: 0x0}, - 173: {region: 0x99, script: 0xe, flags: 0x0}, - 174: {region: 0x165, script: 0x5a, flags: 0x0}, - 175: {region: 0x9c, script: 0x5, flags: 0x0}, - 176: {region: 0x165, script: 0x5a, flags: 0x0}, - 177: {region: 0x4f, script: 0x5a, flags: 0x0}, - 178: {region: 0x78, script: 0x5a, flags: 0x0}, - 179: {region: 0x99, script: 0x22, flags: 0x0}, - 180: {region: 0xe8, script: 0x5, flags: 0x0}, - 181: {region: 0x99, script: 0x22, flags: 0x0}, - 182: {region: 0x165, script: 0x5a, flags: 0x0}, - 183: {region: 0x33, script: 0x5a, flags: 0x0}, - 184: {region: 0x165, script: 0x5a, flags: 0x0}, - 185: {region: 0xb4, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x5a, flags: 0x0}, - 187: {region: 0x165, script: 0x2c, flags: 0x0}, - 188: {region: 0xe7, script: 0x5a, flags: 0x0}, - 189: {region: 0x165, script: 0x5a, flags: 0x0}, - 190: {region: 0xe8, script: 0x22, flags: 0x0}, - 191: {region: 0x106, script: 0x20, flags: 0x0}, - 192: {region: 0x15f, script: 0x5a, flags: 0x0}, - 193: {region: 0x165, script: 0x5a, flags: 0x0}, - 194: {region: 0x95, script: 0x5a, flags: 0x0}, - 195: {region: 0x165, script: 0x5a, flags: 0x0}, - 196: {region: 0x52, script: 0x5a, flags: 0x0}, - 197: {region: 0x165, script: 0x5a, flags: 0x0}, - 198: {region: 0x165, script: 0x5a, flags: 0x0}, - 199: {region: 0x165, script: 0x5a, flags: 0x0}, - 200: {region: 0x86, script: 0x5a, flags: 0x0}, - 201: {region: 0x165, script: 0x5a, flags: 0x0}, - 202: {region: 0x165, script: 0x5a, flags: 0x0}, - 203: {region: 0x165, script: 0x5a, flags: 0x0}, - 204: {region: 0x165, script: 0x5a, flags: 0x0}, - 205: {region: 0x6d, script: 0x2c, flags: 0x0}, - 206: {region: 0x165, script: 0x5a, flags: 0x0}, - 207: {region: 0x165, script: 0x5a, flags: 0x0}, - 208: {region: 0x52, script: 0x5a, flags: 0x0}, - 209: {region: 0x165, script: 0x5a, flags: 0x0}, - 210: {region: 0x165, script: 0x5a, flags: 0x0}, - 211: {region: 0xc3, script: 0x5a, flags: 0x0}, - 212: {region: 0x165, script: 0x5a, flags: 0x0}, - 213: {region: 0x165, script: 0x5a, flags: 0x0}, - 214: {region: 0x165, script: 0x5a, flags: 0x0}, - 215: {region: 0x6e, script: 0x5a, flags: 0x0}, - 216: {region: 0x165, script: 0x5a, flags: 0x0}, - 217: {region: 0x165, script: 0x5a, flags: 0x0}, - 218: {region: 0xd6, script: 0x5a, flags: 0x0}, + 166: {region: 0x166, script: 0x5b, flags: 0x0}, + 167: {region: 0x166, script: 0x5b, flags: 0x0}, + 168: {region: 0x166, script: 0x5b, flags: 0x0}, + 169: {region: 0x53, script: 0xef, flags: 0x0}, + 170: {region: 0x166, script: 0x5b, flags: 0x0}, + 171: {region: 0x166, script: 0x5b, flags: 0x0}, + 172: {region: 0x166, script: 0x5b, flags: 0x0}, + 173: {region: 0x9a, script: 0xe, flags: 0x0}, + 174: {region: 0x166, script: 0x5b, flags: 0x0}, + 175: {region: 0x9d, script: 0x5, flags: 0x0}, + 176: {region: 0x166, script: 0x5b, flags: 0x0}, + 177: {region: 0x4f, script: 0x5b, flags: 0x0}, + 178: {region: 0x79, script: 0x5b, flags: 0x0}, + 179: {region: 0x9a, script: 0x22, flags: 0x0}, + 180: {region: 0xe9, script: 0x5, flags: 0x0}, + 181: {region: 0x9a, script: 0x22, flags: 0x0}, + 182: {region: 0x166, script: 0x5b, flags: 0x0}, + 183: {region: 0x33, script: 0x5b, flags: 0x0}, + 184: {region: 0x166, script: 0x5b, flags: 0x0}, + 185: {region: 0xb5, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5b, flags: 0x0}, + 187: {region: 0x166, script: 0x2c, flags: 0x0}, + 188: {region: 0xe8, script: 0x5b, flags: 0x0}, + 189: {region: 0x166, script: 0x5b, flags: 0x0}, + 190: {region: 0xe9, script: 0x22, flags: 0x0}, + 191: {region: 0x107, script: 0x20, flags: 0x0}, + 192: {region: 0x160, script: 0x5b, flags: 0x0}, + 193: {region: 0x166, script: 0x5b, flags: 0x0}, + 194: {region: 0x96, script: 0x5b, flags: 0x0}, + 195: {region: 0x166, script: 0x5b, flags: 0x0}, + 196: {region: 0x52, script: 0x5b, flags: 0x0}, + 197: {region: 0x166, script: 0x5b, flags: 0x0}, + 198: {region: 0x166, script: 0x5b, flags: 0x0}, + 199: {region: 0x166, script: 0x5b, flags: 0x0}, + 200: {region: 0x87, script: 0x5b, flags: 0x0}, + 201: {region: 0x166, script: 0x5b, flags: 0x0}, + 202: {region: 0x166, script: 0x5b, flags: 0x0}, + 203: {region: 0x166, script: 0x5b, flags: 0x0}, + 204: {region: 0x166, script: 0x5b, flags: 0x0}, + 205: {region: 0x6e, script: 0x2c, flags: 0x0}, + 206: {region: 0x166, script: 0x5b, flags: 0x0}, + 207: {region: 0x166, script: 0x5b, flags: 0x0}, + 208: {region: 0x52, script: 0x5b, flags: 0x0}, + 209: {region: 0x166, script: 0x5b, flags: 0x0}, + 210: {region: 0x166, script: 0x5b, flags: 0x0}, + 211: {region: 0xc4, script: 0x5b, flags: 0x0}, + 212: {region: 0x166, script: 0x5b, flags: 0x0}, + 213: {region: 0x166, script: 0x5b, flags: 0x0}, + 214: {region: 0x166, script: 0x5b, flags: 0x0}, + 215: {region: 0x6f, script: 0x5b, flags: 0x0}, + 216: {region: 0x166, script: 0x5b, flags: 0x0}, + 217: {region: 0x166, script: 0x5b, flags: 0x0}, + 218: {region: 0xd7, script: 0x5b, flags: 0x0}, 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x106, script: 0x20, flags: 0x0}, - 221: {region: 0xe7, script: 0x5a, flags: 0x0}, - 222: {region: 0x165, script: 0x5a, flags: 0x0}, - 223: {region: 0x131, script: 0x5a, flags: 0x0}, - 224: {region: 0x8a, script: 0x5a, flags: 0x0}, - 225: {region: 0x75, script: 0x5a, flags: 0x0}, - 226: {region: 0x106, script: 0x20, flags: 0x0}, - 227: {region: 0x135, script: 0x5a, flags: 0x0}, - 228: {region: 0x49, script: 0x5a, flags: 0x0}, - 229: {region: 0x135, script: 0x1a, flags: 0x0}, - 230: {region: 0xa6, script: 0x5, flags: 0x0}, - 231: {region: 0x13e, script: 0x19, flags: 0x0}, - 232: {region: 0x165, script: 0x5a, flags: 0x0}, - 233: {region: 0x9b, script: 0x5, flags: 0x0}, - 234: {region: 0x165, script: 0x5a, flags: 0x0}, - 235: {region: 0x165, script: 0x5a, flags: 0x0}, - 236: {region: 0x165, script: 0x5a, flags: 0x0}, - 237: {region: 0x165, script: 0x5a, flags: 0x0}, - 238: {region: 0x165, script: 0x5a, flags: 0x0}, - 239: {region: 0xc5, script: 0xd8, flags: 0x0}, - 240: {region: 0x78, script: 0x5a, flags: 0x0}, - 241: {region: 0x6b, script: 0x1d, flags: 0x0}, - 242: {region: 0xe7, script: 0x5a, flags: 0x0}, + 220: {region: 0x107, script: 0x20, flags: 0x0}, + 221: {region: 0xe8, script: 0x5b, flags: 0x0}, + 222: {region: 0x166, script: 0x5b, flags: 0x0}, + 223: {region: 0x132, script: 0x5b, flags: 0x0}, + 224: {region: 0x8b, script: 0x5b, flags: 0x0}, + 225: {region: 0x76, script: 0x5b, flags: 0x0}, + 226: {region: 0x107, script: 0x20, flags: 0x0}, + 227: {region: 0x136, script: 0x5b, flags: 0x0}, + 228: {region: 0x49, script: 0x5b, flags: 0x0}, + 229: {region: 0x136, script: 0x1a, flags: 0x0}, + 230: {region: 0xa7, script: 0x5, flags: 0x0}, + 231: {region: 0x13f, script: 0x19, flags: 0x0}, + 232: {region: 0x166, script: 0x5b, flags: 0x0}, + 233: {region: 0x9c, script: 0x5, flags: 0x0}, + 234: {region: 0x166, script: 0x5b, flags: 0x0}, + 235: {region: 0x166, script: 0x5b, flags: 0x0}, + 236: {region: 0x166, script: 0x5b, flags: 0x0}, + 237: {region: 0x166, script: 0x5b, flags: 0x0}, + 238: {region: 0x166, script: 0x5b, flags: 0x0}, + 239: {region: 0xc6, script: 0xda, flags: 0x0}, + 240: {region: 0x79, script: 0x5b, flags: 0x0}, + 241: {region: 0x6c, script: 0x1d, flags: 0x0}, + 242: {region: 0xe8, script: 0x5b, flags: 0x0}, 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x130, script: 0x20, flags: 0x0}, + 244: {region: 0x131, script: 0x20, flags: 0x0}, 245: {region: 0x49, script: 0x17, flags: 0x0}, 246: {region: 0x49, script: 0x17, flags: 0x0}, 247: {region: 0x49, script: 0x17, flags: 0x0}, 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10a, script: 0x5a, flags: 0x0}, - 250: {region: 0x5e, script: 0x5a, flags: 0x0}, - 251: {region: 0xe9, script: 0x5a, flags: 0x0}, + 249: {region: 0x10b, script: 0x5b, flags: 0x0}, + 250: {region: 0x5f, script: 0x5b, flags: 0x0}, + 251: {region: 0xea, script: 0x5b, flags: 0x0}, 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc4, script: 0x86, flags: 0x0}, + 253: {region: 0xc5, script: 0x88, flags: 0x0}, 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x106, script: 0x20, flags: 0x0}, - 256: {region: 0x7b, script: 0x5a, flags: 0x0}, - 257: {region: 0x63, script: 0x5a, flags: 0x0}, - 258: {region: 0x165, script: 0x5a, flags: 0x0}, - 259: {region: 0x165, script: 0x5a, flags: 0x0}, - 260: {region: 0x165, script: 0x5a, flags: 0x0}, - 261: {region: 0x165, script: 0x5a, flags: 0x0}, - 262: {region: 0x135, script: 0x5a, flags: 0x0}, - 263: {region: 0x106, script: 0x20, flags: 0x0}, - 264: {region: 0xa4, script: 0x5a, flags: 0x0}, - 265: {region: 0x165, script: 0x5a, flags: 0x0}, - 266: {region: 0x165, script: 0x5a, flags: 0x0}, - 267: {region: 0x99, script: 0x5, flags: 0x0}, - 268: {region: 0x165, script: 0x5a, flags: 0x0}, - 269: {region: 0x60, script: 0x5a, flags: 0x0}, - 270: {region: 0x165, script: 0x5a, flags: 0x0}, - 271: {region: 0x49, script: 0x5a, flags: 0x0}, - 272: {region: 0x165, script: 0x5a, flags: 0x0}, - 273: {region: 0x165, script: 0x5a, flags: 0x0}, - 274: {region: 0x165, script: 0x5a, flags: 0x0}, - 275: {region: 0x165, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x5a, flags: 0x0}, - 277: {region: 0x165, script: 0x5a, flags: 0x0}, - 278: {region: 0x165, script: 0x5a, flags: 0x0}, - 279: {region: 0xd4, script: 0x5a, flags: 0x0}, - 280: {region: 0x4f, script: 0x5a, flags: 0x0}, - 281: {region: 0x165, script: 0x5a, flags: 0x0}, - 282: {region: 0x99, script: 0x5, flags: 0x0}, - 283: {region: 0x165, script: 0x5a, flags: 0x0}, - 284: {region: 0x165, script: 0x5a, flags: 0x0}, - 285: {region: 0x165, script: 0x5a, flags: 0x0}, - 286: {region: 0x165, script: 0x2c, flags: 0x0}, - 287: {region: 0x60, script: 0x5a, flags: 0x0}, - 288: {region: 0xc3, script: 0x5a, flags: 0x0}, - 289: {region: 0xd0, script: 0x5a, flags: 0x0}, - 290: {region: 0x165, script: 0x5a, flags: 0x0}, - 291: {region: 0xdb, script: 0x22, flags: 0x0}, - 292: {region: 0x52, script: 0x5a, flags: 0x0}, - 293: {region: 0x165, script: 0x5a, flags: 0x0}, - 294: {region: 0x165, script: 0x5a, flags: 0x0}, - 295: {region: 0x165, script: 0x5a, flags: 0x0}, - 296: {region: 0xcd, script: 0xea, flags: 0x0}, - 297: {region: 0x165, script: 0x5a, flags: 0x0}, - 298: {region: 0x165, script: 0x5a, flags: 0x0}, - 299: {region: 0x114, script: 0x5a, flags: 0x0}, - 300: {region: 0x37, script: 0x5a, flags: 0x0}, - 301: {region: 0x43, script: 0xec, flags: 0x0}, - 302: {region: 0x165, script: 0x5a, flags: 0x0}, - 303: {region: 0xa4, script: 0x5a, flags: 0x0}, - 304: {region: 0x80, script: 0x5a, flags: 0x0}, - 305: {region: 0xd6, script: 0x5a, flags: 0x0}, - 306: {region: 0x9e, script: 0x5a, flags: 0x0}, - 307: {region: 0x6b, script: 0x29, flags: 0x0}, - 308: {region: 0x165, script: 0x5a, flags: 0x0}, - 309: {region: 0xc4, script: 0x4b, flags: 0x0}, - 310: {region: 0x87, script: 0x34, flags: 0x0}, - 311: {region: 0x165, script: 0x5a, flags: 0x0}, - 312: {region: 0x165, script: 0x5a, flags: 0x0}, + 255: {region: 0x107, script: 0x20, flags: 0x0}, + 256: {region: 0x7c, script: 0x5b, flags: 0x0}, + 257: {region: 0x64, script: 0x5b, flags: 0x0}, + 258: {region: 0x166, script: 0x5b, flags: 0x0}, + 259: {region: 0x166, script: 0x5b, flags: 0x0}, + 260: {region: 0x166, script: 0x5b, flags: 0x0}, + 261: {region: 0x166, script: 0x5b, flags: 0x0}, + 262: {region: 0x136, script: 0x5b, flags: 0x0}, + 263: {region: 0x107, script: 0x20, flags: 0x0}, + 264: {region: 0xa5, script: 0x5b, flags: 0x0}, + 265: {region: 0x166, script: 0x5b, flags: 0x0}, + 266: {region: 0x166, script: 0x5b, flags: 0x0}, + 267: {region: 0x9a, script: 0x5, flags: 0x0}, + 268: {region: 0x166, script: 0x5b, flags: 0x0}, + 269: {region: 0x61, script: 0x5b, flags: 0x0}, + 270: {region: 0x166, script: 0x5b, flags: 0x0}, + 271: {region: 0x49, script: 0x5b, flags: 0x0}, + 272: {region: 0x166, script: 0x5b, flags: 0x0}, + 273: {region: 0x166, script: 0x5b, flags: 0x0}, + 274: {region: 0x166, script: 0x5b, flags: 0x0}, + 275: {region: 0x166, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5b, flags: 0x0}, + 277: {region: 0x166, script: 0x5b, flags: 0x0}, + 278: {region: 0x166, script: 0x5b, flags: 0x0}, + 279: {region: 0xd5, script: 0x5b, flags: 0x0}, + 280: {region: 0x4f, script: 0x5b, flags: 0x0}, + 281: {region: 0x166, script: 0x5b, flags: 0x0}, + 282: {region: 0x9a, script: 0x5, flags: 0x0}, + 283: {region: 0x166, script: 0x5b, flags: 0x0}, + 284: {region: 0x166, script: 0x5b, flags: 0x0}, + 285: {region: 0x166, script: 0x5b, flags: 0x0}, + 286: {region: 0x166, script: 0x2c, flags: 0x0}, + 287: {region: 0x61, script: 0x5b, flags: 0x0}, + 288: {region: 0xc4, script: 0x5b, flags: 0x0}, + 289: {region: 0xd1, script: 0x5b, flags: 0x0}, + 290: {region: 0x166, script: 0x5b, flags: 0x0}, + 291: {region: 0xdc, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5b, flags: 0x0}, + 293: {region: 0x166, script: 0x5b, flags: 0x0}, + 294: {region: 0x166, script: 0x5b, flags: 0x0}, + 295: {region: 0x166, script: 0x5b, flags: 0x0}, + 296: {region: 0xce, script: 0xed, flags: 0x0}, + 297: {region: 0x166, script: 0x5b, flags: 0x0}, + 298: {region: 0x166, script: 0x5b, flags: 0x0}, + 299: {region: 0x115, script: 0x5b, flags: 0x0}, + 300: {region: 0x37, script: 0x5b, flags: 0x0}, + 301: {region: 0x43, script: 0xef, flags: 0x0}, + 302: {region: 0x166, script: 0x5b, flags: 0x0}, + 303: {region: 0xa5, script: 0x5b, flags: 0x0}, + 304: {region: 0x81, script: 0x5b, flags: 0x0}, + 305: {region: 0xd7, script: 0x5b, flags: 0x0}, + 306: {region: 0x9f, script: 0x5b, flags: 0x0}, + 307: {region: 0x6c, script: 0x29, flags: 0x0}, + 308: {region: 0x166, script: 0x5b, flags: 0x0}, + 309: {region: 0xc5, script: 0x4b, flags: 0x0}, + 310: {region: 0x88, script: 0x34, flags: 0x0}, + 311: {region: 0x166, script: 0x5b, flags: 0x0}, + 312: {region: 0x166, script: 0x5b, flags: 0x0}, 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x165, script: 0x5a, flags: 0x0}, - 315: {region: 0x165, script: 0x5a, flags: 0x0}, - 316: {region: 0x1, script: 0x5a, flags: 0x0}, - 317: {region: 0x165, script: 0x5a, flags: 0x0}, - 318: {region: 0x6e, script: 0x5a, flags: 0x0}, - 319: {region: 0x135, script: 0x5a, flags: 0x0}, - 320: {region: 0x6a, script: 0x5a, flags: 0x0}, - 321: {region: 0x165, script: 0x5a, flags: 0x0}, - 322: {region: 0x9e, script: 0x46, flags: 0x0}, - 323: {region: 0x165, script: 0x5a, flags: 0x0}, - 324: {region: 0x165, script: 0x5a, flags: 0x0}, - 325: {region: 0x6e, script: 0x5a, flags: 0x0}, - 326: {region: 0x52, script: 0x5a, flags: 0x0}, - 327: {region: 0x6e, script: 0x5a, flags: 0x0}, - 328: {region: 0x9c, script: 0x5, flags: 0x0}, - 329: {region: 0x165, script: 0x5a, flags: 0x0}, - 330: {region: 0x165, script: 0x5a, flags: 0x0}, - 331: {region: 0x165, script: 0x5a, flags: 0x0}, - 332: {region: 0x165, script: 0x5a, flags: 0x0}, - 333: {region: 0x86, script: 0x5a, flags: 0x0}, + 314: {region: 0x166, script: 0x5b, flags: 0x0}, + 315: {region: 0x166, script: 0x5b, flags: 0x0}, + 316: {region: 0x1, script: 0x5b, flags: 0x0}, + 317: {region: 0x166, script: 0x5b, flags: 0x0}, + 318: {region: 0x6f, script: 0x5b, flags: 0x0}, + 319: {region: 0x136, script: 0x5b, flags: 0x0}, + 320: {region: 0x6b, script: 0x5b, flags: 0x0}, + 321: {region: 0x166, script: 0x5b, flags: 0x0}, + 322: {region: 0x9f, script: 0x46, flags: 0x0}, + 323: {region: 0x166, script: 0x5b, flags: 0x0}, + 324: {region: 0x166, script: 0x5b, flags: 0x0}, + 325: {region: 0x6f, script: 0x5b, flags: 0x0}, + 326: {region: 0x52, script: 0x5b, flags: 0x0}, + 327: {region: 0x6f, script: 0x5b, flags: 0x0}, + 328: {region: 0x9d, script: 0x5, flags: 0x0}, + 329: {region: 0x166, script: 0x5b, flags: 0x0}, + 330: {region: 0x166, script: 0x5b, flags: 0x0}, + 331: {region: 0x166, script: 0x5b, flags: 0x0}, + 332: {region: 0x166, script: 0x5b, flags: 0x0}, + 333: {region: 0x87, script: 0x5b, flags: 0x0}, 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x165, script: 0x5a, flags: 0x0}, - 336: {region: 0xc3, script: 0x5a, flags: 0x0}, - 337: {region: 0x72, script: 0x5a, flags: 0x0}, - 338: {region: 0x10b, script: 0x5, flags: 0x0}, - 339: {region: 0xe7, script: 0x5a, flags: 0x0}, - 340: {region: 0x10c, script: 0x5a, flags: 0x0}, - 341: {region: 0x73, script: 0x5a, flags: 0x0}, - 342: {region: 0x165, script: 0x5a, flags: 0x0}, - 343: {region: 0x165, script: 0x5a, flags: 0x0}, - 344: {region: 0x76, script: 0x5a, flags: 0x0}, - 345: {region: 0x165, script: 0x5a, flags: 0x0}, - 346: {region: 0x3b, script: 0x5a, flags: 0x0}, - 347: {region: 0x165, script: 0x5a, flags: 0x0}, - 348: {region: 0x165, script: 0x5a, flags: 0x0}, - 349: {region: 0x165, script: 0x5a, flags: 0x0}, - 350: {region: 0x78, script: 0x5a, flags: 0x0}, - 351: {region: 0x135, script: 0x5a, flags: 0x0}, - 352: {region: 0x78, script: 0x5a, flags: 0x0}, - 353: {region: 0x60, script: 0x5a, flags: 0x0}, - 354: {region: 0x60, script: 0x5a, flags: 0x0}, + 335: {region: 0x166, script: 0x5b, flags: 0x0}, + 336: {region: 0xc4, script: 0x5b, flags: 0x0}, + 337: {region: 0x73, script: 0x5b, flags: 0x0}, + 338: {region: 0x10c, script: 0x5, flags: 0x0}, + 339: {region: 0xe8, script: 0x5b, flags: 0x0}, + 340: {region: 0x10d, script: 0x5b, flags: 0x0}, + 341: {region: 0x74, script: 0x5b, flags: 0x0}, + 342: {region: 0x166, script: 0x5b, flags: 0x0}, + 343: {region: 0x166, script: 0x5b, flags: 0x0}, + 344: {region: 0x77, script: 0x5b, flags: 0x0}, + 345: {region: 0x166, script: 0x5b, flags: 0x0}, + 346: {region: 0x3b, script: 0x5b, flags: 0x0}, + 347: {region: 0x166, script: 0x5b, flags: 0x0}, + 348: {region: 0x166, script: 0x5b, flags: 0x0}, + 349: {region: 0x166, script: 0x5b, flags: 0x0}, + 350: {region: 0x79, script: 0x5b, flags: 0x0}, + 351: {region: 0x136, script: 0x5b, flags: 0x0}, + 352: {region: 0x79, script: 0x5b, flags: 0x0}, + 353: {region: 0x61, script: 0x5b, flags: 0x0}, + 354: {region: 0x61, script: 0x5b, flags: 0x0}, 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x140, script: 0x5a, flags: 0x0}, - 357: {region: 0x165, script: 0x5a, flags: 0x0}, - 358: {region: 0x84, script: 0x5a, flags: 0x0}, - 359: {region: 0x165, script: 0x5a, flags: 0x0}, - 360: {region: 0xd4, script: 0x5a, flags: 0x0}, - 361: {region: 0x9e, script: 0x5a, flags: 0x0}, - 362: {region: 0xd6, script: 0x5a, flags: 0x0}, - 363: {region: 0x165, script: 0x5a, flags: 0x0}, - 364: {region: 0x10b, script: 0x5a, flags: 0x0}, - 365: {region: 0xd9, script: 0x5a, flags: 0x0}, - 366: {region: 0x96, script: 0x5a, flags: 0x0}, - 367: {region: 0x80, script: 0x5a, flags: 0x0}, - 368: {region: 0x165, script: 0x5a, flags: 0x0}, - 369: {region: 0xbc, script: 0x5a, flags: 0x0}, - 370: {region: 0x165, script: 0x5a, flags: 0x0}, - 371: {region: 0x165, script: 0x5a, flags: 0x0}, - 372: {region: 0x165, script: 0x5a, flags: 0x0}, + 356: {region: 0x141, script: 0x5b, flags: 0x0}, + 357: {region: 0x166, script: 0x5b, flags: 0x0}, + 358: {region: 0x85, script: 0x5b, flags: 0x0}, + 359: {region: 0x166, script: 0x5b, flags: 0x0}, + 360: {region: 0xd5, script: 0x5b, flags: 0x0}, + 361: {region: 0x9f, script: 0x5b, flags: 0x0}, + 362: {region: 0xd7, script: 0x5b, flags: 0x0}, + 363: {region: 0x166, script: 0x5b, flags: 0x0}, + 364: {region: 0x10c, script: 0x5b, flags: 0x0}, + 365: {region: 0xda, script: 0x5b, flags: 0x0}, + 366: {region: 0x97, script: 0x5b, flags: 0x0}, + 367: {region: 0x81, script: 0x5b, flags: 0x0}, + 368: {region: 0x166, script: 0x5b, flags: 0x0}, + 369: {region: 0xbd, script: 0x5b, flags: 0x0}, + 370: {region: 0x166, script: 0x5b, flags: 0x0}, + 371: {region: 0x166, script: 0x5b, flags: 0x0}, + 372: {region: 0x166, script: 0x5b, flags: 0x0}, 373: {region: 0x53, script: 0x3b, flags: 0x0}, - 374: {region: 0x165, script: 0x5a, flags: 0x0}, - 375: {region: 0x95, script: 0x5a, flags: 0x0}, - 376: {region: 0x165, script: 0x5a, flags: 0x0}, - 377: {region: 0x165, script: 0x5a, flags: 0x0}, - 378: {region: 0x99, script: 0x22, flags: 0x0}, - 379: {region: 0x165, script: 0x5a, flags: 0x0}, - 380: {region: 0x9c, script: 0x5, flags: 0x0}, - 381: {region: 0x7e, script: 0x5a, flags: 0x0}, - 382: {region: 0x7b, script: 0x5a, flags: 0x0}, - 383: {region: 0x165, script: 0x5a, flags: 0x0}, - 384: {region: 0x165, script: 0x5a, flags: 0x0}, - 385: {region: 0x165, script: 0x5a, flags: 0x0}, - 386: {region: 0x165, script: 0x5a, flags: 0x0}, - 387: {region: 0x165, script: 0x5a, flags: 0x0}, - 388: {region: 0x165, script: 0x5a, flags: 0x0}, - 389: {region: 0x6f, script: 0x2c, flags: 0x0}, - 390: {region: 0x165, script: 0x5a, flags: 0x0}, - 391: {region: 0xdb, script: 0x22, flags: 0x0}, - 392: {region: 0x165, script: 0x5a, flags: 0x0}, - 393: {region: 0xa7, script: 0x5a, flags: 0x0}, - 394: {region: 0x165, script: 0x5a, flags: 0x0}, - 395: {region: 0xe8, script: 0x5, flags: 0x0}, - 396: {region: 0x165, script: 0x5a, flags: 0x0}, - 397: {region: 0xe8, script: 0x5, flags: 0x0}, - 398: {region: 0x165, script: 0x5a, flags: 0x0}, - 399: {region: 0x165, script: 0x5a, flags: 0x0}, - 400: {region: 0x6e, script: 0x5a, flags: 0x0}, - 401: {region: 0x9c, script: 0x5, flags: 0x0}, - 402: {region: 0x165, script: 0x5a, flags: 0x0}, - 403: {region: 0x165, script: 0x2c, flags: 0x0}, - 404: {region: 0xf1, script: 0x5a, flags: 0x0}, - 405: {region: 0x165, script: 0x5a, flags: 0x0}, - 406: {region: 0x165, script: 0x5a, flags: 0x0}, - 407: {region: 0x165, script: 0x5a, flags: 0x0}, - 408: {region: 0x165, script: 0x2c, flags: 0x0}, - 409: {region: 0x165, script: 0x5a, flags: 0x0}, - 410: {region: 0x99, script: 0x22, flags: 0x0}, - 411: {region: 0x99, script: 0xe6, flags: 0x0}, - 412: {region: 0x95, script: 0x5a, flags: 0x0}, - 413: {region: 0xd9, script: 0x5a, flags: 0x0}, - 414: {region: 0x130, script: 0x32, flags: 0x0}, - 415: {region: 0x165, script: 0x5a, flags: 0x0}, + 374: {region: 0x166, script: 0x5b, flags: 0x0}, + 375: {region: 0x96, script: 0x5b, flags: 0x0}, + 376: {region: 0x166, script: 0x5b, flags: 0x0}, + 377: {region: 0x166, script: 0x5b, flags: 0x0}, + 378: {region: 0x9a, script: 0x22, flags: 0x0}, + 379: {region: 0x166, script: 0x5b, flags: 0x0}, + 380: {region: 0x9d, script: 0x5, flags: 0x0}, + 381: {region: 0x7f, script: 0x5b, flags: 0x0}, + 382: {region: 0x7c, script: 0x5b, flags: 0x0}, + 383: {region: 0x166, script: 0x5b, flags: 0x0}, + 384: {region: 0x166, script: 0x5b, flags: 0x0}, + 385: {region: 0x166, script: 0x5b, flags: 0x0}, + 386: {region: 0x166, script: 0x5b, flags: 0x0}, + 387: {region: 0x166, script: 0x5b, flags: 0x0}, + 388: {region: 0x166, script: 0x5b, flags: 0x0}, + 389: {region: 0x70, script: 0x2c, flags: 0x0}, + 390: {region: 0x166, script: 0x5b, flags: 0x0}, + 391: {region: 0xdc, script: 0x22, flags: 0x0}, + 392: {region: 0x166, script: 0x5b, flags: 0x0}, + 393: {region: 0xa8, script: 0x5b, flags: 0x0}, + 394: {region: 0x166, script: 0x5b, flags: 0x0}, + 395: {region: 0xe9, script: 0x5, flags: 0x0}, + 396: {region: 0x166, script: 0x5b, flags: 0x0}, + 397: {region: 0xe9, script: 0x5, flags: 0x0}, + 398: {region: 0x166, script: 0x5b, flags: 0x0}, + 399: {region: 0x166, script: 0x5b, flags: 0x0}, + 400: {region: 0x6f, script: 0x5b, flags: 0x0}, + 401: {region: 0x9d, script: 0x5, flags: 0x0}, + 402: {region: 0x166, script: 0x5b, flags: 0x0}, + 403: {region: 0x166, script: 0x2c, flags: 0x0}, + 404: {region: 0xf2, script: 0x5b, flags: 0x0}, + 405: {region: 0x166, script: 0x5b, flags: 0x0}, + 406: {region: 0x166, script: 0x5b, flags: 0x0}, + 407: {region: 0x166, script: 0x5b, flags: 0x0}, + 408: {region: 0x166, script: 0x2c, flags: 0x0}, + 409: {region: 0x166, script: 0x5b, flags: 0x0}, + 410: {region: 0x9a, script: 0x22, flags: 0x0}, + 411: {region: 0x9a, script: 0xe9, flags: 0x0}, + 412: {region: 0x96, script: 0x5b, flags: 0x0}, + 413: {region: 0xda, script: 0x5b, flags: 0x0}, + 414: {region: 0x131, script: 0x32, flags: 0x0}, + 415: {region: 0x166, script: 0x5b, flags: 0x0}, 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x99, script: 0xe, flags: 0x0}, - 418: {region: 0x165, script: 0x5a, flags: 0x0}, - 419: {region: 0x4e, script: 0x5a, flags: 0x0}, - 420: {region: 0x99, script: 0x35, flags: 0x0}, - 421: {region: 0x41, script: 0x5a, flags: 0x0}, - 422: {region: 0x54, script: 0x5a, flags: 0x0}, - 423: {region: 0x165, script: 0x5a, flags: 0x0}, - 424: {region: 0x80, script: 0x5a, flags: 0x0}, - 425: {region: 0x165, script: 0x5a, flags: 0x0}, - 426: {region: 0x165, script: 0x5a, flags: 0x0}, - 427: {region: 0xa4, script: 0x5a, flags: 0x0}, - 428: {region: 0x98, script: 0x5a, flags: 0x0}, - 429: {region: 0x165, script: 0x5a, flags: 0x0}, - 430: {region: 0xdb, script: 0x22, flags: 0x0}, - 431: {region: 0x165, script: 0x5a, flags: 0x0}, - 432: {region: 0x165, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x5a, flags: 0x0}, - 434: {region: 0x165, script: 0x5, flags: 0x0}, - 435: {region: 0x165, script: 0x5a, flags: 0x0}, + 417: {region: 0x9a, script: 0xe, flags: 0x0}, + 418: {region: 0x166, script: 0x5b, flags: 0x0}, + 419: {region: 0x4e, script: 0x5b, flags: 0x0}, + 420: {region: 0x9a, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5b, flags: 0x0}, + 422: {region: 0x54, script: 0x5b, flags: 0x0}, + 423: {region: 0x166, script: 0x5b, flags: 0x0}, + 424: {region: 0x81, script: 0x5b, flags: 0x0}, + 425: {region: 0x166, script: 0x5b, flags: 0x0}, + 426: {region: 0x166, script: 0x5b, flags: 0x0}, + 427: {region: 0xa5, script: 0x5b, flags: 0x0}, + 428: {region: 0x99, script: 0x5b, flags: 0x0}, + 429: {region: 0x166, script: 0x5b, flags: 0x0}, + 430: {region: 0xdc, script: 0x22, flags: 0x0}, + 431: {region: 0x166, script: 0x5b, flags: 0x0}, + 432: {region: 0x166, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5b, flags: 0x0}, + 434: {region: 0x166, script: 0x5, flags: 0x0}, + 435: {region: 0x166, script: 0x5b, flags: 0x0}, 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x165, script: 0x5a, flags: 0x0}, + 437: {region: 0x166, script: 0x5b, flags: 0x0}, 438: {region: 0x53, script: 0x3b, flags: 0x0}, - 439: {region: 0x165, script: 0x5a, flags: 0x0}, - 440: {region: 0x135, script: 0x5a, flags: 0x0}, + 439: {region: 0x166, script: 0x5b, flags: 0x0}, + 440: {region: 0x136, script: 0x5b, flags: 0x0}, 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x165, script: 0x5a, flags: 0x0}, - 443: {region: 0x165, script: 0x2c, flags: 0x0}, - 444: {region: 0x97, script: 0x3e, flags: 0x0}, - 445: {region: 0x165, script: 0x5a, flags: 0x0}, - 446: {region: 0x99, script: 0x22, flags: 0x0}, - 447: {region: 0x165, script: 0x5a, flags: 0x0}, - 448: {region: 0x73, script: 0x5a, flags: 0x0}, - 449: {region: 0x165, script: 0x5a, flags: 0x0}, - 450: {region: 0x165, script: 0x5a, flags: 0x0}, - 451: {region: 0xe7, script: 0x5a, flags: 0x0}, - 452: {region: 0x165, script: 0x5a, flags: 0x0}, - 453: {region: 0x12b, script: 0x40, flags: 0x0}, - 454: {region: 0x53, script: 0x90, flags: 0x0}, - 455: {region: 0x165, script: 0x5a, flags: 0x0}, - 456: {region: 0xe8, script: 0x5, flags: 0x0}, - 457: {region: 0x99, script: 0x22, flags: 0x0}, - 458: {region: 0xaf, script: 0x41, flags: 0x0}, - 459: {region: 0xe7, script: 0x5a, flags: 0x0}, - 460: {region: 0xe8, script: 0x5, flags: 0x0}, - 461: {region: 0xe6, script: 0x5a, flags: 0x0}, - 462: {region: 0x99, script: 0x22, flags: 0x0}, - 463: {region: 0x99, script: 0x22, flags: 0x0}, - 464: {region: 0x165, script: 0x5a, flags: 0x0}, - 465: {region: 0x90, script: 0x5a, flags: 0x0}, - 466: {region: 0x60, script: 0x5a, flags: 0x0}, + 442: {region: 0x166, script: 0x5b, flags: 0x0}, + 443: {region: 0x166, script: 0x2c, flags: 0x0}, + 444: {region: 0x98, script: 0x3e, flags: 0x0}, + 445: {region: 0x166, script: 0x5b, flags: 0x0}, + 446: {region: 0x9a, script: 0x22, flags: 0x0}, + 447: {region: 0x166, script: 0x5b, flags: 0x0}, + 448: {region: 0x74, script: 0x5b, flags: 0x0}, + 449: {region: 0x166, script: 0x5b, flags: 0x0}, + 450: {region: 0x166, script: 0x5b, flags: 0x0}, + 451: {region: 0xe8, script: 0x5b, flags: 0x0}, + 452: {region: 0x166, script: 0x5b, flags: 0x0}, + 453: {region: 0x12c, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x92, flags: 0x0}, + 455: {region: 0x166, script: 0x5b, flags: 0x0}, + 456: {region: 0xe9, script: 0x5, flags: 0x0}, + 457: {region: 0x9a, script: 0x22, flags: 0x0}, + 458: {region: 0xb0, script: 0x41, flags: 0x0}, + 459: {region: 0xe8, script: 0x5b, flags: 0x0}, + 460: {region: 0xe9, script: 0x5, flags: 0x0}, + 461: {region: 0xe7, script: 0x5b, flags: 0x0}, + 462: {region: 0x9a, script: 0x22, flags: 0x0}, + 463: {region: 0x9a, script: 0x22, flags: 0x0}, + 464: {region: 0x166, script: 0x5b, flags: 0x0}, + 465: {region: 0x91, script: 0x5b, flags: 0x0}, + 466: {region: 0x61, script: 0x5b, flags: 0x0}, 467: {region: 0x53, script: 0x3b, flags: 0x0}, - 468: {region: 0x91, script: 0x5a, flags: 0x0}, - 469: {region: 0x92, script: 0x5a, flags: 0x0}, - 470: {region: 0x165, script: 0x5a, flags: 0x0}, + 468: {region: 0x92, script: 0x5b, flags: 0x0}, + 469: {region: 0x93, script: 0x5b, flags: 0x0}, + 470: {region: 0x166, script: 0x5b, flags: 0x0}, 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd2, script: 0x5a, flags: 0x0}, - 473: {region: 0x78, script: 0x5a, flags: 0x0}, - 474: {region: 0x165, script: 0x5a, flags: 0x0}, - 475: {region: 0x165, script: 0x5a, flags: 0x0}, - 476: {region: 0xd0, script: 0x5a, flags: 0x0}, - 477: {region: 0xd6, script: 0x5a, flags: 0x0}, - 478: {region: 0x165, script: 0x5a, flags: 0x0}, - 479: {region: 0x165, script: 0x5a, flags: 0x0}, - 480: {region: 0x165, script: 0x5a, flags: 0x0}, - 481: {region: 0x95, script: 0x5a, flags: 0x0}, - 482: {region: 0x165, script: 0x5a, flags: 0x0}, - 483: {region: 0x165, script: 0x5a, flags: 0x0}, - 484: {region: 0x165, script: 0x5a, flags: 0x0}, - 486: {region: 0x122, script: 0x5a, flags: 0x0}, - 487: {region: 0xd6, script: 0x5a, flags: 0x0}, - 488: {region: 0x165, script: 0x5a, flags: 0x0}, - 489: {region: 0x165, script: 0x5a, flags: 0x0}, - 490: {region: 0x53, script: 0xfa, flags: 0x0}, - 491: {region: 0x165, script: 0x5a, flags: 0x0}, - 492: {region: 0x135, script: 0x5a, flags: 0x0}, - 493: {region: 0x165, script: 0x5a, flags: 0x0}, - 494: {region: 0x49, script: 0x5a, flags: 0x0}, - 495: {region: 0x165, script: 0x5a, flags: 0x0}, - 496: {region: 0x165, script: 0x5a, flags: 0x0}, - 497: {region: 0xe7, script: 0x5a, flags: 0x0}, - 498: {region: 0x165, script: 0x5a, flags: 0x0}, - 499: {region: 0x95, script: 0x5a, flags: 0x0}, - 500: {region: 0x106, script: 0x20, flags: 0x0}, - 501: {region: 0x1, script: 0x5a, flags: 0x0}, - 502: {region: 0x165, script: 0x5a, flags: 0x0}, - 503: {region: 0x165, script: 0x5a, flags: 0x0}, - 504: {region: 0x9d, script: 0x5a, flags: 0x0}, - 505: {region: 0x9e, script: 0x5a, flags: 0x0}, + 472: {region: 0xd3, script: 0x5b, flags: 0x0}, + 473: {region: 0x79, script: 0x5b, flags: 0x0}, + 474: {region: 0x166, script: 0x5b, flags: 0x0}, + 475: {region: 0x166, script: 0x5b, flags: 0x0}, + 476: {region: 0xd1, script: 0x5b, flags: 0x0}, + 477: {region: 0xd7, script: 0x5b, flags: 0x0}, + 478: {region: 0x166, script: 0x5b, flags: 0x0}, + 479: {region: 0x166, script: 0x5b, flags: 0x0}, + 480: {region: 0x166, script: 0x5b, flags: 0x0}, + 481: {region: 0x96, script: 0x5b, flags: 0x0}, + 482: {region: 0x166, script: 0x5b, flags: 0x0}, + 483: {region: 0x166, script: 0x5b, flags: 0x0}, + 484: {region: 0x166, script: 0x5b, flags: 0x0}, + 486: {region: 0x123, script: 0x5b, flags: 0x0}, + 487: {region: 0xd7, script: 0x5b, flags: 0x0}, + 488: {region: 0x166, script: 0x5b, flags: 0x0}, + 489: {region: 0x166, script: 0x5b, flags: 0x0}, + 490: {region: 0x53, script: 0xfd, flags: 0x0}, + 491: {region: 0x166, script: 0x5b, flags: 0x0}, + 492: {region: 0x136, script: 0x5b, flags: 0x0}, + 493: {region: 0x166, script: 0x5b, flags: 0x0}, + 494: {region: 0x49, script: 0x5b, flags: 0x0}, + 495: {region: 0x166, script: 0x5b, flags: 0x0}, + 496: {region: 0x166, script: 0x5b, flags: 0x0}, + 497: {region: 0xe8, script: 0x5b, flags: 0x0}, + 498: {region: 0x166, script: 0x5b, flags: 0x0}, + 499: {region: 0x96, script: 0x5b, flags: 0x0}, + 500: {region: 0x107, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5b, flags: 0x0}, + 502: {region: 0x166, script: 0x5b, flags: 0x0}, + 503: {region: 0x166, script: 0x5b, flags: 0x0}, + 504: {region: 0x9e, script: 0x5b, flags: 0x0}, + 505: {region: 0x9f, script: 0x5b, flags: 0x0}, 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x97, script: 0x3e, flags: 0x0}, - 508: {region: 0x165, script: 0x5a, flags: 0x0}, - 509: {region: 0x165, script: 0x5a, flags: 0x0}, - 510: {region: 0x106, script: 0x5a, flags: 0x0}, - 511: {region: 0x165, script: 0x5a, flags: 0x0}, - 512: {region: 0xa2, script: 0x49, flags: 0x0}, - 513: {region: 0x165, script: 0x5a, flags: 0x0}, - 514: {region: 0xa0, script: 0x5a, flags: 0x0}, - 515: {region: 0x1, script: 0x5a, flags: 0x0}, - 516: {region: 0x165, script: 0x5a, flags: 0x0}, - 517: {region: 0x165, script: 0x5a, flags: 0x0}, - 518: {region: 0x165, script: 0x5a, flags: 0x0}, - 519: {region: 0x52, script: 0x5a, flags: 0x0}, - 520: {region: 0x130, script: 0x3e, flags: 0x0}, - 521: {region: 0x165, script: 0x5a, flags: 0x0}, - 522: {region: 0x12f, script: 0x5a, flags: 0x0}, - 523: {region: 0xdb, script: 0x22, flags: 0x0}, - 524: {region: 0x165, script: 0x5a, flags: 0x0}, - 525: {region: 0x63, script: 0x5a, flags: 0x0}, - 526: {region: 0x95, script: 0x5a, flags: 0x0}, - 527: {region: 0x95, script: 0x5a, flags: 0x0}, - 528: {region: 0x7d, script: 0x2e, flags: 0x0}, - 529: {region: 0x137, script: 0x20, flags: 0x0}, - 530: {region: 0x67, script: 0x5a, flags: 0x0}, - 531: {region: 0xc4, script: 0x5a, flags: 0x0}, - 532: {region: 0x165, script: 0x5a, flags: 0x0}, - 533: {region: 0x165, script: 0x5a, flags: 0x0}, - 534: {region: 0xd6, script: 0x5a, flags: 0x0}, - 535: {region: 0xa4, script: 0x5a, flags: 0x0}, - 536: {region: 0xc3, script: 0x5a, flags: 0x0}, - 537: {region: 0x106, script: 0x20, flags: 0x0}, - 538: {region: 0x165, script: 0x5a, flags: 0x0}, - 539: {region: 0x165, script: 0x5a, flags: 0x0}, - 540: {region: 0x165, script: 0x5a, flags: 0x0}, - 541: {region: 0x165, script: 0x5a, flags: 0x0}, - 542: {region: 0xd4, script: 0x5, flags: 0x0}, - 543: {region: 0xd6, script: 0x5a, flags: 0x0}, - 544: {region: 0x164, script: 0x5a, flags: 0x0}, - 545: {region: 0x165, script: 0x5a, flags: 0x0}, - 546: {region: 0x165, script: 0x5a, flags: 0x0}, - 547: {region: 0x12f, script: 0x5a, flags: 0x0}, - 548: {region: 0x122, script: 0x5, flags: 0x0}, - 549: {region: 0x165, script: 0x5a, flags: 0x0}, - 550: {region: 0x123, script: 0xeb, flags: 0x0}, - 551: {region: 0x5a, script: 0x5a, flags: 0x0}, - 552: {region: 0x52, script: 0x5a, flags: 0x0}, - 553: {region: 0x165, script: 0x5a, flags: 0x0}, - 554: {region: 0x4f, script: 0x5a, flags: 0x0}, - 555: {region: 0x99, script: 0x22, flags: 0x0}, - 556: {region: 0x99, script: 0x22, flags: 0x0}, - 557: {region: 0x4b, script: 0x5a, flags: 0x0}, - 558: {region: 0x95, script: 0x5a, flags: 0x0}, - 559: {region: 0x165, script: 0x5a, flags: 0x0}, - 560: {region: 0x41, script: 0x5a, flags: 0x0}, - 561: {region: 0x99, script: 0x5a, flags: 0x0}, - 562: {region: 0x53, script: 0xe2, flags: 0x0}, - 563: {region: 0x99, script: 0x22, flags: 0x0}, - 564: {region: 0xc3, script: 0x5a, flags: 0x0}, - 565: {region: 0x165, script: 0x5a, flags: 0x0}, - 566: {region: 0x99, script: 0x75, flags: 0x0}, - 567: {region: 0xe8, script: 0x5, flags: 0x0}, - 568: {region: 0x165, script: 0x5a, flags: 0x0}, - 569: {region: 0xa4, script: 0x5a, flags: 0x0}, - 570: {region: 0x165, script: 0x5a, flags: 0x0}, - 571: {region: 0x12b, script: 0x5a, flags: 0x0}, - 572: {region: 0x165, script: 0x5a, flags: 0x0}, - 573: {region: 0xd2, script: 0x5a, flags: 0x0}, - 574: {region: 0x165, script: 0x5a, flags: 0x0}, - 575: {region: 0xaf, script: 0x57, flags: 0x0}, - 576: {region: 0x165, script: 0x5a, flags: 0x0}, - 577: {region: 0x165, script: 0x5a, flags: 0x0}, + 507: {region: 0x98, script: 0x3e, flags: 0x0}, + 508: {region: 0x166, script: 0x5b, flags: 0x0}, + 509: {region: 0x166, script: 0x5b, flags: 0x0}, + 510: {region: 0x107, script: 0x5b, flags: 0x0}, + 511: {region: 0x166, script: 0x5b, flags: 0x0}, + 512: {region: 0xa3, script: 0x49, flags: 0x0}, + 513: {region: 0x166, script: 0x5b, flags: 0x0}, + 514: {region: 0xa1, script: 0x5b, flags: 0x0}, + 515: {region: 0x1, script: 0x5b, flags: 0x0}, + 516: {region: 0x166, script: 0x5b, flags: 0x0}, + 517: {region: 0x166, script: 0x5b, flags: 0x0}, + 518: {region: 0x166, script: 0x5b, flags: 0x0}, + 519: {region: 0x52, script: 0x5b, flags: 0x0}, + 520: {region: 0x131, script: 0x3e, flags: 0x0}, + 521: {region: 0x166, script: 0x5b, flags: 0x0}, + 522: {region: 0x130, script: 0x5b, flags: 0x0}, + 523: {region: 0xdc, script: 0x22, flags: 0x0}, + 524: {region: 0x166, script: 0x5b, flags: 0x0}, + 525: {region: 0x64, script: 0x5b, flags: 0x0}, + 526: {region: 0x96, script: 0x5b, flags: 0x0}, + 527: {region: 0x96, script: 0x5b, flags: 0x0}, + 528: {region: 0x7e, script: 0x2e, flags: 0x0}, + 529: {region: 0x138, script: 0x20, flags: 0x0}, + 530: {region: 0x68, script: 0x5b, flags: 0x0}, + 531: {region: 0xc5, script: 0x5b, flags: 0x0}, + 532: {region: 0x166, script: 0x5b, flags: 0x0}, + 533: {region: 0x166, script: 0x5b, flags: 0x0}, + 534: {region: 0xd7, script: 0x5b, flags: 0x0}, + 535: {region: 0xa5, script: 0x5b, flags: 0x0}, + 536: {region: 0xc4, script: 0x5b, flags: 0x0}, + 537: {region: 0x107, script: 0x20, flags: 0x0}, + 538: {region: 0x166, script: 0x5b, flags: 0x0}, + 539: {region: 0x166, script: 0x5b, flags: 0x0}, + 540: {region: 0x166, script: 0x5b, flags: 0x0}, + 541: {region: 0x166, script: 0x5b, flags: 0x0}, + 542: {region: 0xd5, script: 0x5, flags: 0x0}, + 543: {region: 0xd7, script: 0x5b, flags: 0x0}, + 544: {region: 0x165, script: 0x5b, flags: 0x0}, + 545: {region: 0x166, script: 0x5b, flags: 0x0}, + 546: {region: 0x166, script: 0x5b, flags: 0x0}, + 547: {region: 0x130, script: 0x5b, flags: 0x0}, + 548: {region: 0x123, script: 0x5, flags: 0x0}, + 549: {region: 0x166, script: 0x5b, flags: 0x0}, + 550: {region: 0x124, script: 0xee, flags: 0x0}, + 551: {region: 0x5b, script: 0x5b, flags: 0x0}, + 552: {region: 0x52, script: 0x5b, flags: 0x0}, + 553: {region: 0x166, script: 0x5b, flags: 0x0}, + 554: {region: 0x4f, script: 0x5b, flags: 0x0}, + 555: {region: 0x9a, script: 0x22, flags: 0x0}, + 556: {region: 0x9a, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5b, flags: 0x0}, + 558: {region: 0x96, script: 0x5b, flags: 0x0}, + 559: {region: 0x166, script: 0x5b, flags: 0x0}, + 560: {region: 0x41, script: 0x5b, flags: 0x0}, + 561: {region: 0x9a, script: 0x5b, flags: 0x0}, + 562: {region: 0x53, script: 0xe5, flags: 0x0}, + 563: {region: 0x9a, script: 0x22, flags: 0x0}, + 564: {region: 0xc4, script: 0x5b, flags: 0x0}, + 565: {region: 0x166, script: 0x5b, flags: 0x0}, + 566: {region: 0x9a, script: 0x76, flags: 0x0}, + 567: {region: 0xe9, script: 0x5, flags: 0x0}, + 568: {region: 0x166, script: 0x5b, flags: 0x0}, + 569: {region: 0xa5, script: 0x5b, flags: 0x0}, + 570: {region: 0x166, script: 0x5b, flags: 0x0}, + 571: {region: 0x12c, script: 0x5b, flags: 0x0}, + 572: {region: 0x166, script: 0x5b, flags: 0x0}, + 573: {region: 0xd3, script: 0x5b, flags: 0x0}, + 574: {region: 0x166, script: 0x5b, flags: 0x0}, + 575: {region: 0xb0, script: 0x58, flags: 0x0}, + 576: {region: 0x166, script: 0x5b, flags: 0x0}, + 577: {region: 0x166, script: 0x5b, flags: 0x0}, 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x165, script: 0x5a, flags: 0x0}, - 580: {region: 0x52, script: 0x5a, flags: 0x0}, - 581: {region: 0x82, script: 0x5a, flags: 0x0}, - 582: {region: 0xa4, script: 0x5a, flags: 0x0}, - 583: {region: 0x165, script: 0x5a, flags: 0x0}, - 584: {region: 0x165, script: 0x5a, flags: 0x0}, - 585: {region: 0x165, script: 0x5a, flags: 0x0}, - 586: {region: 0xa6, script: 0x4e, flags: 0x0}, - 587: {region: 0x2a, script: 0x5a, flags: 0x0}, - 588: {region: 0x165, script: 0x5a, flags: 0x0}, - 589: {region: 0x165, script: 0x5a, flags: 0x0}, - 590: {region: 0x165, script: 0x5a, flags: 0x0}, - 591: {region: 0x165, script: 0x5a, flags: 0x0}, - 592: {region: 0x165, script: 0x5a, flags: 0x0}, - 593: {region: 0x99, script: 0x52, flags: 0x0}, - 594: {region: 0x8b, script: 0x5a, flags: 0x0}, - 595: {region: 0x165, script: 0x5a, flags: 0x0}, - 596: {region: 0xab, script: 0x53, flags: 0x0}, - 597: {region: 0x106, script: 0x20, flags: 0x0}, - 598: {region: 0x99, script: 0x22, flags: 0x0}, - 599: {region: 0x165, script: 0x5a, flags: 0x0}, - 600: {region: 0x75, script: 0x5a, flags: 0x0}, - 601: {region: 0x165, script: 0x5a, flags: 0x0}, - 602: {region: 0xb4, script: 0x5a, flags: 0x0}, - 603: {region: 0x165, script: 0x5a, flags: 0x0}, - 604: {region: 0x165, script: 0x5a, flags: 0x0}, - 605: {region: 0x165, script: 0x5a, flags: 0x0}, - 606: {region: 0x165, script: 0x5a, flags: 0x0}, - 607: {region: 0x165, script: 0x5a, flags: 0x0}, - 608: {region: 0x165, script: 0x5a, flags: 0x0}, - 609: {region: 0x165, script: 0x5a, flags: 0x0}, - 610: {region: 0x165, script: 0x2c, flags: 0x0}, - 611: {region: 0x165, script: 0x5a, flags: 0x0}, - 612: {region: 0x106, script: 0x20, flags: 0x0}, - 613: {region: 0x112, script: 0x5a, flags: 0x0}, - 614: {region: 0xe7, script: 0x5a, flags: 0x0}, - 615: {region: 0x106, script: 0x5a, flags: 0x0}, - 616: {region: 0x165, script: 0x5a, flags: 0x0}, - 617: {region: 0x99, script: 0x22, flags: 0x0}, - 618: {region: 0x99, script: 0x5, flags: 0x0}, - 619: {region: 0x12f, script: 0x5a, flags: 0x0}, - 620: {region: 0x165, script: 0x5a, flags: 0x0}, - 621: {region: 0x52, script: 0x5a, flags: 0x0}, - 622: {region: 0x60, script: 0x5a, flags: 0x0}, - 623: {region: 0x165, script: 0x5a, flags: 0x0}, - 624: {region: 0x165, script: 0x5a, flags: 0x0}, - 625: {region: 0x165, script: 0x2c, flags: 0x0}, - 626: {region: 0x165, script: 0x5a, flags: 0x0}, - 627: {region: 0x165, script: 0x5a, flags: 0x0}, + 579: {region: 0x166, script: 0x5b, flags: 0x0}, + 580: {region: 0x52, script: 0x5b, flags: 0x0}, + 581: {region: 0x83, script: 0x5b, flags: 0x0}, + 582: {region: 0xa5, script: 0x5b, flags: 0x0}, + 583: {region: 0x166, script: 0x5b, flags: 0x0}, + 584: {region: 0x166, script: 0x5b, flags: 0x0}, + 585: {region: 0x166, script: 0x5b, flags: 0x0}, + 586: {region: 0xa7, script: 0x4f, flags: 0x0}, + 587: {region: 0x2a, script: 0x5b, flags: 0x0}, + 588: {region: 0x166, script: 0x5b, flags: 0x0}, + 589: {region: 0x166, script: 0x5b, flags: 0x0}, + 590: {region: 0x166, script: 0x5b, flags: 0x0}, + 591: {region: 0x166, script: 0x5b, flags: 0x0}, + 592: {region: 0x166, script: 0x5b, flags: 0x0}, + 593: {region: 0x9a, script: 0x53, flags: 0x0}, + 594: {region: 0x8c, script: 0x5b, flags: 0x0}, + 595: {region: 0x166, script: 0x5b, flags: 0x0}, + 596: {region: 0xac, script: 0x54, flags: 0x0}, + 597: {region: 0x107, script: 0x20, flags: 0x0}, + 598: {region: 0x9a, script: 0x22, flags: 0x0}, + 599: {region: 0x166, script: 0x5b, flags: 0x0}, + 600: {region: 0x76, script: 0x5b, flags: 0x0}, + 601: {region: 0x166, script: 0x5b, flags: 0x0}, + 602: {region: 0xb5, script: 0x5b, flags: 0x0}, + 603: {region: 0x166, script: 0x5b, flags: 0x0}, + 604: {region: 0x166, script: 0x5b, flags: 0x0}, + 605: {region: 0x166, script: 0x5b, flags: 0x0}, + 606: {region: 0x166, script: 0x5b, flags: 0x0}, + 607: {region: 0x166, script: 0x5b, flags: 0x0}, + 608: {region: 0x166, script: 0x5b, flags: 0x0}, + 609: {region: 0x166, script: 0x5b, flags: 0x0}, + 610: {region: 0x166, script: 0x2c, flags: 0x0}, + 611: {region: 0x166, script: 0x5b, flags: 0x0}, + 612: {region: 0x107, script: 0x20, flags: 0x0}, + 613: {region: 0x113, script: 0x5b, flags: 0x0}, + 614: {region: 0xe8, script: 0x5b, flags: 0x0}, + 615: {region: 0x107, script: 0x5b, flags: 0x0}, + 616: {region: 0x166, script: 0x5b, flags: 0x0}, + 617: {region: 0x9a, script: 0x22, flags: 0x0}, + 618: {region: 0x9a, script: 0x5, flags: 0x0}, + 619: {region: 0x130, script: 0x5b, flags: 0x0}, + 620: {region: 0x166, script: 0x5b, flags: 0x0}, + 621: {region: 0x52, script: 0x5b, flags: 0x0}, + 622: {region: 0x61, script: 0x5b, flags: 0x0}, + 623: {region: 0x166, script: 0x5b, flags: 0x0}, + 624: {region: 0x166, script: 0x5b, flags: 0x0}, + 625: {region: 0x166, script: 0x2c, flags: 0x0}, + 626: {region: 0x166, script: 0x5b, flags: 0x0}, + 627: {region: 0x166, script: 0x5b, flags: 0x0}, 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x165, script: 0x5a, flags: 0x0}, - 630: {region: 0x165, script: 0x5a, flags: 0x0}, - 631: {region: 0x165, script: 0x5a, flags: 0x0}, - 632: {region: 0x165, script: 0x5a, flags: 0x0}, - 633: {region: 0x106, script: 0x20, flags: 0x0}, - 634: {region: 0x165, script: 0x5a, flags: 0x0}, - 635: {region: 0x165, script: 0x5a, flags: 0x0}, - 636: {region: 0x165, script: 0x5a, flags: 0x0}, - 637: {region: 0x106, script: 0x20, flags: 0x0}, - 638: {region: 0x165, script: 0x5a, flags: 0x0}, - 639: {region: 0x95, script: 0x5a, flags: 0x0}, - 640: {region: 0xe8, script: 0x5, flags: 0x0}, - 641: {region: 0x7b, script: 0x5a, flags: 0x0}, - 642: {region: 0x165, script: 0x5a, flags: 0x0}, - 643: {region: 0x165, script: 0x5a, flags: 0x0}, - 644: {region: 0x165, script: 0x5a, flags: 0x0}, - 645: {region: 0x165, script: 0x2c, flags: 0x0}, - 646: {region: 0x123, script: 0xeb, flags: 0x0}, - 647: {region: 0xe8, script: 0x5, flags: 0x0}, - 648: {region: 0x165, script: 0x5a, flags: 0x0}, - 649: {region: 0x165, script: 0x5a, flags: 0x0}, + 629: {region: 0x166, script: 0x5b, flags: 0x0}, + 630: {region: 0x166, script: 0x5b, flags: 0x0}, + 631: {region: 0x166, script: 0x5b, flags: 0x0}, + 632: {region: 0x166, script: 0x5b, flags: 0x0}, + 633: {region: 0x107, script: 0x20, flags: 0x0}, + 634: {region: 0x166, script: 0x5b, flags: 0x0}, + 635: {region: 0x166, script: 0x5b, flags: 0x0}, + 636: {region: 0x166, script: 0x5b, flags: 0x0}, + 637: {region: 0x107, script: 0x20, flags: 0x0}, + 638: {region: 0x166, script: 0x5b, flags: 0x0}, + 639: {region: 0x96, script: 0x5b, flags: 0x0}, + 640: {region: 0xe9, script: 0x5, flags: 0x0}, + 641: {region: 0x7c, script: 0x5b, flags: 0x0}, + 642: {region: 0x166, script: 0x5b, flags: 0x0}, + 643: {region: 0x166, script: 0x5b, flags: 0x0}, + 644: {region: 0x166, script: 0x5b, flags: 0x0}, + 645: {region: 0x166, script: 0x2c, flags: 0x0}, + 646: {region: 0x124, script: 0xee, flags: 0x0}, + 647: {region: 0xe9, script: 0x5, flags: 0x0}, + 648: {region: 0x166, script: 0x5b, flags: 0x0}, + 649: {region: 0x166, script: 0x5b, flags: 0x0}, 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x165, script: 0x5a, flags: 0x0}, - 652: {region: 0x165, script: 0x5a, flags: 0x0}, - 653: {region: 0x165, script: 0x5a, flags: 0x0}, - 654: {region: 0x138, script: 0x5a, flags: 0x0}, - 655: {region: 0x87, script: 0x5e, flags: 0x0}, - 656: {region: 0x97, script: 0x3e, flags: 0x0}, - 657: {region: 0x12f, script: 0x5a, flags: 0x0}, - 658: {region: 0xe8, script: 0x5, flags: 0x0}, - 659: {region: 0x131, script: 0x5a, flags: 0x0}, - 660: {region: 0x165, script: 0x5a, flags: 0x0}, - 661: {region: 0xb7, script: 0x5a, flags: 0x0}, - 662: {region: 0x106, script: 0x20, flags: 0x0}, - 663: {region: 0x165, script: 0x5a, flags: 0x0}, - 664: {region: 0x95, script: 0x5a, flags: 0x0}, - 665: {region: 0x165, script: 0x5a, flags: 0x0}, - 666: {region: 0x53, script: 0xeb, flags: 0x0}, - 667: {region: 0x165, script: 0x5a, flags: 0x0}, - 668: {region: 0x165, script: 0x5a, flags: 0x0}, - 669: {region: 0x165, script: 0x5a, flags: 0x0}, - 670: {region: 0x165, script: 0x5a, flags: 0x0}, - 671: {region: 0x99, script: 0x5c, flags: 0x0}, - 672: {region: 0x165, script: 0x5a, flags: 0x0}, - 673: {region: 0x165, script: 0x5a, flags: 0x0}, - 674: {region: 0x106, script: 0x20, flags: 0x0}, - 675: {region: 0x131, script: 0x5a, flags: 0x0}, - 676: {region: 0x165, script: 0x5a, flags: 0x0}, - 677: {region: 0xd9, script: 0x5a, flags: 0x0}, - 678: {region: 0x165, script: 0x5a, flags: 0x0}, - 679: {region: 0x165, script: 0x5a, flags: 0x0}, + 651: {region: 0x166, script: 0x5b, flags: 0x0}, + 652: {region: 0x166, script: 0x5b, flags: 0x0}, + 653: {region: 0x166, script: 0x5b, flags: 0x0}, + 654: {region: 0x139, script: 0x5b, flags: 0x0}, + 655: {region: 0x88, script: 0x5f, flags: 0x0}, + 656: {region: 0x98, script: 0x3e, flags: 0x0}, + 657: {region: 0x130, script: 0x5b, flags: 0x0}, + 658: {region: 0xe9, script: 0x5, flags: 0x0}, + 659: {region: 0x132, script: 0x5b, flags: 0x0}, + 660: {region: 0x166, script: 0x5b, flags: 0x0}, + 661: {region: 0xb8, script: 0x5b, flags: 0x0}, + 662: {region: 0x107, script: 0x20, flags: 0x0}, + 663: {region: 0x166, script: 0x5b, flags: 0x0}, + 664: {region: 0x96, script: 0x5b, flags: 0x0}, + 665: {region: 0x166, script: 0x5b, flags: 0x0}, + 666: {region: 0x53, script: 0xee, flags: 0x0}, + 667: {region: 0x166, script: 0x5b, flags: 0x0}, + 668: {region: 0x166, script: 0x5b, flags: 0x0}, + 669: {region: 0x166, script: 0x5b, flags: 0x0}, + 670: {region: 0x166, script: 0x5b, flags: 0x0}, + 671: {region: 0x9a, script: 0x5d, flags: 0x0}, + 672: {region: 0x166, script: 0x5b, flags: 0x0}, + 673: {region: 0x166, script: 0x5b, flags: 0x0}, + 674: {region: 0x107, script: 0x20, flags: 0x0}, + 675: {region: 0x132, script: 0x5b, flags: 0x0}, + 676: {region: 0x166, script: 0x5b, flags: 0x0}, + 677: {region: 0xda, script: 0x5b, flags: 0x0}, + 678: {region: 0x166, script: 0x5b, flags: 0x0}, + 679: {region: 0x166, script: 0x5b, flags: 0x0}, 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x165, script: 0x5a, flags: 0x0}, - 682: {region: 0x165, script: 0x5a, flags: 0x0}, - 683: {region: 0x9e, script: 0x5a, flags: 0x0}, - 684: {region: 0x53, script: 0x60, flags: 0x0}, - 685: {region: 0x95, script: 0x5a, flags: 0x0}, - 686: {region: 0x9c, script: 0x5, flags: 0x0}, - 687: {region: 0x135, script: 0x5a, flags: 0x0}, - 688: {region: 0x165, script: 0x5a, flags: 0x0}, - 689: {region: 0x165, script: 0x5a, flags: 0x0}, - 690: {region: 0x99, script: 0xe6, flags: 0x0}, - 691: {region: 0x9e, script: 0x5a, flags: 0x0}, - 692: {region: 0x165, script: 0x5a, flags: 0x0}, - 693: {region: 0x4b, script: 0x5a, flags: 0x0}, - 694: {region: 0x165, script: 0x5a, flags: 0x0}, - 695: {region: 0x165, script: 0x5a, flags: 0x0}, - 696: {region: 0xaf, script: 0x57, flags: 0x0}, - 697: {region: 0x165, script: 0x5a, flags: 0x0}, - 698: {region: 0x165, script: 0x5a, flags: 0x0}, - 699: {region: 0x4b, script: 0x5a, flags: 0x0}, - 700: {region: 0x165, script: 0x5a, flags: 0x0}, - 701: {region: 0x165, script: 0x5a, flags: 0x0}, - 702: {region: 0x162, script: 0x5a, flags: 0x0}, - 703: {region: 0x9c, script: 0x5, flags: 0x0}, - 704: {region: 0xb6, script: 0x5a, flags: 0x0}, - 705: {region: 0xb8, script: 0x5a, flags: 0x0}, - 706: {region: 0x4b, script: 0x5a, flags: 0x0}, - 707: {region: 0x4b, script: 0x5a, flags: 0x0}, - 708: {region: 0xa4, script: 0x5a, flags: 0x0}, - 709: {region: 0xa4, script: 0x5a, flags: 0x0}, - 710: {region: 0x9c, script: 0x5, flags: 0x0}, - 711: {region: 0xb8, script: 0x5a, flags: 0x0}, - 712: {region: 0x123, script: 0xeb, flags: 0x0}, + 681: {region: 0x166, script: 0x5b, flags: 0x0}, + 682: {region: 0x166, script: 0x5b, flags: 0x0}, + 683: {region: 0x9f, script: 0x5b, flags: 0x0}, + 684: {region: 0x53, script: 0x61, flags: 0x0}, + 685: {region: 0x96, script: 0x5b, flags: 0x0}, + 686: {region: 0x9d, script: 0x5, flags: 0x0}, + 687: {region: 0x136, script: 0x5b, flags: 0x0}, + 688: {region: 0x166, script: 0x5b, flags: 0x0}, + 689: {region: 0x166, script: 0x5b, flags: 0x0}, + 690: {region: 0x9a, script: 0xe9, flags: 0x0}, + 691: {region: 0x9f, script: 0x5b, flags: 0x0}, + 692: {region: 0x166, script: 0x5b, flags: 0x0}, + 693: {region: 0x4b, script: 0x5b, flags: 0x0}, + 694: {region: 0x166, script: 0x5b, flags: 0x0}, + 695: {region: 0x166, script: 0x5b, flags: 0x0}, + 696: {region: 0xb0, script: 0x58, flags: 0x0}, + 697: {region: 0x166, script: 0x5b, flags: 0x0}, + 698: {region: 0x166, script: 0x5b, flags: 0x0}, + 699: {region: 0x4b, script: 0x5b, flags: 0x0}, + 700: {region: 0x166, script: 0x5b, flags: 0x0}, + 701: {region: 0x166, script: 0x5b, flags: 0x0}, + 702: {region: 0x163, script: 0x5b, flags: 0x0}, + 703: {region: 0x9d, script: 0x5, flags: 0x0}, + 704: {region: 0xb7, script: 0x5b, flags: 0x0}, + 705: {region: 0xb9, script: 0x5b, flags: 0x0}, + 706: {region: 0x4b, script: 0x5b, flags: 0x0}, + 707: {region: 0x4b, script: 0x5b, flags: 0x0}, + 708: {region: 0xa5, script: 0x5b, flags: 0x0}, + 709: {region: 0xa5, script: 0x5b, flags: 0x0}, + 710: {region: 0x9d, script: 0x5, flags: 0x0}, + 711: {region: 0xb9, script: 0x5b, flags: 0x0}, + 712: {region: 0x124, script: 0xee, flags: 0x0}, 713: {region: 0x53, script: 0x3b, flags: 0x0}, - 714: {region: 0x12b, script: 0x5a, flags: 0x0}, - 715: {region: 0x95, script: 0x5a, flags: 0x0}, - 716: {region: 0x52, script: 0x5a, flags: 0x0}, - 717: {region: 0x99, script: 0x22, flags: 0x0}, - 718: {region: 0x99, script: 0x22, flags: 0x0}, - 719: {region: 0x95, script: 0x5a, flags: 0x0}, + 714: {region: 0x12c, script: 0x5b, flags: 0x0}, + 715: {region: 0x96, script: 0x5b, flags: 0x0}, + 716: {region: 0x52, script: 0x5b, flags: 0x0}, + 717: {region: 0x9a, script: 0x22, flags: 0x0}, + 718: {region: 0x9a, script: 0x22, flags: 0x0}, + 719: {region: 0x96, script: 0x5b, flags: 0x0}, 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa4, script: 0x5a, flags: 0x0}, - 722: {region: 0x165, script: 0x5a, flags: 0x0}, - 723: {region: 0xcf, script: 0x5a, flags: 0x0}, - 724: {region: 0x165, script: 0x5a, flags: 0x0}, - 725: {region: 0x165, script: 0x5a, flags: 0x0}, - 726: {region: 0x165, script: 0x5a, flags: 0x0}, - 727: {region: 0x165, script: 0x5a, flags: 0x0}, - 728: {region: 0x165, script: 0x5a, flags: 0x0}, - 729: {region: 0x165, script: 0x5a, flags: 0x0}, - 730: {region: 0x165, script: 0x5a, flags: 0x0}, - 731: {region: 0x165, script: 0x5a, flags: 0x0}, - 732: {region: 0x165, script: 0x5a, flags: 0x0}, - 733: {region: 0x165, script: 0x5a, flags: 0x0}, - 734: {region: 0x165, script: 0x5a, flags: 0x0}, - 735: {region: 0x165, script: 0x5, flags: 0x0}, - 736: {region: 0x106, script: 0x20, flags: 0x0}, - 737: {region: 0xe7, script: 0x5a, flags: 0x0}, - 738: {region: 0x165, script: 0x5a, flags: 0x0}, - 739: {region: 0x95, script: 0x5a, flags: 0x0}, - 740: {region: 0x165, script: 0x2c, flags: 0x0}, - 741: {region: 0x165, script: 0x5a, flags: 0x0}, - 742: {region: 0x165, script: 0x5a, flags: 0x0}, - 743: {region: 0x165, script: 0x5a, flags: 0x0}, - 744: {region: 0x112, script: 0x5a, flags: 0x0}, - 745: {region: 0xa4, script: 0x5a, flags: 0x0}, - 746: {region: 0x165, script: 0x5a, flags: 0x0}, - 747: {region: 0x165, script: 0x5a, flags: 0x0}, - 748: {region: 0x123, script: 0x5, flags: 0x0}, - 749: {region: 0xcc, script: 0x5a, flags: 0x0}, - 750: {region: 0x165, script: 0x5a, flags: 0x0}, - 751: {region: 0x165, script: 0x5a, flags: 0x0}, - 752: {region: 0x165, script: 0x5a, flags: 0x0}, - 753: {region: 0xbf, script: 0x5a, flags: 0x0}, - 754: {region: 0xd1, script: 0x5a, flags: 0x0}, - 755: {region: 0x165, script: 0x5a, flags: 0x0}, - 756: {region: 0x52, script: 0x5a, flags: 0x0}, - 757: {region: 0xdb, script: 0x22, flags: 0x0}, - 758: {region: 0x12f, script: 0x5a, flags: 0x0}, - 759: {region: 0xc0, script: 0x5a, flags: 0x0}, - 760: {region: 0x165, script: 0x5a, flags: 0x0}, - 761: {region: 0x165, script: 0x5a, flags: 0x0}, - 762: {region: 0xe0, script: 0x5a, flags: 0x0}, - 763: {region: 0x165, script: 0x5a, flags: 0x0}, - 764: {region: 0x95, script: 0x5a, flags: 0x0}, - 765: {region: 0x9b, script: 0x3d, flags: 0x0}, - 766: {region: 0x165, script: 0x5a, flags: 0x0}, - 767: {region: 0xc2, script: 0x20, flags: 0x0}, - 768: {region: 0x165, script: 0x5, flags: 0x0}, - 769: {region: 0x165, script: 0x5a, flags: 0x0}, - 770: {region: 0x165, script: 0x5a, flags: 0x0}, - 771: {region: 0x165, script: 0x5a, flags: 0x0}, - 772: {region: 0x99, script: 0x6e, flags: 0x0}, - 773: {region: 0x165, script: 0x5a, flags: 0x0}, - 774: {region: 0x165, script: 0x5a, flags: 0x0}, - 775: {region: 0x10b, script: 0x5a, flags: 0x0}, - 776: {region: 0x165, script: 0x5a, flags: 0x0}, - 777: {region: 0x165, script: 0x5a, flags: 0x0}, - 778: {region: 0x165, script: 0x5a, flags: 0x0}, + 721: {region: 0xa5, script: 0x5b, flags: 0x0}, + 722: {region: 0x166, script: 0x5b, flags: 0x0}, + 723: {region: 0xd0, script: 0x5b, flags: 0x0}, + 724: {region: 0x166, script: 0x5b, flags: 0x0}, + 725: {region: 0x166, script: 0x5b, flags: 0x0}, + 726: {region: 0x166, script: 0x5b, flags: 0x0}, + 727: {region: 0x166, script: 0x5b, flags: 0x0}, + 728: {region: 0x166, script: 0x5b, flags: 0x0}, + 729: {region: 0x166, script: 0x5b, flags: 0x0}, + 730: {region: 0x166, script: 0x5b, flags: 0x0}, + 731: {region: 0x166, script: 0x5b, flags: 0x0}, + 732: {region: 0x166, script: 0x5b, flags: 0x0}, + 733: {region: 0x166, script: 0x5b, flags: 0x0}, + 734: {region: 0x166, script: 0x5b, flags: 0x0}, + 735: {region: 0x166, script: 0x5, flags: 0x0}, + 736: {region: 0x107, script: 0x20, flags: 0x0}, + 737: {region: 0xe8, script: 0x5b, flags: 0x0}, + 738: {region: 0x166, script: 0x5b, flags: 0x0}, + 739: {region: 0x96, script: 0x5b, flags: 0x0}, + 740: {region: 0x166, script: 0x2c, flags: 0x0}, + 741: {region: 0x166, script: 0x5b, flags: 0x0}, + 742: {region: 0x166, script: 0x5b, flags: 0x0}, + 743: {region: 0x166, script: 0x5b, flags: 0x0}, + 744: {region: 0x113, script: 0x5b, flags: 0x0}, + 745: {region: 0xa5, script: 0x5b, flags: 0x0}, + 746: {region: 0x166, script: 0x5b, flags: 0x0}, + 747: {region: 0x166, script: 0x5b, flags: 0x0}, + 748: {region: 0x124, script: 0x5, flags: 0x0}, + 749: {region: 0xcd, script: 0x5b, flags: 0x0}, + 750: {region: 0x166, script: 0x5b, flags: 0x0}, + 751: {region: 0x166, script: 0x5b, flags: 0x0}, + 752: {region: 0x166, script: 0x5b, flags: 0x0}, + 753: {region: 0xc0, script: 0x5b, flags: 0x0}, + 754: {region: 0xd2, script: 0x5b, flags: 0x0}, + 755: {region: 0x166, script: 0x5b, flags: 0x0}, + 756: {region: 0x52, script: 0x5b, flags: 0x0}, + 757: {region: 0xdc, script: 0x22, flags: 0x0}, + 758: {region: 0x130, script: 0x5b, flags: 0x0}, + 759: {region: 0xc1, script: 0x5b, flags: 0x0}, + 760: {region: 0x166, script: 0x5b, flags: 0x0}, + 761: {region: 0x166, script: 0x5b, flags: 0x0}, + 762: {region: 0xe1, script: 0x5b, flags: 0x0}, + 763: {region: 0x166, script: 0x5b, flags: 0x0}, + 764: {region: 0x96, script: 0x5b, flags: 0x0}, + 765: {region: 0x9c, script: 0x3d, flags: 0x0}, + 766: {region: 0x166, script: 0x5b, flags: 0x0}, + 767: {region: 0xc3, script: 0x20, flags: 0x0}, + 768: {region: 0x166, script: 0x5, flags: 0x0}, + 769: {region: 0x166, script: 0x5b, flags: 0x0}, + 770: {region: 0x166, script: 0x5b, flags: 0x0}, + 771: {region: 0x166, script: 0x5b, flags: 0x0}, + 772: {region: 0x9a, script: 0x6f, flags: 0x0}, + 773: {region: 0x166, script: 0x5b, flags: 0x0}, + 774: {region: 0x166, script: 0x5b, flags: 0x0}, + 775: {region: 0x10c, script: 0x5b, flags: 0x0}, + 776: {region: 0x166, script: 0x5b, flags: 0x0}, + 777: {region: 0x166, script: 0x5b, flags: 0x0}, + 778: {region: 0x166, script: 0x5b, flags: 0x0}, 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x165, script: 0x5a, flags: 0x0}, - 781: {region: 0x165, script: 0x5a, flags: 0x0}, - 782: {region: 0x99, script: 0xe, flags: 0x0}, - 783: {region: 0xc4, script: 0x75, flags: 0x0}, - 785: {region: 0x165, script: 0x5a, flags: 0x0}, - 786: {region: 0x49, script: 0x5a, flags: 0x0}, - 787: {region: 0x49, script: 0x5a, flags: 0x0}, - 788: {region: 0x37, script: 0x5a, flags: 0x0}, - 789: {region: 0x165, script: 0x5a, flags: 0x0}, - 790: {region: 0x165, script: 0x5a, flags: 0x0}, - 791: {region: 0x165, script: 0x5a, flags: 0x0}, - 792: {region: 0x165, script: 0x5a, flags: 0x0}, - 793: {region: 0x165, script: 0x5a, flags: 0x0}, - 794: {region: 0x165, script: 0x5a, flags: 0x0}, - 795: {region: 0x99, script: 0x22, flags: 0x0}, - 796: {region: 0xdb, script: 0x22, flags: 0x0}, - 797: {region: 0x106, script: 0x20, flags: 0x0}, - 798: {region: 0x35, script: 0x72, flags: 0x0}, + 780: {region: 0x166, script: 0x5b, flags: 0x0}, + 781: {region: 0x166, script: 0x5b, flags: 0x0}, + 782: {region: 0x9a, script: 0xe, flags: 0x0}, + 783: {region: 0xc5, script: 0x76, flags: 0x0}, + 785: {region: 0x166, script: 0x5b, flags: 0x0}, + 786: {region: 0x49, script: 0x5b, flags: 0x0}, + 787: {region: 0x49, script: 0x5b, flags: 0x0}, + 788: {region: 0x37, script: 0x5b, flags: 0x0}, + 789: {region: 0x166, script: 0x5b, flags: 0x0}, + 790: {region: 0x166, script: 0x5b, flags: 0x0}, + 791: {region: 0x166, script: 0x5b, flags: 0x0}, + 792: {region: 0x166, script: 0x5b, flags: 0x0}, + 793: {region: 0x166, script: 0x5b, flags: 0x0}, + 794: {region: 0x166, script: 0x5b, flags: 0x0}, + 795: {region: 0x9a, script: 0x22, flags: 0x0}, + 796: {region: 0xdc, script: 0x22, flags: 0x0}, + 797: {region: 0x107, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x73, flags: 0x0}, 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcb, script: 0x5a, flags: 0x0}, - 801: {region: 0x165, script: 0x5a, flags: 0x0}, - 802: {region: 0x165, script: 0x5a, flags: 0x0}, - 803: {region: 0x165, script: 0x5a, flags: 0x0}, - 804: {region: 0x99, script: 0x22, flags: 0x0}, - 805: {region: 0x52, script: 0x5a, flags: 0x0}, - 807: {region: 0x165, script: 0x5a, flags: 0x0}, - 808: {region: 0x135, script: 0x5a, flags: 0x0}, - 809: {region: 0x165, script: 0x5a, flags: 0x0}, - 810: {region: 0x165, script: 0x5a, flags: 0x0}, - 811: {region: 0xe8, script: 0x5, flags: 0x0}, - 812: {region: 0xc3, script: 0x5a, flags: 0x0}, - 813: {region: 0x99, script: 0x22, flags: 0x0}, - 814: {region: 0x95, script: 0x5a, flags: 0x0}, - 815: {region: 0x164, script: 0x5a, flags: 0x0}, - 816: {region: 0x165, script: 0x5a, flags: 0x0}, - 817: {region: 0xc4, script: 0x75, flags: 0x0}, - 818: {region: 0x165, script: 0x5a, flags: 0x0}, - 819: {region: 0x165, script: 0x2c, flags: 0x0}, - 820: {region: 0x106, script: 0x20, flags: 0x0}, - 821: {region: 0x165, script: 0x5a, flags: 0x0}, - 822: {region: 0x131, script: 0x5a, flags: 0x0}, - 823: {region: 0x9c, script: 0x66, flags: 0x0}, - 824: {region: 0x165, script: 0x5a, flags: 0x0}, - 825: {region: 0x165, script: 0x5a, flags: 0x0}, - 826: {region: 0x9c, script: 0x5, flags: 0x0}, - 827: {region: 0x165, script: 0x5a, flags: 0x0}, - 828: {region: 0x165, script: 0x5a, flags: 0x0}, - 829: {region: 0x165, script: 0x5a, flags: 0x0}, - 830: {region: 0xdd, script: 0x5a, flags: 0x0}, - 831: {region: 0x165, script: 0x5a, flags: 0x0}, - 832: {region: 0x165, script: 0x5a, flags: 0x0}, - 834: {region: 0x165, script: 0x5a, flags: 0x0}, + 800: {region: 0xcc, script: 0x5b, flags: 0x0}, + 801: {region: 0x166, script: 0x5b, flags: 0x0}, + 802: {region: 0x166, script: 0x5b, flags: 0x0}, + 803: {region: 0x166, script: 0x5b, flags: 0x0}, + 804: {region: 0x9a, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5b, flags: 0x0}, + 807: {region: 0x166, script: 0x5b, flags: 0x0}, + 808: {region: 0x136, script: 0x5b, flags: 0x0}, + 809: {region: 0x166, script: 0x5b, flags: 0x0}, + 810: {region: 0x166, script: 0x5b, flags: 0x0}, + 811: {region: 0xe9, script: 0x5, flags: 0x0}, + 812: {region: 0xc4, script: 0x5b, flags: 0x0}, + 813: {region: 0x9a, script: 0x22, flags: 0x0}, + 814: {region: 0x96, script: 0x5b, flags: 0x0}, + 815: {region: 0x165, script: 0x5b, flags: 0x0}, + 816: {region: 0x166, script: 0x5b, flags: 0x0}, + 817: {region: 0xc5, script: 0x76, flags: 0x0}, + 818: {region: 0x166, script: 0x5b, flags: 0x0}, + 819: {region: 0x166, script: 0x2c, flags: 0x0}, + 820: {region: 0x107, script: 0x20, flags: 0x0}, + 821: {region: 0x166, script: 0x5b, flags: 0x0}, + 822: {region: 0x132, script: 0x5b, flags: 0x0}, + 823: {region: 0x9d, script: 0x67, flags: 0x0}, + 824: {region: 0x166, script: 0x5b, flags: 0x0}, + 825: {region: 0x166, script: 0x5b, flags: 0x0}, + 826: {region: 0x9d, script: 0x5, flags: 0x0}, + 827: {region: 0x166, script: 0x5b, flags: 0x0}, + 828: {region: 0x166, script: 0x5b, flags: 0x0}, + 829: {region: 0x166, script: 0x5b, flags: 0x0}, + 830: {region: 0xde, script: 0x5b, flags: 0x0}, + 831: {region: 0x166, script: 0x5b, flags: 0x0}, + 832: {region: 0x166, script: 0x5b, flags: 0x0}, + 834: {region: 0x166, script: 0x5b, flags: 0x0}, 835: {region: 0x53, script: 0x3b, flags: 0x0}, - 836: {region: 0x9e, script: 0x5a, flags: 0x0}, - 837: {region: 0xd2, script: 0x5a, flags: 0x0}, - 838: {region: 0x165, script: 0x5a, flags: 0x0}, - 839: {region: 0xda, script: 0x5a, flags: 0x0}, - 840: {region: 0x165, script: 0x5a, flags: 0x0}, - 841: {region: 0x165, script: 0x5a, flags: 0x0}, - 842: {region: 0x165, script: 0x5a, flags: 0x0}, - 843: {region: 0xcf, script: 0x5a, flags: 0x0}, - 844: {region: 0x165, script: 0x5a, flags: 0x0}, - 845: {region: 0x165, script: 0x5a, flags: 0x0}, - 846: {region: 0x164, script: 0x5a, flags: 0x0}, - 847: {region: 0xd1, script: 0x5a, flags: 0x0}, - 848: {region: 0x60, script: 0x5a, flags: 0x0}, - 849: {region: 0xdb, script: 0x22, flags: 0x0}, - 850: {region: 0x165, script: 0x5a, flags: 0x0}, - 851: {region: 0xdb, script: 0x22, flags: 0x0}, - 852: {region: 0x165, script: 0x5a, flags: 0x0}, - 853: {region: 0x165, script: 0x5a, flags: 0x0}, - 854: {region: 0xd2, script: 0x5a, flags: 0x0}, - 855: {region: 0x165, script: 0x5a, flags: 0x0}, - 856: {region: 0x165, script: 0x5a, flags: 0x0}, - 857: {region: 0xd1, script: 0x5a, flags: 0x0}, - 858: {region: 0x165, script: 0x5a, flags: 0x0}, - 859: {region: 0xcf, script: 0x5a, flags: 0x0}, - 860: {region: 0xcf, script: 0x5a, flags: 0x0}, - 861: {region: 0x165, script: 0x5a, flags: 0x0}, - 862: {region: 0x165, script: 0x5a, flags: 0x0}, - 863: {region: 0x95, script: 0x5a, flags: 0x0}, - 864: {region: 0x165, script: 0x5a, flags: 0x0}, - 865: {region: 0xdf, script: 0x5a, flags: 0x0}, - 866: {region: 0x165, script: 0x5a, flags: 0x0}, - 867: {region: 0x165, script: 0x5a, flags: 0x0}, - 868: {region: 0x99, script: 0x5a, flags: 0x0}, - 869: {region: 0x165, script: 0x5a, flags: 0x0}, - 870: {region: 0x165, script: 0x5a, flags: 0x0}, - 871: {region: 0xd9, script: 0x5a, flags: 0x0}, - 872: {region: 0x52, script: 0x5a, flags: 0x0}, - 873: {region: 0x165, script: 0x5a, flags: 0x0}, - 874: {region: 0xda, script: 0x5a, flags: 0x0}, - 875: {region: 0x165, script: 0x5a, flags: 0x0}, - 876: {region: 0x52, script: 0x5a, flags: 0x0}, - 877: {region: 0x165, script: 0x5a, flags: 0x0}, - 878: {region: 0x165, script: 0x5a, flags: 0x0}, - 879: {region: 0xda, script: 0x5a, flags: 0x0}, - 880: {region: 0x123, script: 0x56, flags: 0x0}, - 881: {region: 0x99, script: 0x22, flags: 0x0}, - 882: {region: 0x10c, script: 0xc9, flags: 0x0}, - 883: {region: 0x165, script: 0x5a, flags: 0x0}, - 884: {region: 0x165, script: 0x5a, flags: 0x0}, - 885: {region: 0x84, script: 0x7c, flags: 0x0}, - 886: {region: 0x161, script: 0x5a, flags: 0x0}, - 887: {region: 0x165, script: 0x5a, flags: 0x0}, + 836: {region: 0x9f, script: 0x5b, flags: 0x0}, + 837: {region: 0xd3, script: 0x5b, flags: 0x0}, + 838: {region: 0x166, script: 0x5b, flags: 0x0}, + 839: {region: 0xdb, script: 0x5b, flags: 0x0}, + 840: {region: 0x166, script: 0x5b, flags: 0x0}, + 841: {region: 0x166, script: 0x5b, flags: 0x0}, + 842: {region: 0x166, script: 0x5b, flags: 0x0}, + 843: {region: 0xd0, script: 0x5b, flags: 0x0}, + 844: {region: 0x166, script: 0x5b, flags: 0x0}, + 845: {region: 0x166, script: 0x5b, flags: 0x0}, + 846: {region: 0x165, script: 0x5b, flags: 0x0}, + 847: {region: 0xd2, script: 0x5b, flags: 0x0}, + 848: {region: 0x61, script: 0x5b, flags: 0x0}, + 849: {region: 0xdc, script: 0x22, flags: 0x0}, + 850: {region: 0x166, script: 0x5b, flags: 0x0}, + 851: {region: 0xdc, script: 0x22, flags: 0x0}, + 852: {region: 0x166, script: 0x5b, flags: 0x0}, + 853: {region: 0x166, script: 0x5b, flags: 0x0}, + 854: {region: 0xd3, script: 0x5b, flags: 0x0}, + 855: {region: 0x166, script: 0x5b, flags: 0x0}, + 856: {region: 0x166, script: 0x5b, flags: 0x0}, + 857: {region: 0xd2, script: 0x5b, flags: 0x0}, + 858: {region: 0x166, script: 0x5b, flags: 0x0}, + 859: {region: 0xd0, script: 0x5b, flags: 0x0}, + 860: {region: 0xd0, script: 0x5b, flags: 0x0}, + 861: {region: 0x166, script: 0x5b, flags: 0x0}, + 862: {region: 0x166, script: 0x5b, flags: 0x0}, + 863: {region: 0x96, script: 0x5b, flags: 0x0}, + 864: {region: 0x166, script: 0x5b, flags: 0x0}, + 865: {region: 0xe0, script: 0x5b, flags: 0x0}, + 866: {region: 0x166, script: 0x5b, flags: 0x0}, + 867: {region: 0x166, script: 0x5b, flags: 0x0}, + 868: {region: 0x9a, script: 0x5b, flags: 0x0}, + 869: {region: 0x166, script: 0x5b, flags: 0x0}, + 870: {region: 0x166, script: 0x5b, flags: 0x0}, + 871: {region: 0xda, script: 0x5b, flags: 0x0}, + 872: {region: 0x52, script: 0x5b, flags: 0x0}, + 873: {region: 0x166, script: 0x5b, flags: 0x0}, + 874: {region: 0xdb, script: 0x5b, flags: 0x0}, + 875: {region: 0x166, script: 0x5b, flags: 0x0}, + 876: {region: 0x52, script: 0x5b, flags: 0x0}, + 877: {region: 0x166, script: 0x5b, flags: 0x0}, + 878: {region: 0x166, script: 0x5b, flags: 0x0}, + 879: {region: 0xdb, script: 0x5b, flags: 0x0}, + 880: {region: 0x124, script: 0x57, flags: 0x0}, + 881: {region: 0x9a, script: 0x22, flags: 0x0}, + 882: {region: 0x10d, script: 0xcb, flags: 0x0}, + 883: {region: 0x166, script: 0x5b, flags: 0x0}, + 884: {region: 0x166, script: 0x5b, flags: 0x0}, + 885: {region: 0x85, script: 0x7e, flags: 0x0}, + 886: {region: 0x162, script: 0x5b, flags: 0x0}, + 887: {region: 0x166, script: 0x5b, flags: 0x0}, 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x165, script: 0x5a, flags: 0x0}, - 890: {region: 0x161, script: 0x5a, flags: 0x0}, - 891: {region: 0x165, script: 0x5a, flags: 0x0}, - 892: {region: 0x165, script: 0x5a, flags: 0x0}, - 893: {region: 0x165, script: 0x5a, flags: 0x0}, - 894: {region: 0x165, script: 0x5a, flags: 0x0}, - 895: {region: 0x165, script: 0x5a, flags: 0x0}, - 896: {region: 0x117, script: 0x5a, flags: 0x0}, - 897: {region: 0x165, script: 0x5a, flags: 0x0}, - 898: {region: 0x165, script: 0x5a, flags: 0x0}, - 899: {region: 0x135, script: 0x5a, flags: 0x0}, - 900: {region: 0x165, script: 0x5a, flags: 0x0}, - 901: {region: 0x53, script: 0x5a, flags: 0x0}, - 902: {region: 0x165, script: 0x5a, flags: 0x0}, - 903: {region: 0xce, script: 0x5a, flags: 0x0}, - 904: {region: 0x12f, script: 0x5a, flags: 0x0}, - 905: {region: 0x131, script: 0x5a, flags: 0x0}, - 906: {region: 0x80, script: 0x5a, flags: 0x0}, - 907: {region: 0x78, script: 0x5a, flags: 0x0}, - 908: {region: 0x165, script: 0x5a, flags: 0x0}, - 910: {region: 0x165, script: 0x5a, flags: 0x0}, - 911: {region: 0x165, script: 0x5a, flags: 0x0}, - 912: {region: 0x6f, script: 0x5a, flags: 0x0}, - 913: {region: 0x165, script: 0x5a, flags: 0x0}, - 914: {region: 0x165, script: 0x5a, flags: 0x0}, - 915: {region: 0x165, script: 0x5a, flags: 0x0}, - 916: {region: 0x165, script: 0x5a, flags: 0x0}, - 917: {region: 0x99, script: 0x81, flags: 0x0}, - 918: {region: 0x165, script: 0x5a, flags: 0x0}, - 919: {region: 0x165, script: 0x5, flags: 0x0}, - 920: {region: 0x7d, script: 0x20, flags: 0x0}, - 921: {region: 0x135, script: 0x82, flags: 0x0}, - 922: {region: 0x165, script: 0x5, flags: 0x0}, - 923: {region: 0xc5, script: 0x80, flags: 0x0}, - 924: {region: 0x165, script: 0x5a, flags: 0x0}, + 889: {region: 0x166, script: 0x5b, flags: 0x0}, + 890: {region: 0x162, script: 0x5b, flags: 0x0}, + 891: {region: 0x166, script: 0x5b, flags: 0x0}, + 892: {region: 0x166, script: 0x5b, flags: 0x0}, + 893: {region: 0x166, script: 0x5b, flags: 0x0}, + 894: {region: 0x166, script: 0x5b, flags: 0x0}, + 895: {region: 0x166, script: 0x5b, flags: 0x0}, + 896: {region: 0x118, script: 0x5b, flags: 0x0}, + 897: {region: 0x166, script: 0x5b, flags: 0x0}, + 898: {region: 0x166, script: 0x5b, flags: 0x0}, + 899: {region: 0x136, script: 0x5b, flags: 0x0}, + 900: {region: 0x166, script: 0x5b, flags: 0x0}, + 901: {region: 0x53, script: 0x5b, flags: 0x0}, + 902: {region: 0x166, script: 0x5b, flags: 0x0}, + 903: {region: 0xcf, script: 0x5b, flags: 0x0}, + 904: {region: 0x130, script: 0x5b, flags: 0x0}, + 905: {region: 0x132, script: 0x5b, flags: 0x0}, + 906: {region: 0x81, script: 0x5b, flags: 0x0}, + 907: {region: 0x79, script: 0x5b, flags: 0x0}, + 908: {region: 0x166, script: 0x5b, flags: 0x0}, + 910: {region: 0x166, script: 0x5b, flags: 0x0}, + 911: {region: 0x166, script: 0x5b, flags: 0x0}, + 912: {region: 0x70, script: 0x5b, flags: 0x0}, + 913: {region: 0x166, script: 0x5b, flags: 0x0}, + 914: {region: 0x166, script: 0x5b, flags: 0x0}, + 915: {region: 0x166, script: 0x5b, flags: 0x0}, + 916: {region: 0x166, script: 0x5b, flags: 0x0}, + 917: {region: 0x9a, script: 0x83, flags: 0x0}, + 918: {region: 0x166, script: 0x5b, flags: 0x0}, + 919: {region: 0x166, script: 0x5, flags: 0x0}, + 920: {region: 0x7e, script: 0x20, flags: 0x0}, + 921: {region: 0x136, script: 0x84, flags: 0x0}, + 922: {region: 0x166, script: 0x5, flags: 0x0}, + 923: {region: 0xc6, script: 0x82, flags: 0x0}, + 924: {region: 0x166, script: 0x5b, flags: 0x0}, 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe7, script: 0x5a, flags: 0x0}, + 926: {region: 0xe8, script: 0x5b, flags: 0x0}, 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe7, script: 0x5a, flags: 0x0}, - 929: {region: 0x30, script: 0x5a, flags: 0x0}, - 930: {region: 0xf0, script: 0x5a, flags: 0x0}, - 931: {region: 0x165, script: 0x5a, flags: 0x0}, - 932: {region: 0x78, script: 0x5a, flags: 0x0}, - 933: {region: 0xd6, script: 0x5a, flags: 0x0}, - 934: {region: 0x135, script: 0x5a, flags: 0x0}, - 935: {region: 0x49, script: 0x5a, flags: 0x0}, - 936: {region: 0x165, script: 0x5a, flags: 0x0}, - 937: {region: 0x9c, script: 0xf7, flags: 0x0}, - 938: {region: 0x165, script: 0x5a, flags: 0x0}, - 939: {region: 0x60, script: 0x5a, flags: 0x0}, - 940: {region: 0x165, script: 0x5, flags: 0x0}, - 941: {region: 0xb0, script: 0x8e, flags: 0x0}, - 943: {region: 0x165, script: 0x5a, flags: 0x0}, - 944: {region: 0x165, script: 0x5a, flags: 0x0}, - 945: {region: 0x99, script: 0x12, flags: 0x0}, - 946: {region: 0xa4, script: 0x5a, flags: 0x0}, - 947: {region: 0xe9, script: 0x5a, flags: 0x0}, - 948: {region: 0x165, script: 0x5a, flags: 0x0}, - 949: {region: 0x9e, script: 0x5a, flags: 0x0}, - 950: {region: 0x165, script: 0x5a, flags: 0x0}, - 951: {region: 0x165, script: 0x5a, flags: 0x0}, - 952: {region: 0x87, script: 0x34, flags: 0x0}, - 953: {region: 0x75, script: 0x5a, flags: 0x0}, - 954: {region: 0x165, script: 0x5a, flags: 0x0}, - 955: {region: 0xe8, script: 0x4d, flags: 0x0}, - 956: {region: 0x9c, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x5a, flags: 0x0}, + 928: {region: 0xe8, script: 0x5b, flags: 0x0}, + 929: {region: 0x30, script: 0x5b, flags: 0x0}, + 930: {region: 0xf1, script: 0x5b, flags: 0x0}, + 931: {region: 0x166, script: 0x5b, flags: 0x0}, + 932: {region: 0x79, script: 0x5b, flags: 0x0}, + 933: {region: 0xd7, script: 0x5b, flags: 0x0}, + 934: {region: 0x136, script: 0x5b, flags: 0x0}, + 935: {region: 0x49, script: 0x5b, flags: 0x0}, + 936: {region: 0x166, script: 0x5b, flags: 0x0}, + 937: {region: 0x9d, script: 0xfa, flags: 0x0}, + 938: {region: 0x166, script: 0x5b, flags: 0x0}, + 939: {region: 0x61, script: 0x5b, flags: 0x0}, + 940: {region: 0x166, script: 0x5, flags: 0x0}, + 941: {region: 0xb1, script: 0x90, flags: 0x0}, + 943: {region: 0x166, script: 0x5b, flags: 0x0}, + 944: {region: 0x166, script: 0x5b, flags: 0x0}, + 945: {region: 0x9a, script: 0x12, flags: 0x0}, + 946: {region: 0xa5, script: 0x5b, flags: 0x0}, + 947: {region: 0xea, script: 0x5b, flags: 0x0}, + 948: {region: 0x166, script: 0x5b, flags: 0x0}, + 949: {region: 0x9f, script: 0x5b, flags: 0x0}, + 950: {region: 0x166, script: 0x5b, flags: 0x0}, + 951: {region: 0x166, script: 0x5b, flags: 0x0}, + 952: {region: 0x88, script: 0x34, flags: 0x0}, + 953: {region: 0x76, script: 0x5b, flags: 0x0}, + 954: {region: 0x166, script: 0x5b, flags: 0x0}, + 955: {region: 0xe9, script: 0x4e, flags: 0x0}, + 956: {region: 0x9d, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5b, flags: 0x0}, 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x165, script: 0x5a, flags: 0x0}, - 960: {region: 0x41, script: 0x5a, flags: 0x0}, - 961: {region: 0x165, script: 0x5a, flags: 0x0}, - 962: {region: 0x7a, script: 0x5a, flags: 0x0}, - 963: {region: 0x165, script: 0x5a, flags: 0x0}, - 964: {region: 0xe4, script: 0x5a, flags: 0x0}, - 965: {region: 0x89, script: 0x5a, flags: 0x0}, - 966: {region: 0x69, script: 0x5a, flags: 0x0}, - 967: {region: 0x165, script: 0x5a, flags: 0x0}, - 968: {region: 0x99, script: 0x22, flags: 0x0}, - 969: {region: 0x165, script: 0x5a, flags: 0x0}, - 970: {region: 0x102, script: 0x5a, flags: 0x0}, - 971: {region: 0x95, script: 0x5a, flags: 0x0}, - 972: {region: 0x165, script: 0x5a, flags: 0x0}, - 973: {region: 0x165, script: 0x5a, flags: 0x0}, - 974: {region: 0x9e, script: 0x5a, flags: 0x0}, - 975: {region: 0x165, script: 0x5, flags: 0x0}, - 976: {region: 0x99, script: 0x5a, flags: 0x0}, + 959: {region: 0x166, script: 0x5b, flags: 0x0}, + 960: {region: 0x41, script: 0x5b, flags: 0x0}, + 961: {region: 0x166, script: 0x5b, flags: 0x0}, + 962: {region: 0x7b, script: 0x5b, flags: 0x0}, + 963: {region: 0x166, script: 0x5b, flags: 0x0}, + 964: {region: 0xe5, script: 0x5b, flags: 0x0}, + 965: {region: 0x8a, script: 0x5b, flags: 0x0}, + 966: {region: 0x6a, script: 0x5b, flags: 0x0}, + 967: {region: 0x166, script: 0x5b, flags: 0x0}, + 968: {region: 0x9a, script: 0x22, flags: 0x0}, + 969: {region: 0x166, script: 0x5b, flags: 0x0}, + 970: {region: 0x103, script: 0x5b, flags: 0x0}, + 971: {region: 0x96, script: 0x5b, flags: 0x0}, + 972: {region: 0x166, script: 0x5b, flags: 0x0}, + 973: {region: 0x166, script: 0x5b, flags: 0x0}, + 974: {region: 0x9f, script: 0x5b, flags: 0x0}, + 975: {region: 0x166, script: 0x5, flags: 0x0}, + 976: {region: 0x9a, script: 0x5b, flags: 0x0}, 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdb, script: 0x22, flags: 0x0}, + 978: {region: 0xdc, script: 0x22, flags: 0x0}, 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x5a, flags: 0x0}, - 981: {region: 0x72, script: 0x5a, flags: 0x0}, - 982: {region: 0x4e, script: 0x5a, flags: 0x0}, - 983: {region: 0x9c, script: 0x5, flags: 0x0}, - 984: {region: 0x10c, script: 0x5a, flags: 0x0}, - 985: {region: 0x3a, script: 0x5a, flags: 0x0}, - 986: {region: 0x165, script: 0x5a, flags: 0x0}, - 987: {region: 0xd1, script: 0x5a, flags: 0x0}, - 988: {region: 0x104, script: 0x5a, flags: 0x0}, - 989: {region: 0x95, script: 0x5a, flags: 0x0}, - 990: {region: 0x12f, script: 0x5a, flags: 0x0}, - 991: {region: 0x165, script: 0x5a, flags: 0x0}, - 992: {region: 0x165, script: 0x5a, flags: 0x0}, - 993: {region: 0x73, script: 0x5a, flags: 0x0}, - 994: {region: 0x106, script: 0x20, flags: 0x0}, - 995: {region: 0x130, script: 0x20, flags: 0x0}, - 996: {region: 0x109, script: 0x5a, flags: 0x0}, - 997: {region: 0x107, script: 0x5a, flags: 0x0}, - 998: {region: 0x12f, script: 0x5a, flags: 0x0}, - 999: {region: 0x165, script: 0x5a, flags: 0x0}, - 1000: {region: 0xa2, script: 0x4c, flags: 0x0}, - 1001: {region: 0x99, script: 0x22, flags: 0x0}, - 1002: {region: 0x80, script: 0x5a, flags: 0x0}, - 1003: {region: 0x106, script: 0x20, flags: 0x0}, - 1004: {region: 0xa4, script: 0x5a, flags: 0x0}, - 1005: {region: 0x95, script: 0x5a, flags: 0x0}, - 1006: {region: 0x99, script: 0x5a, flags: 0x0}, - 1007: {region: 0x114, script: 0x5a, flags: 0x0}, - 1008: {region: 0x99, script: 0xcd, flags: 0x0}, - 1009: {region: 0x165, script: 0x5a, flags: 0x0}, - 1010: {region: 0x165, script: 0x5a, flags: 0x0}, - 1011: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1012: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1013: {region: 0x99, script: 0x22, flags: 0x0}, - 1014: {region: 0x165, script: 0x5, flags: 0x0}, - 1015: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1016: {region: 0x7b, script: 0x5a, flags: 0x0}, - 1017: {region: 0x49, script: 0x5a, flags: 0x0}, + 980: {region: 0x4e, script: 0x5b, flags: 0x0}, + 981: {region: 0x73, script: 0x5b, flags: 0x0}, + 982: {region: 0x4e, script: 0x5b, flags: 0x0}, + 983: {region: 0x9d, script: 0x5, flags: 0x0}, + 984: {region: 0x10d, script: 0x5b, flags: 0x0}, + 985: {region: 0x3a, script: 0x5b, flags: 0x0}, + 986: {region: 0x166, script: 0x5b, flags: 0x0}, + 987: {region: 0xd2, script: 0x5b, flags: 0x0}, + 988: {region: 0x105, script: 0x5b, flags: 0x0}, + 989: {region: 0x96, script: 0x5b, flags: 0x0}, + 990: {region: 0x130, script: 0x5b, flags: 0x0}, + 991: {region: 0x166, script: 0x5b, flags: 0x0}, + 992: {region: 0x166, script: 0x5b, flags: 0x0}, + 993: {region: 0x74, script: 0x5b, flags: 0x0}, + 994: {region: 0x107, script: 0x20, flags: 0x0}, + 995: {region: 0x131, script: 0x20, flags: 0x0}, + 996: {region: 0x10a, script: 0x5b, flags: 0x0}, + 997: {region: 0x108, script: 0x5b, flags: 0x0}, + 998: {region: 0x130, script: 0x5b, flags: 0x0}, + 999: {region: 0x166, script: 0x5b, flags: 0x0}, + 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, + 1001: {region: 0x9a, script: 0x22, flags: 0x0}, + 1002: {region: 0x81, script: 0x5b, flags: 0x0}, + 1003: {region: 0x107, script: 0x20, flags: 0x0}, + 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, + 1005: {region: 0x96, script: 0x5b, flags: 0x0}, + 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, + 1007: {region: 0x115, script: 0x5b, flags: 0x0}, + 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, + 1009: {region: 0x166, script: 0x5b, flags: 0x0}, + 1010: {region: 0x166, script: 0x5b, flags: 0x0}, + 1011: {region: 0x130, script: 0x5b, flags: 0x0}, + 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1013: {region: 0x9a, script: 0x22, flags: 0x0}, + 1014: {region: 0x166, script: 0x5, flags: 0x0}, + 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, + 1017: {region: 0x49, script: 0x5b, flags: 0x0}, 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1020: {region: 0x9c, script: 0x5, flags: 0x0}, - 1021: {region: 0xda, script: 0x5a, flags: 0x0}, - 1022: {region: 0x4f, script: 0x5a, flags: 0x0}, - 1023: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1024: {region: 0xcf, script: 0x5a, flags: 0x0}, - 1025: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1026: {region: 0x4c, script: 0x5a, flags: 0x0}, - 1027: {region: 0x96, script: 0x7e, flags: 0x0}, - 1028: {region: 0xb6, script: 0x5a, flags: 0x0}, - 1029: {region: 0x165, script: 0x2c, flags: 0x0}, - 1030: {region: 0x165, script: 0x5a, flags: 0x0}, - 1032: {region: 0xba, script: 0xe8, flags: 0x0}, - 1033: {region: 0x165, script: 0x5a, flags: 0x0}, - 1034: {region: 0xc4, script: 0x75, flags: 0x0}, - 1035: {region: 0x165, script: 0x5, flags: 0x0}, - 1036: {region: 0xb3, script: 0xd4, flags: 0x0}, - 1037: {region: 0x6f, script: 0x5a, flags: 0x0}, - 1038: {region: 0x165, script: 0x5a, flags: 0x0}, - 1039: {region: 0x165, script: 0x5a, flags: 0x0}, - 1040: {region: 0x165, script: 0x5a, flags: 0x0}, - 1041: {region: 0x165, script: 0x5a, flags: 0x0}, - 1042: {region: 0x111, script: 0x5a, flags: 0x0}, - 1043: {region: 0x165, script: 0x5a, flags: 0x0}, - 1044: {region: 0xe8, script: 0x5, flags: 0x0}, - 1045: {region: 0x165, script: 0x5a, flags: 0x0}, - 1046: {region: 0x10f, script: 0x5a, flags: 0x0}, - 1047: {region: 0x165, script: 0x5a, flags: 0x0}, - 1048: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1049: {region: 0x165, script: 0x5a, flags: 0x0}, - 1050: {region: 0x95, script: 0x5a, flags: 0x0}, - 1051: {region: 0x142, script: 0x5a, flags: 0x0}, - 1052: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1054: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1055: {region: 0x72, script: 0x5a, flags: 0x0}, - 1056: {region: 0x97, script: 0xca, flags: 0x0}, - 1057: {region: 0x165, script: 0x5a, flags: 0x0}, - 1058: {region: 0x72, script: 0x5a, flags: 0x0}, - 1059: {region: 0x164, script: 0x5a, flags: 0x0}, - 1060: {region: 0x165, script: 0x5a, flags: 0x0}, - 1061: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1062: {region: 0x165, script: 0x5a, flags: 0x0}, - 1063: {region: 0x165, script: 0x5a, flags: 0x0}, - 1064: {region: 0x165, script: 0x5a, flags: 0x0}, - 1065: {region: 0x115, script: 0x5a, flags: 0x0}, - 1066: {region: 0x165, script: 0x5a, flags: 0x0}, - 1067: {region: 0x165, script: 0x5a, flags: 0x0}, - 1068: {region: 0x123, script: 0xeb, flags: 0x0}, - 1069: {region: 0x165, script: 0x5a, flags: 0x0}, - 1070: {region: 0x165, script: 0x5a, flags: 0x0}, - 1071: {region: 0x165, script: 0x5a, flags: 0x0}, - 1072: {region: 0x165, script: 0x5a, flags: 0x0}, - 1073: {region: 0x27, script: 0x5a, flags: 0x0}, + 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1020: {region: 0x9d, script: 0x5, flags: 0x0}, + 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, + 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, + 1027: {region: 0x97, script: 0x80, flags: 0x0}, + 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, + 1029: {region: 0x166, script: 0x2c, flags: 0x0}, + 1030: {region: 0x166, script: 0x5b, flags: 0x0}, + 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1033: {region: 0x166, script: 0x5b, flags: 0x0}, + 1034: {region: 0xc5, script: 0x76, flags: 0x0}, + 1035: {region: 0x166, script: 0x5, flags: 0x0}, + 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, + 1037: {region: 0x70, script: 0x5b, flags: 0x0}, + 1038: {region: 0x166, script: 0x5b, flags: 0x0}, + 1039: {region: 0x166, script: 0x5b, flags: 0x0}, + 1040: {region: 0x166, script: 0x5b, flags: 0x0}, + 1041: {region: 0x166, script: 0x5b, flags: 0x0}, + 1042: {region: 0x112, script: 0x5b, flags: 0x0}, + 1043: {region: 0x166, script: 0x5b, flags: 0x0}, + 1044: {region: 0xe9, script: 0x5, flags: 0x0}, + 1045: {region: 0x166, script: 0x5b, flags: 0x0}, + 1046: {region: 0x110, script: 0x5b, flags: 0x0}, + 1047: {region: 0x166, script: 0x5b, flags: 0x0}, + 1048: {region: 0xea, script: 0x5b, flags: 0x0}, + 1049: {region: 0x166, script: 0x5b, flags: 0x0}, + 1050: {region: 0x96, script: 0x5b, flags: 0x0}, + 1051: {region: 0x143, script: 0x5b, flags: 0x0}, + 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1055: {region: 0x73, script: 0x5b, flags: 0x0}, + 1056: {region: 0x98, script: 0xcc, flags: 0x0}, + 1057: {region: 0x166, script: 0x5b, flags: 0x0}, + 1058: {region: 0x73, script: 0x5b, flags: 0x0}, + 1059: {region: 0x165, script: 0x5b, flags: 0x0}, + 1060: {region: 0x166, script: 0x5b, flags: 0x0}, + 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1062: {region: 0x166, script: 0x5b, flags: 0x0}, + 1063: {region: 0x166, script: 0x5b, flags: 0x0}, + 1064: {region: 0x166, script: 0x5b, flags: 0x0}, + 1065: {region: 0x116, script: 0x5b, flags: 0x0}, + 1066: {region: 0x166, script: 0x5b, flags: 0x0}, + 1067: {region: 0x166, script: 0x5b, flags: 0x0}, + 1068: {region: 0x124, script: 0xee, flags: 0x0}, + 1069: {region: 0x166, script: 0x5b, flags: 0x0}, + 1070: {region: 0x166, script: 0x5b, flags: 0x0}, + 1071: {region: 0x166, script: 0x5b, flags: 0x0}, + 1072: {region: 0x166, script: 0x5b, flags: 0x0}, + 1073: {region: 0x27, script: 0x5b, flags: 0x0}, 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x99, script: 0xd7, flags: 0x0}, - 1076: {region: 0x116, script: 0x5a, flags: 0x0}, - 1077: {region: 0x114, script: 0x5a, flags: 0x0}, - 1078: {region: 0x99, script: 0x22, flags: 0x0}, - 1079: {region: 0x161, script: 0x5a, flags: 0x0}, - 1080: {region: 0x165, script: 0x5a, flags: 0x0}, - 1081: {region: 0x165, script: 0x5a, flags: 0x0}, - 1082: {region: 0x6d, script: 0x5a, flags: 0x0}, - 1083: {region: 0x161, script: 0x5a, flags: 0x0}, - 1084: {region: 0x165, script: 0x5a, flags: 0x0}, - 1085: {region: 0x60, script: 0x5a, flags: 0x0}, - 1086: {region: 0x95, script: 0x5a, flags: 0x0}, - 1087: {region: 0x165, script: 0x5a, flags: 0x0}, - 1088: {region: 0x165, script: 0x5a, flags: 0x0}, - 1089: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1090: {region: 0x165, script: 0x5a, flags: 0x0}, - 1091: {region: 0x84, script: 0x5a, flags: 0x0}, - 1092: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1093: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1094: {region: 0x15f, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x5a, flags: 0x0}, - 1096: {region: 0x60, script: 0x5a, flags: 0x0}, - 1097: {region: 0x165, script: 0x5a, flags: 0x0}, - 1098: {region: 0x99, script: 0x22, flags: 0x0}, - 1099: {region: 0x95, script: 0x5a, flags: 0x0}, - 1100: {region: 0x165, script: 0x5a, flags: 0x0}, + 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, + 1076: {region: 0x117, script: 0x5b, flags: 0x0}, + 1077: {region: 0x115, script: 0x5b, flags: 0x0}, + 1078: {region: 0x9a, script: 0x22, flags: 0x0}, + 1079: {region: 0x162, script: 0x5b, flags: 0x0}, + 1080: {region: 0x166, script: 0x5b, flags: 0x0}, + 1081: {region: 0x166, script: 0x5b, flags: 0x0}, + 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, + 1083: {region: 0x162, script: 0x5b, flags: 0x0}, + 1084: {region: 0x166, script: 0x5b, flags: 0x0}, + 1085: {region: 0x61, script: 0x5b, flags: 0x0}, + 1086: {region: 0x96, script: 0x5b, flags: 0x0}, + 1087: {region: 0x166, script: 0x5b, flags: 0x0}, + 1088: {region: 0x166, script: 0x5b, flags: 0x0}, + 1089: {region: 0x130, script: 0x5b, flags: 0x0}, + 1090: {region: 0x166, script: 0x5b, flags: 0x0}, + 1091: {region: 0x85, script: 0x5b, flags: 0x0}, + 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1093: {region: 0x130, script: 0x5b, flags: 0x0}, + 1094: {region: 0x160, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, + 1096: {region: 0x61, script: 0x5b, flags: 0x0}, + 1097: {region: 0x166, script: 0x5b, flags: 0x0}, + 1098: {region: 0x9a, script: 0x22, flags: 0x0}, + 1099: {region: 0x96, script: 0x5b, flags: 0x0}, + 1100: {region: 0x166, script: 0x5b, flags: 0x0}, 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9b, script: 0xdb, flags: 0x0}, - 1103: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1104: {region: 0x99, script: 0xe3, flags: 0x0}, - 1105: {region: 0xdb, script: 0x22, flags: 0x0}, - 1106: {region: 0x165, script: 0x5a, flags: 0x0}, - 1107: {region: 0x165, script: 0x5a, flags: 0x0}, - 1108: {region: 0x165, script: 0x5a, flags: 0x0}, - 1109: {region: 0x165, script: 0x5a, flags: 0x0}, - 1110: {region: 0x165, script: 0x5a, flags: 0x0}, - 1111: {region: 0x165, script: 0x5a, flags: 0x0}, - 1112: {region: 0x165, script: 0x5a, flags: 0x0}, - 1113: {region: 0x165, script: 0x5a, flags: 0x0}, - 1114: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1115: {region: 0x165, script: 0x5a, flags: 0x0}, - 1116: {region: 0x165, script: 0x5a, flags: 0x0}, - 1117: {region: 0x99, script: 0x52, flags: 0x0}, - 1118: {region: 0x53, script: 0xe1, flags: 0x0}, - 1119: {region: 0xdb, script: 0x22, flags: 0x0}, - 1120: {region: 0xdb, script: 0x22, flags: 0x0}, - 1121: {region: 0x99, script: 0xe6, flags: 0x0}, - 1122: {region: 0x165, script: 0x5a, flags: 0x0}, - 1123: {region: 0x112, script: 0x5a, flags: 0x0}, - 1124: {region: 0x131, script: 0x5a, flags: 0x0}, - 1125: {region: 0x126, script: 0x5a, flags: 0x0}, - 1126: {region: 0x165, script: 0x5a, flags: 0x0}, + 1102: {region: 0x9c, script: 0xde, flags: 0x0}, + 1103: {region: 0xea, script: 0x5b, flags: 0x0}, + 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, + 1105: {region: 0xdc, script: 0x22, flags: 0x0}, + 1106: {region: 0x166, script: 0x5b, flags: 0x0}, + 1107: {region: 0x166, script: 0x5b, flags: 0x0}, + 1108: {region: 0x166, script: 0x5b, flags: 0x0}, + 1109: {region: 0x166, script: 0x5b, flags: 0x0}, + 1110: {region: 0x166, script: 0x5b, flags: 0x0}, + 1111: {region: 0x166, script: 0x5b, flags: 0x0}, + 1112: {region: 0x166, script: 0x5b, flags: 0x0}, + 1113: {region: 0x166, script: 0x5b, flags: 0x0}, + 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1115: {region: 0x166, script: 0x5b, flags: 0x0}, + 1116: {region: 0x166, script: 0x5b, flags: 0x0}, + 1117: {region: 0x9a, script: 0x53, flags: 0x0}, + 1118: {region: 0x53, script: 0xe4, flags: 0x0}, + 1119: {region: 0xdc, script: 0x22, flags: 0x0}, + 1120: {region: 0xdc, script: 0x22, flags: 0x0}, + 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1122: {region: 0x166, script: 0x5b, flags: 0x0}, + 1123: {region: 0x113, script: 0x5b, flags: 0x0}, + 1124: {region: 0x132, script: 0x5b, flags: 0x0}, + 1125: {region: 0x127, script: 0x5b, flags: 0x0}, + 1126: {region: 0x166, script: 0x5b, flags: 0x0}, 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x165, script: 0x5a, flags: 0x0}, - 1129: {region: 0x165, script: 0x5a, flags: 0x0}, - 1130: {region: 0x165, script: 0x5a, flags: 0x0}, - 1131: {region: 0x123, script: 0xeb, flags: 0x0}, - 1132: {region: 0xdb, script: 0x22, flags: 0x0}, - 1133: {region: 0xdb, script: 0x22, flags: 0x0}, - 1134: {region: 0xdb, script: 0x22, flags: 0x0}, - 1135: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1136: {region: 0x165, script: 0x5a, flags: 0x0}, - 1137: {region: 0x6d, script: 0x2c, flags: 0x0}, - 1138: {region: 0x165, script: 0x5a, flags: 0x0}, - 1139: {region: 0x165, script: 0x5a, flags: 0x0}, - 1140: {region: 0x165, script: 0x5a, flags: 0x0}, - 1141: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1142: {region: 0x127, script: 0x5a, flags: 0x0}, - 1143: {region: 0x125, script: 0x5a, flags: 0x0}, - 1144: {region: 0x32, script: 0x5a, flags: 0x0}, - 1145: {region: 0xdb, script: 0x22, flags: 0x0}, - 1146: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1147: {region: 0x165, script: 0x5a, flags: 0x0}, - 1148: {region: 0x165, script: 0x5a, flags: 0x0}, - 1149: {region: 0x32, script: 0x5a, flags: 0x0}, - 1150: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1151: {region: 0x165, script: 0x5a, flags: 0x0}, - 1152: {region: 0x161, script: 0x5a, flags: 0x0}, - 1153: {region: 0x165, script: 0x5a, flags: 0x0}, - 1154: {region: 0x129, script: 0x5a, flags: 0x0}, - 1155: {region: 0x165, script: 0x5a, flags: 0x0}, - 1156: {region: 0xce, script: 0x5a, flags: 0x0}, - 1157: {region: 0x165, script: 0x5a, flags: 0x0}, - 1158: {region: 0xe6, script: 0x5a, flags: 0x0}, - 1159: {region: 0x165, script: 0x5a, flags: 0x0}, - 1160: {region: 0x165, script: 0x5a, flags: 0x0}, - 1161: {region: 0x165, script: 0x5a, flags: 0x0}, - 1162: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1163: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1164: {region: 0x12e, script: 0x5a, flags: 0x0}, - 1165: {region: 0x165, script: 0x5, flags: 0x0}, - 1166: {region: 0x161, script: 0x5a, flags: 0x0}, - 1167: {region: 0x87, script: 0x34, flags: 0x0}, - 1168: {region: 0xdb, script: 0x22, flags: 0x0}, - 1169: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1170: {region: 0x43, script: 0xec, flags: 0x0}, - 1171: {region: 0x165, script: 0x5a, flags: 0x0}, - 1172: {region: 0x106, script: 0x20, flags: 0x0}, - 1173: {region: 0x165, script: 0x5a, flags: 0x0}, - 1174: {region: 0x165, script: 0x5a, flags: 0x0}, - 1175: {region: 0x131, script: 0x5a, flags: 0x0}, - 1176: {region: 0x165, script: 0x5a, flags: 0x0}, - 1177: {region: 0x123, script: 0xeb, flags: 0x0}, - 1178: {region: 0x32, script: 0x5a, flags: 0x0}, - 1179: {region: 0x165, script: 0x5a, flags: 0x0}, - 1180: {region: 0x165, script: 0x5a, flags: 0x0}, - 1181: {region: 0xce, script: 0x5a, flags: 0x0}, - 1182: {region: 0x165, script: 0x5a, flags: 0x0}, - 1183: {region: 0x165, script: 0x5a, flags: 0x0}, - 1184: {region: 0x12d, script: 0x5a, flags: 0x0}, - 1185: {region: 0x165, script: 0x5a, flags: 0x0}, - 1187: {region: 0x165, script: 0x5a, flags: 0x0}, - 1188: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1189: {region: 0x53, script: 0xe4, flags: 0x0}, - 1190: {region: 0xe5, script: 0x5a, flags: 0x0}, - 1191: {region: 0x165, script: 0x5a, flags: 0x0}, - 1192: {region: 0x106, script: 0x20, flags: 0x0}, - 1193: {region: 0xba, script: 0x5a, flags: 0x0}, - 1194: {region: 0x165, script: 0x5a, flags: 0x0}, - 1195: {region: 0x106, script: 0x20, flags: 0x0}, + 1128: {region: 0x166, script: 0x5b, flags: 0x0}, + 1129: {region: 0x166, script: 0x5b, flags: 0x0}, + 1130: {region: 0x166, script: 0x5b, flags: 0x0}, + 1131: {region: 0x124, script: 0xee, flags: 0x0}, + 1132: {region: 0xdc, script: 0x22, flags: 0x0}, + 1133: {region: 0xdc, script: 0x22, flags: 0x0}, + 1134: {region: 0xdc, script: 0x22, flags: 0x0}, + 1135: {region: 0x70, script: 0x2c, flags: 0x0}, + 1136: {region: 0x166, script: 0x5b, flags: 0x0}, + 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, + 1138: {region: 0x166, script: 0x5b, flags: 0x0}, + 1139: {region: 0x166, script: 0x5b, flags: 0x0}, + 1140: {region: 0x166, script: 0x5b, flags: 0x0}, + 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1142: {region: 0x128, script: 0x5b, flags: 0x0}, + 1143: {region: 0x126, script: 0x5b, flags: 0x0}, + 1144: {region: 0x32, script: 0x5b, flags: 0x0}, + 1145: {region: 0xdc, script: 0x22, flags: 0x0}, + 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1147: {region: 0x166, script: 0x5b, flags: 0x0}, + 1148: {region: 0x166, script: 0x5b, flags: 0x0}, + 1149: {region: 0x32, script: 0x5b, flags: 0x0}, + 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1151: {region: 0x166, script: 0x5b, flags: 0x0}, + 1152: {region: 0x162, script: 0x5b, flags: 0x0}, + 1153: {region: 0x166, script: 0x5b, flags: 0x0}, + 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1155: {region: 0x166, script: 0x5b, flags: 0x0}, + 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1157: {region: 0x166, script: 0x5b, flags: 0x0}, + 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, + 1159: {region: 0x166, script: 0x5b, flags: 0x0}, + 1160: {region: 0x166, script: 0x5b, flags: 0x0}, + 1161: {region: 0x166, script: 0x5b, flags: 0x0}, + 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, + 1165: {region: 0x166, script: 0x5, flags: 0x0}, + 1166: {region: 0x162, script: 0x5b, flags: 0x0}, + 1167: {region: 0x88, script: 0x34, flags: 0x0}, + 1168: {region: 0xdc, script: 0x22, flags: 0x0}, + 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1170: {region: 0x43, script: 0xef, flags: 0x0}, + 1171: {region: 0x166, script: 0x5b, flags: 0x0}, + 1172: {region: 0x107, script: 0x20, flags: 0x0}, + 1173: {region: 0x166, script: 0x5b, flags: 0x0}, + 1174: {region: 0x166, script: 0x5b, flags: 0x0}, + 1175: {region: 0x132, script: 0x5b, flags: 0x0}, + 1176: {region: 0x166, script: 0x5b, flags: 0x0}, + 1177: {region: 0x124, script: 0xee, flags: 0x0}, + 1178: {region: 0x32, script: 0x5b, flags: 0x0}, + 1179: {region: 0x166, script: 0x5b, flags: 0x0}, + 1180: {region: 0x166, script: 0x5b, flags: 0x0}, + 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1182: {region: 0x166, script: 0x5b, flags: 0x0}, + 1183: {region: 0x166, script: 0x5b, flags: 0x0}, + 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, + 1185: {region: 0x166, script: 0x5b, flags: 0x0}, + 1187: {region: 0x166, script: 0x5b, flags: 0x0}, + 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1189: {region: 0x53, script: 0xe7, flags: 0x0}, + 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, + 1191: {region: 0x166, script: 0x5b, flags: 0x0}, + 1192: {region: 0x107, script: 0x20, flags: 0x0}, + 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, + 1194: {region: 0x166, script: 0x5b, flags: 0x0}, + 1195: {region: 0x107, script: 0x20, flags: 0x0}, 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11c, script: 0xf0, flags: 0x0}, - 1198: {region: 0x130, script: 0x20, flags: 0x0}, - 1199: {region: 0x75, script: 0x5a, flags: 0x0}, - 1200: {region: 0x2a, script: 0x5a, flags: 0x0}, + 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, + 1198: {region: 0x131, script: 0x20, flags: 0x0}, + 1199: {region: 0x76, script: 0x5b, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x99, script: 0xe, flags: 0x0}, - 1204: {region: 0xe8, script: 0x5, flags: 0x0}, - 1205: {region: 0x165, script: 0x5a, flags: 0x0}, - 1206: {region: 0x165, script: 0x5a, flags: 0x0}, - 1207: {region: 0x165, script: 0x5a, flags: 0x0}, - 1208: {region: 0x165, script: 0x5a, flags: 0x0}, - 1209: {region: 0x165, script: 0x5a, flags: 0x0}, - 1210: {region: 0x165, script: 0x5a, flags: 0x0}, - 1211: {region: 0x165, script: 0x5a, flags: 0x0}, + 1203: {region: 0x9a, script: 0xe, flags: 0x0}, + 1204: {region: 0xe9, script: 0x5, flags: 0x0}, + 1205: {region: 0x166, script: 0x5b, flags: 0x0}, + 1206: {region: 0x166, script: 0x5b, flags: 0x0}, + 1207: {region: 0x166, script: 0x5b, flags: 0x0}, + 1208: {region: 0x166, script: 0x5b, flags: 0x0}, + 1209: {region: 0x166, script: 0x5b, flags: 0x0}, + 1210: {region: 0x166, script: 0x5b, flags: 0x0}, + 1211: {region: 0x166, script: 0x5b, flags: 0x0}, 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x165, script: 0x5a, flags: 0x0}, - 1214: {region: 0xb4, script: 0xf1, flags: 0x0}, - 1215: {region: 0x165, script: 0x5a, flags: 0x0}, - 1216: {region: 0x161, script: 0x5a, flags: 0x0}, - 1217: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1218: {region: 0x106, script: 0x5a, flags: 0x0}, - 1219: {region: 0x13e, script: 0x5a, flags: 0x0}, - 1220: {region: 0x11b, script: 0x5a, flags: 0x0}, - 1221: {region: 0x165, script: 0x5a, flags: 0x0}, - 1222: {region: 0x36, script: 0x5a, flags: 0x0}, - 1223: {region: 0x60, script: 0x5a, flags: 0x0}, - 1224: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1225: {region: 0x1, script: 0x5a, flags: 0x0}, - 1226: {region: 0x106, script: 0x5a, flags: 0x0}, - 1227: {region: 0x6a, script: 0x5a, flags: 0x0}, - 1228: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1229: {region: 0x165, script: 0x5a, flags: 0x0}, - 1230: {region: 0x36, script: 0x5a, flags: 0x0}, - 1231: {region: 0x4e, script: 0x5a, flags: 0x0}, - 1232: {region: 0x165, script: 0x5a, flags: 0x0}, - 1233: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1234: {region: 0x165, script: 0x5a, flags: 0x0}, - 1235: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1236: {region: 0x2f, script: 0x5a, flags: 0x0}, - 1237: {region: 0x99, script: 0xe6, flags: 0x0}, - 1238: {region: 0x99, script: 0x22, flags: 0x0}, - 1239: {region: 0x165, script: 0x5a, flags: 0x0}, - 1240: {region: 0x165, script: 0x5a, flags: 0x0}, - 1241: {region: 0x165, script: 0x5a, flags: 0x0}, - 1242: {region: 0x165, script: 0x5a, flags: 0x0}, - 1243: {region: 0x165, script: 0x5a, flags: 0x0}, - 1244: {region: 0x165, script: 0x5a, flags: 0x0}, - 1245: {region: 0x165, script: 0x5a, flags: 0x0}, - 1246: {region: 0x165, script: 0x5a, flags: 0x0}, - 1247: {region: 0x165, script: 0x5a, flags: 0x0}, - 1248: {region: 0x140, script: 0x5a, flags: 0x0}, - 1249: {region: 0x165, script: 0x5a, flags: 0x0}, - 1250: {region: 0x165, script: 0x5a, flags: 0x0}, - 1251: {region: 0xa8, script: 0x5, flags: 0x0}, - 1252: {region: 0x165, script: 0x5a, flags: 0x0}, - 1253: {region: 0x114, script: 0x5a, flags: 0x0}, - 1254: {region: 0x165, script: 0x5a, flags: 0x0}, - 1255: {region: 0x165, script: 0x5a, flags: 0x0}, - 1256: {region: 0x165, script: 0x5a, flags: 0x0}, - 1257: {region: 0x165, script: 0x5a, flags: 0x0}, - 1258: {region: 0x99, script: 0x22, flags: 0x0}, + 1213: {region: 0x166, script: 0x5b, flags: 0x0}, + 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, + 1215: {region: 0x166, script: 0x5b, flags: 0x0}, + 1216: {region: 0x162, script: 0x5b, flags: 0x0}, + 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1218: {region: 0x107, script: 0x5b, flags: 0x0}, + 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, + 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, + 1221: {region: 0x166, script: 0x5b, flags: 0x0}, + 1222: {region: 0x36, script: 0x5b, flags: 0x0}, + 1223: {region: 0x61, script: 0x5b, flags: 0x0}, + 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1225: {region: 0x1, script: 0x5b, flags: 0x0}, + 1226: {region: 0x107, script: 0x5b, flags: 0x0}, + 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, + 1228: {region: 0x130, script: 0x5b, flags: 0x0}, + 1229: {region: 0x166, script: 0x5b, flags: 0x0}, + 1230: {region: 0x36, script: 0x5b, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, + 1232: {region: 0x166, script: 0x5b, flags: 0x0}, + 1233: {region: 0x70, script: 0x2c, flags: 0x0}, + 1234: {region: 0x166, script: 0x5b, flags: 0x0}, + 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, + 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1238: {region: 0x9a, script: 0x22, flags: 0x0}, + 1239: {region: 0x166, script: 0x5b, flags: 0x0}, + 1240: {region: 0x166, script: 0x5b, flags: 0x0}, + 1241: {region: 0x166, script: 0x5b, flags: 0x0}, + 1242: {region: 0x166, script: 0x5b, flags: 0x0}, + 1243: {region: 0x166, script: 0x5b, flags: 0x0}, + 1244: {region: 0x166, script: 0x5b, flags: 0x0}, + 1245: {region: 0x166, script: 0x5b, flags: 0x0}, + 1246: {region: 0x166, script: 0x5b, flags: 0x0}, + 1247: {region: 0x166, script: 0x5b, flags: 0x0}, + 1248: {region: 0x141, script: 0x5b, flags: 0x0}, + 1249: {region: 0x166, script: 0x5b, flags: 0x0}, + 1250: {region: 0x166, script: 0x5b, flags: 0x0}, + 1251: {region: 0xa9, script: 0x5, flags: 0x0}, + 1252: {region: 0x166, script: 0x5b, flags: 0x0}, + 1253: {region: 0x115, script: 0x5b, flags: 0x0}, + 1254: {region: 0x166, script: 0x5b, flags: 0x0}, + 1255: {region: 0x166, script: 0x5b, flags: 0x0}, + 1256: {region: 0x166, script: 0x5b, flags: 0x0}, + 1257: {region: 0x166, script: 0x5b, flags: 0x0}, + 1258: {region: 0x9a, script: 0x22, flags: 0x0}, 1259: {region: 0x53, script: 0x3b, flags: 0x0}, - 1260: {region: 0x165, script: 0x5a, flags: 0x0}, - 1261: {region: 0x165, script: 0x5a, flags: 0x0}, - 1262: {region: 0x41, script: 0x5a, flags: 0x0}, - 1263: {region: 0x165, script: 0x5a, flags: 0x0}, - 1264: {region: 0x12b, script: 0x18, flags: 0x0}, - 1265: {region: 0x165, script: 0x5a, flags: 0x0}, - 1266: {region: 0x161, script: 0x5a, flags: 0x0}, - 1267: {region: 0x165, script: 0x5a, flags: 0x0}, - 1268: {region: 0x12b, script: 0x62, flags: 0x0}, - 1269: {region: 0x12b, script: 0x63, flags: 0x0}, - 1270: {region: 0x7d, script: 0x2e, flags: 0x0}, - 1271: {region: 0x53, script: 0x67, flags: 0x0}, - 1272: {region: 0x10b, script: 0x6c, flags: 0x0}, - 1273: {region: 0x108, script: 0x77, flags: 0x0}, - 1274: {region: 0x99, script: 0x22, flags: 0x0}, - 1275: {region: 0x131, script: 0x5a, flags: 0x0}, - 1276: {region: 0x165, script: 0x5a, flags: 0x0}, - 1277: {region: 0x9c, script: 0x91, flags: 0x0}, - 1278: {region: 0x165, script: 0x5a, flags: 0x0}, - 1279: {region: 0x15e, script: 0xcc, flags: 0x0}, - 1280: {region: 0x165, script: 0x5a, flags: 0x0}, - 1281: {region: 0x165, script: 0x5a, flags: 0x0}, - 1282: {region: 0xdb, script: 0x22, flags: 0x0}, - 1283: {region: 0x165, script: 0x5a, flags: 0x0}, - 1284: {region: 0x165, script: 0x5a, flags: 0x0}, - 1285: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1286: {region: 0x75, script: 0x5a, flags: 0x0}, - 1287: {region: 0x165, script: 0x5a, flags: 0x0}, - 1288: {region: 0x165, script: 0x5a, flags: 0x0}, - 1289: {region: 0x52, script: 0x5a, flags: 0x0}, - 1290: {region: 0x165, script: 0x5a, flags: 0x0}, - 1291: {region: 0x165, script: 0x5a, flags: 0x0}, - 1292: {region: 0x165, script: 0x5a, flags: 0x0}, - 1293: {region: 0x52, script: 0x5a, flags: 0x0}, - 1294: {region: 0x165, script: 0x5a, flags: 0x0}, - 1295: {region: 0x165, script: 0x5a, flags: 0x0}, - 1296: {region: 0x165, script: 0x5a, flags: 0x0}, - 1297: {region: 0x165, script: 0x5a, flags: 0x0}, + 1260: {region: 0x166, script: 0x5b, flags: 0x0}, + 1261: {region: 0x166, script: 0x5b, flags: 0x0}, + 1262: {region: 0x41, script: 0x5b, flags: 0x0}, + 1263: {region: 0x166, script: 0x5b, flags: 0x0}, + 1264: {region: 0x12c, script: 0x18, flags: 0x0}, + 1265: {region: 0x166, script: 0x5b, flags: 0x0}, + 1266: {region: 0x162, script: 0x5b, flags: 0x0}, + 1267: {region: 0x166, script: 0x5b, flags: 0x0}, + 1268: {region: 0x12c, script: 0x63, flags: 0x0}, + 1269: {region: 0x12c, script: 0x64, flags: 0x0}, + 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x68, flags: 0x0}, + 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, + 1273: {region: 0x109, script: 0x79, flags: 0x0}, + 1274: {region: 0x9a, script: 0x22, flags: 0x0}, + 1275: {region: 0x132, script: 0x5b, flags: 0x0}, + 1276: {region: 0x166, script: 0x5b, flags: 0x0}, + 1277: {region: 0x9d, script: 0x93, flags: 0x0}, + 1278: {region: 0x166, script: 0x5b, flags: 0x0}, + 1279: {region: 0x15f, script: 0xce, flags: 0x0}, + 1280: {region: 0x166, script: 0x5b, flags: 0x0}, + 1281: {region: 0x166, script: 0x5b, flags: 0x0}, + 1282: {region: 0xdc, script: 0x22, flags: 0x0}, + 1283: {region: 0x166, script: 0x5b, flags: 0x0}, + 1284: {region: 0x166, script: 0x5b, flags: 0x0}, + 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1286: {region: 0x76, script: 0x5b, flags: 0x0}, + 1287: {region: 0x166, script: 0x5b, flags: 0x0}, + 1288: {region: 0x166, script: 0x5b, flags: 0x0}, + 1289: {region: 0x52, script: 0x5b, flags: 0x0}, + 1290: {region: 0x166, script: 0x5b, flags: 0x0}, + 1291: {region: 0x166, script: 0x5b, flags: 0x0}, + 1292: {region: 0x166, script: 0x5b, flags: 0x0}, + 1293: {region: 0x52, script: 0x5b, flags: 0x0}, + 1294: {region: 0x166, script: 0x5b, flags: 0x0}, + 1295: {region: 0x166, script: 0x5b, flags: 0x0}, + 1296: {region: 0x166, script: 0x5b, flags: 0x0}, + 1297: {region: 0x166, script: 0x5b, flags: 0x0}, 1298: {region: 0x1, script: 0x3e, flags: 0x0}, - 1299: {region: 0x165, script: 0x5a, flags: 0x0}, - 1300: {region: 0x165, script: 0x5a, flags: 0x0}, - 1301: {region: 0x165, script: 0x5a, flags: 0x0}, - 1302: {region: 0x165, script: 0x5a, flags: 0x0}, - 1303: {region: 0x165, script: 0x5a, flags: 0x0}, - 1304: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1305: {region: 0x165, script: 0x5a, flags: 0x0}, - 1306: {region: 0x165, script: 0x5a, flags: 0x0}, - 1307: {region: 0x165, script: 0x5a, flags: 0x0}, - 1308: {region: 0x41, script: 0x5a, flags: 0x0}, - 1309: {region: 0x165, script: 0x5a, flags: 0x0}, - 1310: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1299: {region: 0x166, script: 0x5b, flags: 0x0}, + 1300: {region: 0x166, script: 0x5b, flags: 0x0}, + 1301: {region: 0x166, script: 0x5b, flags: 0x0}, + 1302: {region: 0x166, script: 0x5b, flags: 0x0}, + 1303: {region: 0x166, script: 0x5b, flags: 0x0}, + 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1305: {region: 0x166, script: 0x5b, flags: 0x0}, + 1306: {region: 0x166, script: 0x5b, flags: 0x0}, + 1307: {region: 0x166, script: 0x5b, flags: 0x0}, + 1308: {region: 0x41, script: 0x5b, flags: 0x0}, + 1309: {region: 0x166, script: 0x5b, flags: 0x0}, + 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x165, script: 0x5a, flags: 0x0}, - 1313: {region: 0x165, script: 0x5a, flags: 0x0}, - 1314: {region: 0x165, script: 0x5a, flags: 0x0}, - 1315: {region: 0x53, script: 0x5a, flags: 0x0}, - 1316: {region: 0x10b, script: 0x5a, flags: 0x0}, - 1318: {region: 0xa8, script: 0x5, flags: 0x0}, - 1319: {region: 0xd9, script: 0x5a, flags: 0x0}, - 1320: {region: 0xba, script: 0xe8, flags: 0x0}, + 1312: {region: 0x166, script: 0x5b, flags: 0x0}, + 1313: {region: 0x166, script: 0x5b, flags: 0x0}, + 1314: {region: 0x166, script: 0x5b, flags: 0x0}, + 1315: {region: 0x53, script: 0x5b, flags: 0x0}, + 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, + 1318: {region: 0xa9, script: 0x5, flags: 0x0}, + 1319: {region: 0xda, script: 0x5b, flags: 0x0}, + 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x7d, flags: 0x0}, - 1323: {region: 0x165, script: 0x5a, flags: 0x0}, - 1324: {region: 0x122, script: 0x5a, flags: 0x0}, - 1325: {region: 0xd0, script: 0x5a, flags: 0x0}, - 1326: {region: 0x165, script: 0x5a, flags: 0x0}, - 1327: {region: 0x161, script: 0x5a, flags: 0x0}, - 1329: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1322: {region: 0x53, script: 0x7f, flags: 0x0}, + 1323: {region: 0x166, script: 0x5b, flags: 0x0}, + 1324: {region: 0x123, script: 0x5b, flags: 0x0}, + 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, + 1326: {region: 0x166, script: 0x5b, flags: 0x0}, + 1327: {region: 0x162, script: 0x5b, flags: 0x0}, + 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, } // likelyLangList holds lists info associated with likelyLang. // Size: 582 bytes, 97 elements var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9c, script: 0x7, flags: 0x0}, - 1: {region: 0xa1, script: 0x78, flags: 0x2}, - 2: {region: 0x11c, script: 0x85, flags: 0x2}, - 3: {region: 0x32, script: 0x5a, flags: 0x0}, - 4: {region: 0x9b, script: 0x5, flags: 0x4}, - 5: {region: 0x9c, script: 0x5, flags: 0x4}, - 6: {region: 0x106, script: 0x20, flags: 0x4}, - 7: {region: 0x9c, script: 0x5, flags: 0x2}, - 8: {region: 0x106, script: 0x20, flags: 0x0}, + 0: {region: 0x9d, script: 0x7, flags: 0x0}, + 1: {region: 0xa2, script: 0x7a, flags: 0x2}, + 2: {region: 0x11d, script: 0x87, flags: 0x2}, + 3: {region: 0x32, script: 0x5b, flags: 0x0}, + 4: {region: 0x9c, script: 0x5, flags: 0x4}, + 5: {region: 0x9d, script: 0x5, flags: 0x4}, + 6: {region: 0x107, script: 0x20, flags: 0x4}, + 7: {region: 0x9d, script: 0x5, flags: 0x2}, + 8: {region: 0x107, script: 0x20, flags: 0x0}, 9: {region: 0x38, script: 0x2f, flags: 0x2}, - 10: {region: 0x135, script: 0x5a, flags: 0x0}, - 11: {region: 0x7b, script: 0xcf, flags: 0x2}, - 12: {region: 0x114, script: 0x5a, flags: 0x0}, - 13: {region: 0x84, script: 0x1, flags: 0x2}, - 14: {region: 0x5d, script: 0x1f, flags: 0x0}, - 15: {region: 0x87, script: 0x5f, flags: 0x2}, - 16: {region: 0xd6, script: 0x5a, flags: 0x0}, + 10: {region: 0x136, script: 0x5b, flags: 0x0}, + 11: {region: 0x7c, script: 0xd1, flags: 0x2}, + 12: {region: 0x115, script: 0x5b, flags: 0x0}, + 13: {region: 0x85, script: 0x1, flags: 0x2}, + 14: {region: 0x5e, script: 0x1f, flags: 0x0}, + 15: {region: 0x88, script: 0x60, flags: 0x2}, + 16: {region: 0xd7, script: 0x5b, flags: 0x0}, 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10b, script: 0x5, flags: 0x4}, - 19: {region: 0xae, script: 0x20, flags: 0x0}, + 18: {region: 0x10c, script: 0x5, flags: 0x4}, + 19: {region: 0xaf, script: 0x20, flags: 0x0}, 20: {region: 0x24, script: 0x5, flags: 0x4}, 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9c, script: 0x5, flags: 0x4}, - 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 22: {region: 0x9d, script: 0x5, flags: 0x4}, + 23: {region: 0xc6, script: 0x5, flags: 0x4}, 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12b, script: 0x5a, flags: 0x0}, - 26: {region: 0xb0, script: 0x5, flags: 0x4}, - 27: {region: 0x9b, script: 0x5, flags: 0x2}, - 28: {region: 0xa5, script: 0x20, flags: 0x0}, + 25: {region: 0x12c, script: 0x5b, flags: 0x0}, + 26: {region: 0xb1, script: 0x5, flags: 0x4}, + 27: {region: 0x9c, script: 0x5, flags: 0x2}, + 28: {region: 0xa6, script: 0x20, flags: 0x0}, 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12b, script: 0x5a, flags: 0x4}, + 30: {region: 0x12c, script: 0x5b, flags: 0x4}, 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12b, script: 0x5a, flags: 0x2}, - 33: {region: 0xdb, script: 0x22, flags: 0x0}, - 34: {region: 0x99, script: 0x5d, flags: 0x2}, - 35: {region: 0x83, script: 0x5a, flags: 0x0}, - 36: {region: 0x84, script: 0x7c, flags: 0x4}, - 37: {region: 0x84, script: 0x7c, flags: 0x2}, - 38: {region: 0xc5, script: 0x20, flags: 0x0}, - 39: {region: 0x53, script: 0x70, flags: 0x4}, - 40: {region: 0x53, script: 0x70, flags: 0x2}, - 41: {region: 0xd0, script: 0x5a, flags: 0x0}, + 32: {region: 0x12c, script: 0x5b, flags: 0x2}, + 33: {region: 0xdc, script: 0x22, flags: 0x0}, + 34: {region: 0x9a, script: 0x5e, flags: 0x2}, + 35: {region: 0x84, script: 0x5b, flags: 0x0}, + 36: {region: 0x85, script: 0x7e, flags: 0x4}, + 37: {region: 0x85, script: 0x7e, flags: 0x2}, + 38: {region: 0xc6, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x71, flags: 0x4}, + 40: {region: 0x53, script: 0x71, flags: 0x2}, + 41: {region: 0xd1, script: 0x5b, flags: 0x0}, 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x95, script: 0x5, flags: 0x4}, - 44: {region: 0x99, script: 0x36, flags: 0x0}, - 45: {region: 0xe8, script: 0x5, flags: 0x4}, - 46: {region: 0xe8, script: 0x5, flags: 0x2}, - 47: {region: 0x9c, script: 0x8b, flags: 0x0}, - 48: {region: 0x53, script: 0x8c, flags: 0x2}, - 49: {region: 0xba, script: 0xe8, flags: 0x0}, - 50: {region: 0xd9, script: 0x5a, flags: 0x4}, - 51: {region: 0xe8, script: 0x5, flags: 0x0}, - 52: {region: 0x99, script: 0x22, flags: 0x2}, - 53: {region: 0x99, script: 0x4f, flags: 0x2}, - 54: {region: 0x99, script: 0xd3, flags: 0x2}, - 55: {region: 0x105, script: 0x20, flags: 0x0}, - 56: {region: 0xbd, script: 0x5a, flags: 0x4}, - 57: {region: 0x104, script: 0x5a, flags: 0x4}, - 58: {region: 0x106, script: 0x5a, flags: 0x4}, - 59: {region: 0x12b, script: 0x5a, flags: 0x4}, - 60: {region: 0x124, script: 0x20, flags: 0x0}, - 61: {region: 0xe8, script: 0x5, flags: 0x4}, - 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 43: {region: 0x96, script: 0x5, flags: 0x4}, + 44: {region: 0x9a, script: 0x36, flags: 0x0}, + 45: {region: 0xe9, script: 0x5, flags: 0x4}, + 46: {region: 0xe9, script: 0x5, flags: 0x2}, + 47: {region: 0x9d, script: 0x8d, flags: 0x0}, + 48: {region: 0x53, script: 0x8e, flags: 0x2}, + 49: {region: 0xbb, script: 0xeb, flags: 0x0}, + 50: {region: 0xda, script: 0x5b, flags: 0x4}, + 51: {region: 0xe9, script: 0x5, flags: 0x0}, + 52: {region: 0x9a, script: 0x22, flags: 0x2}, + 53: {region: 0x9a, script: 0x50, flags: 0x2}, + 54: {region: 0x9a, script: 0xd5, flags: 0x2}, + 55: {region: 0x106, script: 0x20, flags: 0x0}, + 56: {region: 0xbe, script: 0x5b, flags: 0x4}, + 57: {region: 0x105, script: 0x5b, flags: 0x4}, + 58: {region: 0x107, script: 0x5b, flags: 0x4}, + 59: {region: 0x12c, script: 0x5b, flags: 0x4}, + 60: {region: 0x125, script: 0x20, flags: 0x0}, + 61: {region: 0xe9, script: 0x5, flags: 0x4}, + 62: {region: 0xe9, script: 0x5, flags: 0x2}, 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xae, script: 0x20, flags: 0x4}, - 65: {region: 0xc5, script: 0x20, flags: 0x4}, - 66: {region: 0xae, script: 0x20, flags: 0x2}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0xdb, script: 0x22, flags: 0x4}, - 69: {region: 0xdb, script: 0x22, flags: 0x2}, - 70: {region: 0x137, script: 0x5a, flags: 0x0}, + 64: {region: 0xaf, script: 0x20, flags: 0x4}, + 65: {region: 0xc6, script: 0x20, flags: 0x4}, + 66: {region: 0xaf, script: 0x20, flags: 0x2}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0xdc, script: 0x22, flags: 0x4}, + 69: {region: 0xdc, script: 0x22, flags: 0x2}, + 70: {region: 0x138, script: 0x5b, flags: 0x0}, 71: {region: 0x24, script: 0x5, flags: 0x4}, 72: {region: 0x53, script: 0x20, flags: 0x4}, 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8d, script: 0x3c, flags: 0x0}, + 74: {region: 0x8e, script: 0x3c, flags: 0x0}, 75: {region: 0x53, script: 0x3b, flags: 0x4}, 76: {region: 0x53, script: 0x3b, flags: 0x2}, 77: {region: 0x53, script: 0x3b, flags: 0x0}, 78: {region: 0x2f, script: 0x3c, flags: 0x4}, 79: {region: 0x3e, script: 0x3c, flags: 0x4}, - 80: {region: 0x7b, script: 0x3c, flags: 0x4}, - 81: {region: 0x7e, script: 0x3c, flags: 0x4}, - 82: {region: 0x8d, script: 0x3c, flags: 0x4}, - 83: {region: 0x95, script: 0x3c, flags: 0x4}, - 84: {region: 0xc6, script: 0x3c, flags: 0x4}, - 85: {region: 0xd0, script: 0x3c, flags: 0x4}, - 86: {region: 0xe2, script: 0x3c, flags: 0x4}, - 87: {region: 0xe5, script: 0x3c, flags: 0x4}, - 88: {region: 0xe7, script: 0x3c, flags: 0x4}, - 89: {region: 0x116, script: 0x3c, flags: 0x4}, - 90: {region: 0x123, script: 0x3c, flags: 0x4}, - 91: {region: 0x12e, script: 0x3c, flags: 0x4}, - 92: {region: 0x135, script: 0x3c, flags: 0x4}, - 93: {region: 0x13e, script: 0x3c, flags: 0x4}, - 94: {region: 0x12e, script: 0x11, flags: 0x2}, - 95: {region: 0x12e, script: 0x37, flags: 0x2}, - 96: {region: 0x12e, script: 0x3c, flags: 0x2}, + 80: {region: 0x7c, script: 0x3c, flags: 0x4}, + 81: {region: 0x7f, script: 0x3c, flags: 0x4}, + 82: {region: 0x8e, script: 0x3c, flags: 0x4}, + 83: {region: 0x96, script: 0x3c, flags: 0x4}, + 84: {region: 0xc7, script: 0x3c, flags: 0x4}, + 85: {region: 0xd1, script: 0x3c, flags: 0x4}, + 86: {region: 0xe3, script: 0x3c, flags: 0x4}, + 87: {region: 0xe6, script: 0x3c, flags: 0x4}, + 88: {region: 0xe8, script: 0x3c, flags: 0x4}, + 89: {region: 0x117, script: 0x3c, flags: 0x4}, + 90: {region: 0x124, script: 0x3c, flags: 0x4}, + 91: {region: 0x12f, script: 0x3c, flags: 0x4}, + 92: {region: 0x136, script: 0x3c, flags: 0x4}, + 93: {region: 0x13f, script: 0x3c, flags: 0x4}, + 94: {region: 0x12f, script: 0x11, flags: 0x2}, + 95: {region: 0x12f, script: 0x37, flags: 0x2}, + 96: {region: 0x12f, script: 0x3c, flags: 0x2}, } type likelyLangScript struct { @@ -2987,306 +3009,306 @@ type likelyLangScript struct { // for a given regionID, lang and script are the index and size respectively // of the list in likelyRegionList. // TODO: exclude containers and user-definable regions from the list. -// Size: 2148 bytes, 358 elements -var likelyRegion = [358]likelyLangScript{ - 34: {lang: 0xd7, script: 0x5a, flags: 0x0}, +// Size: 2154 bytes, 359 elements +var likelyRegion = [359]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, 35: {lang: 0x3a, script: 0x5, flags: 0x0}, 36: {lang: 0x0, script: 0x2, flags: 0x1}, 39: {lang: 0x2, script: 0x2, flags: 0x1}, 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 43: {lang: 0x0, script: 0x5a, flags: 0x0}, - 44: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 45: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 46: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 48: {lang: 0x367, script: 0x5a, flags: 0x0}, - 49: {lang: 0x444, script: 0x5a, flags: 0x0}, - 50: {lang: 0x58, script: 0x5a, flags: 0x0}, + 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 43: {lang: 0x0, script: 0x5b, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 48: {lang: 0x367, script: 0x5b, flags: 0x0}, + 49: {lang: 0x444, script: 0x5b, flags: 0x0}, + 50: {lang: 0x58, script: 0x5b, flags: 0x0}, 51: {lang: 0x6, script: 0x2, flags: 0x1}, 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x5a, flags: 0x0}, - 55: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 54: {lang: 0x367, script: 0x5b, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, 56: {lang: 0x7e, script: 0x20, flags: 0x0}, 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x5a, flags: 0x0}, - 59: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 60: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 62: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 63: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x5a, flags: 0x0}, + 69: {lang: 0x0, script: 0x5b, flags: 0x0}, 71: {lang: 0x71, script: 0x20, flags: 0x0}, 73: {lang: 0x512, script: 0x3e, flags: 0x2}, 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x5a, flags: 0x0}, - 76: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 77: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 78: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 81: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 82: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 75: {lang: 0x445, script: 0x5b, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 85: {lang: 0x0, script: 0x5a, flags: 0x0}, - 86: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 89: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 90: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 91: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 93: {lang: 0xe, script: 0x2, flags: 0x1}, - 94: {lang: 0xfa, script: 0x5a, flags: 0x0}, - 96: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 98: {lang: 0x1, script: 0x5a, flags: 0x0}, - 99: {lang: 0x101, script: 0x5a, flags: 0x0}, - 101: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 103: {lang: 0x10, script: 0x2, flags: 0x1}, - 104: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 105: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 106: {lang: 0x140, script: 0x5a, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 85: {lang: 0x0, script: 0x5b, flags: 0x0}, + 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 94: {lang: 0xe, script: 0x2, flags: 0x1}, + 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, + 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 99: {lang: 0x1, script: 0x5b, flags: 0x0}, + 100: {lang: 0x101, script: 0x5b, flags: 0x0}, + 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 104: {lang: 0x10, script: 0x2, flags: 0x1}, + 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 107: {lang: 0x140, script: 0x5b, flags: 0x0}, 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x46f, script: 0x2c, flags: 0x0}, - 110: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 111: {lang: 0x12, script: 0x2, flags: 0x1}, - 113: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 114: {lang: 0x151, script: 0x5a, flags: 0x0}, - 115: {lang: 0x1c0, script: 0x22, flags: 0x2}, - 118: {lang: 0x158, script: 0x5a, flags: 0x0}, - 120: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 122: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 123: {lang: 0x14, script: 0x2, flags: 0x1}, - 125: {lang: 0x16, script: 0x3, flags: 0x1}, - 126: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 128: {lang: 0x21, script: 0x5a, flags: 0x0}, - 130: {lang: 0x245, script: 0x5a, flags: 0x0}, - 132: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 133: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 134: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 135: {lang: 0x19, script: 0x2, flags: 0x1}, - 136: {lang: 0x0, script: 0x5a, flags: 0x0}, - 137: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 139: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 141: {lang: 0x529, script: 0x3c, flags: 0x0}, - 142: {lang: 0x0, script: 0x5a, flags: 0x0}, - 143: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 144: {lang: 0x1d1, script: 0x5a, flags: 0x0}, - 145: {lang: 0x1d4, script: 0x5a, flags: 0x0}, - 146: {lang: 0x1d5, script: 0x5a, flags: 0x0}, - 148: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 149: {lang: 0x1b, script: 0x2, flags: 0x1}, - 151: {lang: 0x1bc, script: 0x3e, flags: 0x0}, - 153: {lang: 0x1d, script: 0x3, flags: 0x1}, - 155: {lang: 0x3a, script: 0x5, flags: 0x0}, - 156: {lang: 0x20, script: 0x2, flags: 0x1}, - 157: {lang: 0x1f8, script: 0x5a, flags: 0x0}, - 158: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 161: {lang: 0x3a, script: 0x5, flags: 0x0}, - 162: {lang: 0x200, script: 0x49, flags: 0x0}, - 164: {lang: 0x445, script: 0x5a, flags: 0x0}, - 165: {lang: 0x28a, script: 0x20, flags: 0x0}, - 166: {lang: 0x22, script: 0x3, flags: 0x1}, - 168: {lang: 0x25, script: 0x2, flags: 0x1}, - 170: {lang: 0x254, script: 0x53, flags: 0x0}, - 171: {lang: 0x254, script: 0x53, flags: 0x0}, - 172: {lang: 0x3a, script: 0x5, flags: 0x0}, - 174: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 175: {lang: 0x27, script: 0x2, flags: 0x1}, - 176: {lang: 0x3a, script: 0x5, flags: 0x0}, - 178: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 179: {lang: 0x40c, script: 0xd4, flags: 0x0}, - 181: {lang: 0x43b, script: 0x5a, flags: 0x0}, - 182: {lang: 0x2c0, script: 0x5a, flags: 0x0}, - 183: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 184: {lang: 0x2c7, script: 0x5a, flags: 0x0}, - 185: {lang: 0x3a, script: 0x5, flags: 0x0}, - 186: {lang: 0x29, script: 0x2, flags: 0x1}, - 187: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 188: {lang: 0x2b, script: 0x2, flags: 0x1}, - 189: {lang: 0x432, script: 0x5a, flags: 0x0}, - 190: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 191: {lang: 0x2f1, script: 0x5a, flags: 0x0}, - 194: {lang: 0x2d, script: 0x2, flags: 0x1}, - 195: {lang: 0xa0, script: 0x5a, flags: 0x0}, - 196: {lang: 0x2f, script: 0x2, flags: 0x1}, - 197: {lang: 0x31, script: 0x2, flags: 0x1}, - 198: {lang: 0x33, script: 0x2, flags: 0x1}, - 200: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 201: {lang: 0x35, script: 0x2, flags: 0x1}, - 203: {lang: 0x320, script: 0x5a, flags: 0x0}, - 204: {lang: 0x37, script: 0x3, flags: 0x1}, - 205: {lang: 0x128, script: 0xea, flags: 0x0}, - 207: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 208: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 209: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 210: {lang: 0x16, script: 0x5a, flags: 0x0}, - 211: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 212: {lang: 0x1b4, script: 0x5a, flags: 0x0}, - 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 216: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 217: {lang: 0x367, script: 0x5a, flags: 0x0}, - 218: {lang: 0x347, script: 0x5a, flags: 0x0}, - 219: {lang: 0x351, script: 0x22, flags: 0x0}, - 225: {lang: 0x3a, script: 0x5, flags: 0x0}, - 226: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 228: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 229: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 230: {lang: 0x486, script: 0x5a, flags: 0x0}, - 231: {lang: 0x153, script: 0x5a, flags: 0x0}, - 232: {lang: 0x3a, script: 0x3, flags: 0x1}, - 233: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 234: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 236: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 237: {lang: 0x3a, script: 0x5, flags: 0x0}, - 238: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 240: {lang: 0x3a2, script: 0x5a, flags: 0x0}, - 241: {lang: 0x194, script: 0x5a, flags: 0x0}, - 243: {lang: 0x3a, script: 0x5, flags: 0x0}, - 258: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 260: {lang: 0x3d, script: 0x2, flags: 0x1}, - 261: {lang: 0x432, script: 0x20, flags: 0x0}, - 262: {lang: 0x3f, script: 0x2, flags: 0x1}, - 263: {lang: 0x3e5, script: 0x5a, flags: 0x0}, - 264: {lang: 0x3a, script: 0x5, flags: 0x0}, - 266: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 267: {lang: 0x3a, script: 0x5, flags: 0x0}, - 268: {lang: 0x41, script: 0x2, flags: 0x1}, - 271: {lang: 0x416, script: 0x5a, flags: 0x0}, - 272: {lang: 0x347, script: 0x5a, flags: 0x0}, - 273: {lang: 0x43, script: 0x2, flags: 0x1}, - 275: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 276: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 277: {lang: 0x429, script: 0x5a, flags: 0x0}, - 278: {lang: 0x367, script: 0x5a, flags: 0x0}, - 280: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 282: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 284: {lang: 0x45, script: 0x2, flags: 0x1}, - 288: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 289: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 290: {lang: 0x47, script: 0x2, flags: 0x1}, - 291: {lang: 0x49, script: 0x3, flags: 0x1}, - 292: {lang: 0x4c, script: 0x2, flags: 0x1}, - 293: {lang: 0x477, script: 0x5a, flags: 0x0}, - 294: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 295: {lang: 0x476, script: 0x5a, flags: 0x0}, - 296: {lang: 0x4e, script: 0x2, flags: 0x1}, - 297: {lang: 0x482, script: 0x5a, flags: 0x0}, - 299: {lang: 0x50, script: 0x4, flags: 0x1}, - 301: {lang: 0x4a0, script: 0x5a, flags: 0x0}, - 302: {lang: 0x54, script: 0x2, flags: 0x1}, - 303: {lang: 0x445, script: 0x5a, flags: 0x0}, - 304: {lang: 0x56, script: 0x3, flags: 0x1}, - 305: {lang: 0x445, script: 0x5a, flags: 0x0}, - 309: {lang: 0x512, script: 0x3e, flags: 0x2}, - 310: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 311: {lang: 0x4bc, script: 0x5a, flags: 0x0}, - 312: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 315: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 318: {lang: 0x4c3, script: 0x5a, flags: 0x0}, - 319: {lang: 0x8a, script: 0x5a, flags: 0x0}, - 320: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 322: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 333: {lang: 0x59, script: 0x2, flags: 0x1}, - 350: {lang: 0x3a, script: 0x5, flags: 0x0}, - 351: {lang: 0x5b, script: 0x2, flags: 0x1}, - 356: {lang: 0x423, script: 0x5a, flags: 0x0}, + 109: {lang: 0x3a, script: 0x5, flags: 0x0}, + 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 112: {lang: 0x12, script: 0x2, flags: 0x1}, + 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 115: {lang: 0x151, script: 0x5b, flags: 0x0}, + 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 119: {lang: 0x158, script: 0x5b, flags: 0x0}, + 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 124: {lang: 0x14, script: 0x2, flags: 0x1}, + 126: {lang: 0x16, script: 0x3, flags: 0x1}, + 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 129: {lang: 0x21, script: 0x5b, flags: 0x0}, + 131: {lang: 0x245, script: 0x5b, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 136: {lang: 0x19, script: 0x2, flags: 0x1}, + 137: {lang: 0x0, script: 0x5b, flags: 0x0}, + 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 142: {lang: 0x529, script: 0x3c, flags: 0x0}, + 143: {lang: 0x0, script: 0x5b, flags: 0x0}, + 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, + 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, + 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, + 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 150: {lang: 0x1b, script: 0x2, flags: 0x1}, + 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 154: {lang: 0x1d, script: 0x3, flags: 0x1}, + 156: {lang: 0x3a, script: 0x5, flags: 0x0}, + 157: {lang: 0x20, script: 0x2, flags: 0x1}, + 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, + 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 162: {lang: 0x3a, script: 0x5, flags: 0x0}, + 163: {lang: 0x200, script: 0x49, flags: 0x0}, + 165: {lang: 0x445, script: 0x5b, flags: 0x0}, + 166: {lang: 0x28a, script: 0x20, flags: 0x0}, + 167: {lang: 0x22, script: 0x3, flags: 0x1}, + 169: {lang: 0x25, script: 0x2, flags: 0x1}, + 171: {lang: 0x254, script: 0x54, flags: 0x0}, + 172: {lang: 0x254, script: 0x54, flags: 0x0}, + 173: {lang: 0x3a, script: 0x5, flags: 0x0}, + 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 176: {lang: 0x27, script: 0x2, flags: 0x1}, + 177: {lang: 0x3a, script: 0x5, flags: 0x0}, + 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, + 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, + 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, + 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, + 186: {lang: 0x3a, script: 0x5, flags: 0x0}, + 187: {lang: 0x29, script: 0x2, flags: 0x1}, + 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 189: {lang: 0x2b, script: 0x2, flags: 0x1}, + 190: {lang: 0x432, script: 0x5b, flags: 0x0}, + 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, + 195: {lang: 0x2d, script: 0x2, flags: 0x1}, + 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, + 197: {lang: 0x2f, script: 0x2, flags: 0x1}, + 198: {lang: 0x31, script: 0x2, flags: 0x1}, + 199: {lang: 0x33, script: 0x2, flags: 0x1}, + 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 202: {lang: 0x35, script: 0x2, flags: 0x1}, + 204: {lang: 0x320, script: 0x5b, flags: 0x0}, + 205: {lang: 0x37, script: 0x3, flags: 0x1}, + 206: {lang: 0x128, script: 0xed, flags: 0x0}, + 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 211: {lang: 0x16, script: 0x5b, flags: 0x0}, + 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, + 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 218: {lang: 0x367, script: 0x5b, flags: 0x0}, + 219: {lang: 0x347, script: 0x5b, flags: 0x0}, + 220: {lang: 0x351, script: 0x22, flags: 0x0}, + 226: {lang: 0x3a, script: 0x5, flags: 0x0}, + 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 231: {lang: 0x486, script: 0x5b, flags: 0x0}, + 232: {lang: 0x153, script: 0x5b, flags: 0x0}, + 233: {lang: 0x3a, script: 0x3, flags: 0x1}, + 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 238: {lang: 0x3a, script: 0x5, flags: 0x0}, + 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, + 242: {lang: 0x194, script: 0x5b, flags: 0x0}, + 244: {lang: 0x3a, script: 0x5, flags: 0x0}, + 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 261: {lang: 0x3d, script: 0x2, flags: 0x1}, + 262: {lang: 0x432, script: 0x20, flags: 0x0}, + 263: {lang: 0x3f, script: 0x2, flags: 0x1}, + 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, + 265: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 268: {lang: 0x3a, script: 0x5, flags: 0x0}, + 269: {lang: 0x41, script: 0x2, flags: 0x1}, + 272: {lang: 0x416, script: 0x5b, flags: 0x0}, + 273: {lang: 0x347, script: 0x5b, flags: 0x0}, + 274: {lang: 0x43, script: 0x2, flags: 0x1}, + 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 278: {lang: 0x429, script: 0x5b, flags: 0x0}, + 279: {lang: 0x367, script: 0x5b, flags: 0x0}, + 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 285: {lang: 0x45, script: 0x2, flags: 0x1}, + 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 291: {lang: 0x47, script: 0x2, flags: 0x1}, + 292: {lang: 0x49, script: 0x3, flags: 0x1}, + 293: {lang: 0x4c, script: 0x2, flags: 0x1}, + 294: {lang: 0x477, script: 0x5b, flags: 0x0}, + 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 296: {lang: 0x476, script: 0x5b, flags: 0x0}, + 297: {lang: 0x4e, script: 0x2, flags: 0x1}, + 298: {lang: 0x482, script: 0x5b, flags: 0x0}, + 300: {lang: 0x50, script: 0x4, flags: 0x1}, + 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, + 303: {lang: 0x54, script: 0x2, flags: 0x1}, + 304: {lang: 0x445, script: 0x5b, flags: 0x0}, + 305: {lang: 0x56, script: 0x3, flags: 0x1}, + 306: {lang: 0x445, script: 0x5b, flags: 0x0}, + 310: {lang: 0x512, script: 0x3e, flags: 0x2}, + 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, + 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, + 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, + 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 334: {lang: 0x59, script: 0x2, flags: 0x1}, + 351: {lang: 0x3a, script: 0x5, flags: 0x0}, + 352: {lang: 0x5b, script: 0x2, flags: 0x1}, + 357: {lang: 0x423, script: 0x5b, flags: 0x0}, } // likelyRegionList holds lists info associated with likelyRegion. // Size: 558 bytes, 93 elements var likelyRegionList = [93]likelyLangScript{ 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x5a, flags: 0x0}, - 2: {lang: 0x431, script: 0x5a, flags: 0x0}, + 1: {lang: 0x476, script: 0x5b, flags: 0x0}, + 2: {lang: 0x431, script: 0x5b, flags: 0x0}, 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x5a, flags: 0x0}, - 6: {lang: 0xb7, script: 0x5a, flags: 0x0}, + 5: {lang: 0x274, script: 0x5b, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, 7: {lang: 0x432, script: 0x20, flags: 0x0}, - 8: {lang: 0x12d, script: 0xec, flags: 0x0}, + 8: {lang: 0x12d, script: 0xef, flags: 0x0}, 9: {lang: 0x351, script: 0x22, flags: 0x0}, 10: {lang: 0x529, script: 0x3b, flags: 0x0}, 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x5a, flags: 0x0}, - 13: {lang: 0x29a, script: 0xeb, flags: 0x0}, + 12: {lang: 0x523, script: 0x5b, flags: 0x0}, + 13: {lang: 0x29a, script: 0xee, flags: 0x0}, 14: {lang: 0x136, script: 0x34, flags: 0x0}, - 15: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, 18: {lang: 0x27, script: 0x2c, flags: 0x0}, - 19: {lang: 0x139, script: 0x5a, flags: 0x0}, + 19: {lang: 0x139, script: 0x5b, flags: 0x0}, 20: {lang: 0x26a, script: 0x5, flags: 0x2}, 21: {lang: 0x512, script: 0x3e, flags: 0x2}, 22: {lang: 0x210, script: 0x2e, flags: 0x0}, 23: {lang: 0x5, script: 0x20, flags: 0x0}, - 24: {lang: 0x274, script: 0x5a, flags: 0x0}, + 24: {lang: 0x274, script: 0x5b, flags: 0x0}, 25: {lang: 0x136, script: 0x34, flags: 0x0}, 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x5a, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, 28: {lang: 0x31f, script: 0x5, flags: 0x0}, 29: {lang: 0x1be, script: 0x22, flags: 0x0}, 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x75, flags: 0x0}, + 31: {lang: 0x236, script: 0x76, flags: 0x0}, 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x5a, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4e, flags: 0x0}, + 33: {lang: 0x476, script: 0x5b, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xeb, flags: 0x0}, + 36: {lang: 0x226, script: 0xee, flags: 0x0}, 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x57, flags: 0x0}, - 40: {lang: 0x226, script: 0xeb, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, + 40: {lang: 0x226, script: 0xee, flags: 0x0}, 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 46: {lang: 0x431, script: 0x5a, flags: 0x0}, - 47: {lang: 0x331, script: 0x75, flags: 0x0}, - 48: {lang: 0x213, script: 0x5a, flags: 0x0}, + 46: {lang: 0x431, script: 0x5b, flags: 0x0}, + 47: {lang: 0x331, script: 0x76, flags: 0x0}, + 48: {lang: 0x213, script: 0x5b, flags: 0x0}, 49: {lang: 0x30b, script: 0x20, flags: 0x0}, 50: {lang: 0x242, script: 0x5, flags: 0x0}, 51: {lang: 0x529, script: 0x3c, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x5a, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, 57: {lang: 0x88, script: 0x22, flags: 0x0}, 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, 60: {lang: 0xbe, script: 0x22, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 62: {lang: 0x7e, script: 0x20, flags: 0x0}, 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 64: {lang: 0x267, script: 0x5a, flags: 0x0}, - 65: {lang: 0x444, script: 0x5a, flags: 0x0}, + 64: {lang: 0x267, script: 0x5b, flags: 0x0}, + 65: {lang: 0x444, script: 0x5b, flags: 0x0}, 66: {lang: 0x512, script: 0x3e, flags: 0x0}, - 67: {lang: 0x412, script: 0x5a, flags: 0x0}, + 67: {lang: 0x412, script: 0x5b, flags: 0x0}, 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 71: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xeb, flags: 0x0}, + 73: {lang: 0x46b, script: 0xee, flags: 0x0}, 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x75, flags: 0x0}, + 75: {lang: 0x30f, script: 0x76, flags: 0x0}, 76: {lang: 0x467, script: 0x20, flags: 0x0}, 77: {lang: 0x148, script: 0x5, flags: 0x0}, 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 80: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, 81: {lang: 0x58, script: 0x5, flags: 0x0}, 82: {lang: 0x219, script: 0x20, flags: 0x0}, 83: {lang: 0x81, script: 0x34, flags: 0x0}, 84: {lang: 0x529, script: 0x3c, flags: 0x0}, - 85: {lang: 0x48c, script: 0x5a, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, 87: {lang: 0x512, script: 0x3e, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 89: {lang: 0x431, script: 0x5a, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 89: {lang: 0x431, script: 0x5b, flags: 0x0}, 90: {lang: 0x432, script: 0x20, flags: 0x0}, - 91: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, 92: {lang: 0x446, script: 0x5, flags: 0x0}, } @@ -3298,38 +3320,38 @@ type likelyTag struct { // Size: 198 bytes, 33 elements var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd6, script: 0x5a}, - 2: {lang: 0x139, region: 0x135, script: 0x5a}, - 3: {lang: 0x3c0, region: 0x41, script: 0x5a}, - 4: {lang: 0x139, region: 0x2f, script: 0x5a}, - 5: {lang: 0x139, region: 0xd6, script: 0x5a}, - 6: {lang: 0x13e, region: 0xcf, script: 0x5a}, - 7: {lang: 0x445, region: 0x12f, script: 0x5a}, - 8: {lang: 0x3a, region: 0x6b, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x5a}, - 10: {lang: 0x139, region: 0x161, script: 0x5a}, - 11: {lang: 0x139, region: 0x135, script: 0x5a}, - 12: {lang: 0x139, region: 0x135, script: 0x5a}, - 13: {lang: 0x13e, region: 0x59, script: 0x5a}, + 1: {lang: 0x139, region: 0xd7, script: 0x5b}, + 2: {lang: 0x139, region: 0x136, script: 0x5b}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, + 4: {lang: 0x139, region: 0x2f, script: 0x5b}, + 5: {lang: 0x139, region: 0xd7, script: 0x5b}, + 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, + 7: {lang: 0x445, region: 0x130, script: 0x5b}, + 8: {lang: 0x3a, region: 0x6c, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5b}, + 10: {lang: 0x139, region: 0x162, script: 0x5b}, + 11: {lang: 0x139, region: 0x136, script: 0x5b}, + 12: {lang: 0x139, region: 0x136, script: 0x5b}, + 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, 14: {lang: 0x529, region: 0x53, script: 0x3b}, - 15: {lang: 0x1be, region: 0x99, script: 0x22}, - 16: {lang: 0x1e1, region: 0x95, script: 0x5a}, - 17: {lang: 0x1f9, region: 0x9e, script: 0x5a}, - 18: {lang: 0x139, region: 0x2f, script: 0x5a}, - 19: {lang: 0x139, region: 0xe6, script: 0x5a}, - 20: {lang: 0x139, region: 0x8a, script: 0x5a}, - 21: {lang: 0x41b, region: 0x142, script: 0x5a}, + 15: {lang: 0x1be, region: 0x9a, script: 0x22}, + 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, + 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, + 18: {lang: 0x139, region: 0x2f, script: 0x5b}, + 19: {lang: 0x139, region: 0xe7, script: 0x5b}, + 20: {lang: 0x139, region: 0x8b, script: 0x5b}, + 21: {lang: 0x41b, region: 0x143, script: 0x5b}, 22: {lang: 0x529, region: 0x53, script: 0x3b}, - 23: {lang: 0x4bc, region: 0x137, script: 0x5a}, - 24: {lang: 0x3a, region: 0x108, script: 0x5}, - 25: {lang: 0x3e2, region: 0x106, script: 0x20}, - 26: {lang: 0x3e2, region: 0x106, script: 0x20}, - 27: {lang: 0x139, region: 0x7b, script: 0x5a}, - 28: {lang: 0x10d, region: 0x60, script: 0x5a}, - 29: {lang: 0x139, region: 0xd6, script: 0x5a}, - 30: {lang: 0x13e, region: 0x1f, script: 0x5a}, - 31: {lang: 0x139, region: 0x9a, script: 0x5a}, - 32: {lang: 0x139, region: 0x7b, script: 0x5a}, + 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, + 24: {lang: 0x3a, region: 0x109, script: 0x5}, + 25: {lang: 0x3e2, region: 0x107, script: 0x20}, + 26: {lang: 0x3e2, region: 0x107, script: 0x20}, + 27: {lang: 0x139, region: 0x7c, script: 0x5b}, + 28: {lang: 0x10d, region: 0x61, script: 0x5b}, + 29: {lang: 0x139, region: 0xd7, script: 0x5b}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, + 31: {lang: 0x139, region: 0x9b, script: 0x5b}, + 32: {lang: 0x139, region: 0x7c, script: 0x5b}, } // Size: 264 bytes, 33 elements @@ -3350,8 +3372,8 @@ var regionContainment = [33]uint64{ // regionInclusion maps region identifiers to sets of regions in regionInclusionBits, // where each set holds all groupings that are directly connected in a region // containment graph. -// Size: 358 bytes, 358 elements -var regionInclusion = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionInclusion = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, @@ -3364,45 +3386,45 @@ var regionInclusion = [358]uint8{ // Entry 40 - 7F 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, - 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, - 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, - 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, - 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, - 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, + 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, + 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, + 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, + 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, + 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, // Entry 80 - BF - 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, - 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, - 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, - 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, - 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, - 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, - 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, - 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, + 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, + 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, + 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, + 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, + 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, + 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, + 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, // Entry C0 - FF - 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, - 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, - 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, - 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, - 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, - 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, - 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, + 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, + 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, + 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, + 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, + 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, + 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, // Entry 100 - 13F - 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, - 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, - 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, - 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, - 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, - 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, - 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, - 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, + 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, + 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, + 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, + 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, + 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, + 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, + 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, // Entry 140 - 17F - 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, - 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, + 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, } // regionInclusionBits is an array of bit vectors where every vector represents @@ -3462,11 +3484,11 @@ type parentRel struct { // Size: 414 bytes, 5 elements var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, - 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, + 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, } -// Total table size 30244 bytes (29KiB); checksum: B6B15F30 +// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go index ee45f494..1153baf2 100644 --- a/vendor/golang.org/x/text/language/match.go +++ b/vendor/golang.org/x/text/language/match.go @@ -434,7 +434,7 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // (their canonicalization simply substitutes a different language code, but // nothing else), the match confidence is Exact, otherwise it is High. for i, lm := range language.AliasMap { - // If deprecated codes match and there is no fiddling with the script or + // If deprecated codes match and there is no fiddling with the script // or region, we consider it an exact match. conf := Exact if language.AliasTypes[i] != language.Macro { diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go index 34a732b6..a6573dcb 100644 --- a/vendor/golang.org/x/text/language/tables.go +++ b/vendor/golang.org/x/text/language/tables.go @@ -23,31 +23,31 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) -var regionToGroups = []uint8{ // 358 elements +var regionToGroups = []uint8{ // 359 elements // Entry 0 - 3F 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, @@ -60,51 +60,51 @@ var regionToGroups = []uint8{ // 358 elements // Entry 40 - 7F 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, - 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, // Entry 80 - BF - 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, // Entry C0 - FF - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, - 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, // Entry 140 - 17F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} // Size: 382 bytes + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 383 bytes var paradigmLocales = [][3]uint16{ // 3 elements - 0: [3]uint16{0x139, 0x0, 0x7b}, + 0: [3]uint16{0x139, 0x0, 0x7c}, 1: [3]uint16{0x13e, 0x0, 0x1f}, - 2: [3]uint16{0x3c0, 0x41, 0xee}, + 2: [3]uint16{0x3c0, 0x41, 0xef}, } // Size: 42 bytes type mutualIntelligibility struct { @@ -249,30 +249,30 @@ var matchLang = []mutualIntelligibility{ // 113 elements // matchScript holds pairs of scriptIDs where readers of one script // can typically also read the other. Each is associated with a confidence. var matchScript = []scriptIntelligibility{ // 26 elements - 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5}, - 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5}, - 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa}, + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa}, 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, - 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa}, - 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa}, - 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa}, - 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa}, - 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa}, - 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa}, - 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa}, - 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa}, - 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa}, - 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd4, haveScript: 0x5a, distance: 0xa}, - 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe3, haveScript: 0x5a, distance: 0xa}, - 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5a, distance: 0xa}, - 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa}, - 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa}, 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, } // Size: 232 bytes @@ -295,4 +295,4 @@ var matchRegion = []regionIntelligibility{ // 15 elements 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, } // Size: 114 bytes -// Total table size 1472 bytes (1KiB); checksum: F86C669 +// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C diff --git a/vendor/golang.org/x/text/secure/bidirule/bidirule10.0.0.go b/vendor/golang.org/x/text/secure/bidirule/bidirule10.0.0.go index 8a7392c4..784bb880 100644 --- a/vendor/golang.org/x/text/secure/bidirule/bidirule10.0.0.go +++ b/vendor/golang.org/x/text/secure/bidirule/bidirule10.0.0.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build go1.10 -// +build go1.10 package bidirule diff --git a/vendor/golang.org/x/text/secure/bidirule/bidirule9.0.0.go b/vendor/golang.org/x/text/secure/bidirule/bidirule9.0.0.go index bb0a9200..8e1e9439 100644 --- a/vendor/golang.org/x/text/secure/bidirule/bidirule9.0.0.go +++ b/vendor/golang.org/x/text/secure/bidirule/bidirule9.0.0.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !go1.10 -// +build !go1.10 package bidirule diff --git a/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go index 42fa8d72..d2bd7118 100644 --- a/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go +++ b/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. //go:build go1.10 && !go1.13 -// +build go1.10,!go1.13 package bidi diff --git a/vendor/golang.org/x/text/unicode/bidi/tables11.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables11.0.0.go index 56a0e1ea..f76bdca2 100644 --- a/vendor/golang.org/x/text/unicode/bidi/tables11.0.0.go +++ b/vendor/golang.org/x/text/unicode/bidi/tables11.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. //go:build go1.13 && !go1.14 -// +build go1.13,!go1.14 package bidi diff --git a/vendor/golang.org/x/text/unicode/bidi/tables12.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables12.0.0.go index baacf32b..3aa2c3bd 100644 --- a/vendor/golang.org/x/text/unicode/bidi/tables12.0.0.go +++ b/vendor/golang.org/x/text/unicode/bidi/tables12.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. //go:build go1.14 && !go1.16 -// +build go1.14,!go1.16 package bidi diff --git a/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go index f248effa..a7137579 100644 --- a/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go +++ b/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 package bidi diff --git a/vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go new file mode 100644 index 00000000..f15746f7 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go @@ -0,0 +1,2042 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 + +package bidi + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "15.0.0" + +// xorMasks contains masks to be xor-ed with brackets to get the reverse +// version. +var xorMasks = []int32{ // 8 elements + 0, 1, 6, 7, 3, 15, 29, 63, +} // Size: 56 bytes + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookup(s []byte) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupUnsafe(s []byte) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookupString(s string) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupStringUnsafe(s string) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// bidiTrie. Total size: 19904 bytes (19.44 KiB). Checksum: b1f201ed2debb6c8. +type bidiTrie struct{} + +func newBidiTrie(i int) *bidiTrie { + return &bidiTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *bidiTrie) lookupValue(n uint32, b byte) uint8 { + switch { + default: + return uint8(bidiValues[n<<6+uint32(b)]) + } +} + +// bidiValues: 259 blocks, 16576 entries, 16576 bytes +// The third block is the zero block. +var bidiValues = [16576]uint8{ + // Block 0x0, offset 0x0 + 0x00: 0x000b, 0x01: 0x000b, 0x02: 0x000b, 0x03: 0x000b, 0x04: 0x000b, 0x05: 0x000b, + 0x06: 0x000b, 0x07: 0x000b, 0x08: 0x000b, 0x09: 0x0008, 0x0a: 0x0007, 0x0b: 0x0008, + 0x0c: 0x0009, 0x0d: 0x0007, 0x0e: 0x000b, 0x0f: 0x000b, 0x10: 0x000b, 0x11: 0x000b, + 0x12: 0x000b, 0x13: 0x000b, 0x14: 0x000b, 0x15: 0x000b, 0x16: 0x000b, 0x17: 0x000b, + 0x18: 0x000b, 0x19: 0x000b, 0x1a: 0x000b, 0x1b: 0x000b, 0x1c: 0x0007, 0x1d: 0x0007, + 0x1e: 0x0007, 0x1f: 0x0008, 0x20: 0x0009, 0x21: 0x000a, 0x22: 0x000a, 0x23: 0x0004, + 0x24: 0x0004, 0x25: 0x0004, 0x26: 0x000a, 0x27: 0x000a, 0x28: 0x003a, 0x29: 0x002a, + 0x2a: 0x000a, 0x2b: 0x0003, 0x2c: 0x0006, 0x2d: 0x0003, 0x2e: 0x0006, 0x2f: 0x0006, + 0x30: 0x0002, 0x31: 0x0002, 0x32: 0x0002, 0x33: 0x0002, 0x34: 0x0002, 0x35: 0x0002, + 0x36: 0x0002, 0x37: 0x0002, 0x38: 0x0002, 0x39: 0x0002, 0x3a: 0x0006, 0x3b: 0x000a, + 0x3c: 0x000a, 0x3d: 0x000a, 0x3e: 0x000a, 0x3f: 0x000a, + // Block 0x1, offset 0x40 + 0x40: 0x000a, + 0x5b: 0x005a, 0x5c: 0x000a, 0x5d: 0x004a, + 0x5e: 0x000a, 0x5f: 0x000a, 0x60: 0x000a, + 0x7b: 0x005a, + 0x7c: 0x000a, 0x7d: 0x004a, 0x7e: 0x000a, 0x7f: 0x000b, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x000b, 0xc1: 0x000b, 0xc2: 0x000b, 0xc3: 0x000b, 0xc4: 0x000b, 0xc5: 0x0007, + 0xc6: 0x000b, 0xc7: 0x000b, 0xc8: 0x000b, 0xc9: 0x000b, 0xca: 0x000b, 0xcb: 0x000b, + 0xcc: 0x000b, 0xcd: 0x000b, 0xce: 0x000b, 0xcf: 0x000b, 0xd0: 0x000b, 0xd1: 0x000b, + 0xd2: 0x000b, 0xd3: 0x000b, 0xd4: 0x000b, 0xd5: 0x000b, 0xd6: 0x000b, 0xd7: 0x000b, + 0xd8: 0x000b, 0xd9: 0x000b, 0xda: 0x000b, 0xdb: 0x000b, 0xdc: 0x000b, 0xdd: 0x000b, + 0xde: 0x000b, 0xdf: 0x000b, 0xe0: 0x0006, 0xe1: 0x000a, 0xe2: 0x0004, 0xe3: 0x0004, + 0xe4: 0x0004, 0xe5: 0x0004, 0xe6: 0x000a, 0xe7: 0x000a, 0xe8: 0x000a, 0xe9: 0x000a, + 0xeb: 0x000a, 0xec: 0x000a, 0xed: 0x000b, 0xee: 0x000a, 0xef: 0x000a, + 0xf0: 0x0004, 0xf1: 0x0004, 0xf2: 0x0002, 0xf3: 0x0002, 0xf4: 0x000a, + 0xf6: 0x000a, 0xf7: 0x000a, 0xf8: 0x000a, 0xf9: 0x0002, 0xfb: 0x000a, + 0xfc: 0x000a, 0xfd: 0x000a, 0xfe: 0x000a, 0xff: 0x000a, + // Block 0x4, offset 0x100 + 0x117: 0x000a, + 0x137: 0x000a, + // Block 0x5, offset 0x140 + 0x179: 0x000a, 0x17a: 0x000a, + // Block 0x6, offset 0x180 + 0x182: 0x000a, 0x183: 0x000a, 0x184: 0x000a, 0x185: 0x000a, + 0x186: 0x000a, 0x187: 0x000a, 0x188: 0x000a, 0x189: 0x000a, 0x18a: 0x000a, 0x18b: 0x000a, + 0x18c: 0x000a, 0x18d: 0x000a, 0x18e: 0x000a, 0x18f: 0x000a, + 0x192: 0x000a, 0x193: 0x000a, 0x194: 0x000a, 0x195: 0x000a, 0x196: 0x000a, 0x197: 0x000a, + 0x198: 0x000a, 0x199: 0x000a, 0x19a: 0x000a, 0x19b: 0x000a, 0x19c: 0x000a, 0x19d: 0x000a, + 0x19e: 0x000a, 0x19f: 0x000a, + 0x1a5: 0x000a, 0x1a6: 0x000a, 0x1a7: 0x000a, 0x1a8: 0x000a, 0x1a9: 0x000a, + 0x1aa: 0x000a, 0x1ab: 0x000a, 0x1ac: 0x000a, 0x1ad: 0x000a, 0x1af: 0x000a, + 0x1b0: 0x000a, 0x1b1: 0x000a, 0x1b2: 0x000a, 0x1b3: 0x000a, 0x1b4: 0x000a, 0x1b5: 0x000a, + 0x1b6: 0x000a, 0x1b7: 0x000a, 0x1b8: 0x000a, 0x1b9: 0x000a, 0x1ba: 0x000a, 0x1bb: 0x000a, + 0x1bc: 0x000a, 0x1bd: 0x000a, 0x1be: 0x000a, 0x1bf: 0x000a, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x000c, 0x1c1: 0x000c, 0x1c2: 0x000c, 0x1c3: 0x000c, 0x1c4: 0x000c, 0x1c5: 0x000c, + 0x1c6: 0x000c, 0x1c7: 0x000c, 0x1c8: 0x000c, 0x1c9: 0x000c, 0x1ca: 0x000c, 0x1cb: 0x000c, + 0x1cc: 0x000c, 0x1cd: 0x000c, 0x1ce: 0x000c, 0x1cf: 0x000c, 0x1d0: 0x000c, 0x1d1: 0x000c, + 0x1d2: 0x000c, 0x1d3: 0x000c, 0x1d4: 0x000c, 0x1d5: 0x000c, 0x1d6: 0x000c, 0x1d7: 0x000c, + 0x1d8: 0x000c, 0x1d9: 0x000c, 0x1da: 0x000c, 0x1db: 0x000c, 0x1dc: 0x000c, 0x1dd: 0x000c, + 0x1de: 0x000c, 0x1df: 0x000c, 0x1e0: 0x000c, 0x1e1: 0x000c, 0x1e2: 0x000c, 0x1e3: 0x000c, + 0x1e4: 0x000c, 0x1e5: 0x000c, 0x1e6: 0x000c, 0x1e7: 0x000c, 0x1e8: 0x000c, 0x1e9: 0x000c, + 0x1ea: 0x000c, 0x1eb: 0x000c, 0x1ec: 0x000c, 0x1ed: 0x000c, 0x1ee: 0x000c, 0x1ef: 0x000c, + 0x1f0: 0x000c, 0x1f1: 0x000c, 0x1f2: 0x000c, 0x1f3: 0x000c, 0x1f4: 0x000c, 0x1f5: 0x000c, + 0x1f6: 0x000c, 0x1f7: 0x000c, 0x1f8: 0x000c, 0x1f9: 0x000c, 0x1fa: 0x000c, 0x1fb: 0x000c, + 0x1fc: 0x000c, 0x1fd: 0x000c, 0x1fe: 0x000c, 0x1ff: 0x000c, + // Block 0x8, offset 0x200 + 0x200: 0x000c, 0x201: 0x000c, 0x202: 0x000c, 0x203: 0x000c, 0x204: 0x000c, 0x205: 0x000c, + 0x206: 0x000c, 0x207: 0x000c, 0x208: 0x000c, 0x209: 0x000c, 0x20a: 0x000c, 0x20b: 0x000c, + 0x20c: 0x000c, 0x20d: 0x000c, 0x20e: 0x000c, 0x20f: 0x000c, 0x210: 0x000c, 0x211: 0x000c, + 0x212: 0x000c, 0x213: 0x000c, 0x214: 0x000c, 0x215: 0x000c, 0x216: 0x000c, 0x217: 0x000c, + 0x218: 0x000c, 0x219: 0x000c, 0x21a: 0x000c, 0x21b: 0x000c, 0x21c: 0x000c, 0x21d: 0x000c, + 0x21e: 0x000c, 0x21f: 0x000c, 0x220: 0x000c, 0x221: 0x000c, 0x222: 0x000c, 0x223: 0x000c, + 0x224: 0x000c, 0x225: 0x000c, 0x226: 0x000c, 0x227: 0x000c, 0x228: 0x000c, 0x229: 0x000c, + 0x22a: 0x000c, 0x22b: 0x000c, 0x22c: 0x000c, 0x22d: 0x000c, 0x22e: 0x000c, 0x22f: 0x000c, + 0x234: 0x000a, 0x235: 0x000a, + 0x23e: 0x000a, + // Block 0x9, offset 0x240 + 0x244: 0x000a, 0x245: 0x000a, + 0x247: 0x000a, + // Block 0xa, offset 0x280 + 0x2b6: 0x000a, + // Block 0xb, offset 0x2c0 + 0x2c3: 0x000c, 0x2c4: 0x000c, 0x2c5: 0x000c, + 0x2c6: 0x000c, 0x2c7: 0x000c, 0x2c8: 0x000c, 0x2c9: 0x000c, + // Block 0xc, offset 0x300 + 0x30a: 0x000a, + 0x30d: 0x000a, 0x30e: 0x000a, 0x30f: 0x0004, 0x310: 0x0001, 0x311: 0x000c, + 0x312: 0x000c, 0x313: 0x000c, 0x314: 0x000c, 0x315: 0x000c, 0x316: 0x000c, 0x317: 0x000c, + 0x318: 0x000c, 0x319: 0x000c, 0x31a: 0x000c, 0x31b: 0x000c, 0x31c: 0x000c, 0x31d: 0x000c, + 0x31e: 0x000c, 0x31f: 0x000c, 0x320: 0x000c, 0x321: 0x000c, 0x322: 0x000c, 0x323: 0x000c, + 0x324: 0x000c, 0x325: 0x000c, 0x326: 0x000c, 0x327: 0x000c, 0x328: 0x000c, 0x329: 0x000c, + 0x32a: 0x000c, 0x32b: 0x000c, 0x32c: 0x000c, 0x32d: 0x000c, 0x32e: 0x000c, 0x32f: 0x000c, + 0x330: 0x000c, 0x331: 0x000c, 0x332: 0x000c, 0x333: 0x000c, 0x334: 0x000c, 0x335: 0x000c, + 0x336: 0x000c, 0x337: 0x000c, 0x338: 0x000c, 0x339: 0x000c, 0x33a: 0x000c, 0x33b: 0x000c, + 0x33c: 0x000c, 0x33d: 0x000c, 0x33e: 0x0001, 0x33f: 0x000c, + // Block 0xd, offset 0x340 + 0x340: 0x0001, 0x341: 0x000c, 0x342: 0x000c, 0x343: 0x0001, 0x344: 0x000c, 0x345: 0x000c, + 0x346: 0x0001, 0x347: 0x000c, 0x348: 0x0001, 0x349: 0x0001, 0x34a: 0x0001, 0x34b: 0x0001, + 0x34c: 0x0001, 0x34d: 0x0001, 0x34e: 0x0001, 0x34f: 0x0001, 0x350: 0x0001, 0x351: 0x0001, + 0x352: 0x0001, 0x353: 0x0001, 0x354: 0x0001, 0x355: 0x0001, 0x356: 0x0001, 0x357: 0x0001, + 0x358: 0x0001, 0x359: 0x0001, 0x35a: 0x0001, 0x35b: 0x0001, 0x35c: 0x0001, 0x35d: 0x0001, + 0x35e: 0x0001, 0x35f: 0x0001, 0x360: 0x0001, 0x361: 0x0001, 0x362: 0x0001, 0x363: 0x0001, + 0x364: 0x0001, 0x365: 0x0001, 0x366: 0x0001, 0x367: 0x0001, 0x368: 0x0001, 0x369: 0x0001, + 0x36a: 0x0001, 0x36b: 0x0001, 0x36c: 0x0001, 0x36d: 0x0001, 0x36e: 0x0001, 0x36f: 0x0001, + 0x370: 0x0001, 0x371: 0x0001, 0x372: 0x0001, 0x373: 0x0001, 0x374: 0x0001, 0x375: 0x0001, + 0x376: 0x0001, 0x377: 0x0001, 0x378: 0x0001, 0x379: 0x0001, 0x37a: 0x0001, 0x37b: 0x0001, + 0x37c: 0x0001, 0x37d: 0x0001, 0x37e: 0x0001, 0x37f: 0x0001, + // Block 0xe, offset 0x380 + 0x380: 0x0005, 0x381: 0x0005, 0x382: 0x0005, 0x383: 0x0005, 0x384: 0x0005, 0x385: 0x0005, + 0x386: 0x000a, 0x387: 0x000a, 0x388: 0x000d, 0x389: 0x0004, 0x38a: 0x0004, 0x38b: 0x000d, + 0x38c: 0x0006, 0x38d: 0x000d, 0x38e: 0x000a, 0x38f: 0x000a, 0x390: 0x000c, 0x391: 0x000c, + 0x392: 0x000c, 0x393: 0x000c, 0x394: 0x000c, 0x395: 0x000c, 0x396: 0x000c, 0x397: 0x000c, + 0x398: 0x000c, 0x399: 0x000c, 0x39a: 0x000c, 0x39b: 0x000d, 0x39c: 0x000d, 0x39d: 0x000d, + 0x39e: 0x000d, 0x39f: 0x000d, 0x3a0: 0x000d, 0x3a1: 0x000d, 0x3a2: 0x000d, 0x3a3: 0x000d, + 0x3a4: 0x000d, 0x3a5: 0x000d, 0x3a6: 0x000d, 0x3a7: 0x000d, 0x3a8: 0x000d, 0x3a9: 0x000d, + 0x3aa: 0x000d, 0x3ab: 0x000d, 0x3ac: 0x000d, 0x3ad: 0x000d, 0x3ae: 0x000d, 0x3af: 0x000d, + 0x3b0: 0x000d, 0x3b1: 0x000d, 0x3b2: 0x000d, 0x3b3: 0x000d, 0x3b4: 0x000d, 0x3b5: 0x000d, + 0x3b6: 0x000d, 0x3b7: 0x000d, 0x3b8: 0x000d, 0x3b9: 0x000d, 0x3ba: 0x000d, 0x3bb: 0x000d, + 0x3bc: 0x000d, 0x3bd: 0x000d, 0x3be: 0x000d, 0x3bf: 0x000d, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x000d, 0x3c1: 0x000d, 0x3c2: 0x000d, 0x3c3: 0x000d, 0x3c4: 0x000d, 0x3c5: 0x000d, + 0x3c6: 0x000d, 0x3c7: 0x000d, 0x3c8: 0x000d, 0x3c9: 0x000d, 0x3ca: 0x000d, 0x3cb: 0x000c, + 0x3cc: 0x000c, 0x3cd: 0x000c, 0x3ce: 0x000c, 0x3cf: 0x000c, 0x3d0: 0x000c, 0x3d1: 0x000c, + 0x3d2: 0x000c, 0x3d3: 0x000c, 0x3d4: 0x000c, 0x3d5: 0x000c, 0x3d6: 0x000c, 0x3d7: 0x000c, + 0x3d8: 0x000c, 0x3d9: 0x000c, 0x3da: 0x000c, 0x3db: 0x000c, 0x3dc: 0x000c, 0x3dd: 0x000c, + 0x3de: 0x000c, 0x3df: 0x000c, 0x3e0: 0x0005, 0x3e1: 0x0005, 0x3e2: 0x0005, 0x3e3: 0x0005, + 0x3e4: 0x0005, 0x3e5: 0x0005, 0x3e6: 0x0005, 0x3e7: 0x0005, 0x3e8: 0x0005, 0x3e9: 0x0005, + 0x3ea: 0x0004, 0x3eb: 0x0005, 0x3ec: 0x0005, 0x3ed: 0x000d, 0x3ee: 0x000d, 0x3ef: 0x000d, + 0x3f0: 0x000c, 0x3f1: 0x000d, 0x3f2: 0x000d, 0x3f3: 0x000d, 0x3f4: 0x000d, 0x3f5: 0x000d, + 0x3f6: 0x000d, 0x3f7: 0x000d, 0x3f8: 0x000d, 0x3f9: 0x000d, 0x3fa: 0x000d, 0x3fb: 0x000d, + 0x3fc: 0x000d, 0x3fd: 0x000d, 0x3fe: 0x000d, 0x3ff: 0x000d, + // Block 0x10, offset 0x400 + 0x400: 0x000d, 0x401: 0x000d, 0x402: 0x000d, 0x403: 0x000d, 0x404: 0x000d, 0x405: 0x000d, + 0x406: 0x000d, 0x407: 0x000d, 0x408: 0x000d, 0x409: 0x000d, 0x40a: 0x000d, 0x40b: 0x000d, + 0x40c: 0x000d, 0x40d: 0x000d, 0x40e: 0x000d, 0x40f: 0x000d, 0x410: 0x000d, 0x411: 0x000d, + 0x412: 0x000d, 0x413: 0x000d, 0x414: 0x000d, 0x415: 0x000d, 0x416: 0x000d, 0x417: 0x000d, + 0x418: 0x000d, 0x419: 0x000d, 0x41a: 0x000d, 0x41b: 0x000d, 0x41c: 0x000d, 0x41d: 0x000d, + 0x41e: 0x000d, 0x41f: 0x000d, 0x420: 0x000d, 0x421: 0x000d, 0x422: 0x000d, 0x423: 0x000d, + 0x424: 0x000d, 0x425: 0x000d, 0x426: 0x000d, 0x427: 0x000d, 0x428: 0x000d, 0x429: 0x000d, + 0x42a: 0x000d, 0x42b: 0x000d, 0x42c: 0x000d, 0x42d: 0x000d, 0x42e: 0x000d, 0x42f: 0x000d, + 0x430: 0x000d, 0x431: 0x000d, 0x432: 0x000d, 0x433: 0x000d, 0x434: 0x000d, 0x435: 0x000d, + 0x436: 0x000d, 0x437: 0x000d, 0x438: 0x000d, 0x439: 0x000d, 0x43a: 0x000d, 0x43b: 0x000d, + 0x43c: 0x000d, 0x43d: 0x000d, 0x43e: 0x000d, 0x43f: 0x000d, + // Block 0x11, offset 0x440 + 0x440: 0x000d, 0x441: 0x000d, 0x442: 0x000d, 0x443: 0x000d, 0x444: 0x000d, 0x445: 0x000d, + 0x446: 0x000d, 0x447: 0x000d, 0x448: 0x000d, 0x449: 0x000d, 0x44a: 0x000d, 0x44b: 0x000d, + 0x44c: 0x000d, 0x44d: 0x000d, 0x44e: 0x000d, 0x44f: 0x000d, 0x450: 0x000d, 0x451: 0x000d, + 0x452: 0x000d, 0x453: 0x000d, 0x454: 0x000d, 0x455: 0x000d, 0x456: 0x000c, 0x457: 0x000c, + 0x458: 0x000c, 0x459: 0x000c, 0x45a: 0x000c, 0x45b: 0x000c, 0x45c: 0x000c, 0x45d: 0x0005, + 0x45e: 0x000a, 0x45f: 0x000c, 0x460: 0x000c, 0x461: 0x000c, 0x462: 0x000c, 0x463: 0x000c, + 0x464: 0x000c, 0x465: 0x000d, 0x466: 0x000d, 0x467: 0x000c, 0x468: 0x000c, 0x469: 0x000a, + 0x46a: 0x000c, 0x46b: 0x000c, 0x46c: 0x000c, 0x46d: 0x000c, 0x46e: 0x000d, 0x46f: 0x000d, + 0x470: 0x0002, 0x471: 0x0002, 0x472: 0x0002, 0x473: 0x0002, 0x474: 0x0002, 0x475: 0x0002, + 0x476: 0x0002, 0x477: 0x0002, 0x478: 0x0002, 0x479: 0x0002, 0x47a: 0x000d, 0x47b: 0x000d, + 0x47c: 0x000d, 0x47d: 0x000d, 0x47e: 0x000d, 0x47f: 0x000d, + // Block 0x12, offset 0x480 + 0x480: 0x000d, 0x481: 0x000d, 0x482: 0x000d, 0x483: 0x000d, 0x484: 0x000d, 0x485: 0x000d, + 0x486: 0x000d, 0x487: 0x000d, 0x488: 0x000d, 0x489: 0x000d, 0x48a: 0x000d, 0x48b: 0x000d, + 0x48c: 0x000d, 0x48d: 0x000d, 0x48e: 0x000d, 0x48f: 0x000d, 0x490: 0x000d, 0x491: 0x000c, + 0x492: 0x000d, 0x493: 0x000d, 0x494: 0x000d, 0x495: 0x000d, 0x496: 0x000d, 0x497: 0x000d, + 0x498: 0x000d, 0x499: 0x000d, 0x49a: 0x000d, 0x49b: 0x000d, 0x49c: 0x000d, 0x49d: 0x000d, + 0x49e: 0x000d, 0x49f: 0x000d, 0x4a0: 0x000d, 0x4a1: 0x000d, 0x4a2: 0x000d, 0x4a3: 0x000d, + 0x4a4: 0x000d, 0x4a5: 0x000d, 0x4a6: 0x000d, 0x4a7: 0x000d, 0x4a8: 0x000d, 0x4a9: 0x000d, + 0x4aa: 0x000d, 0x4ab: 0x000d, 0x4ac: 0x000d, 0x4ad: 0x000d, 0x4ae: 0x000d, 0x4af: 0x000d, + 0x4b0: 0x000c, 0x4b1: 0x000c, 0x4b2: 0x000c, 0x4b3: 0x000c, 0x4b4: 0x000c, 0x4b5: 0x000c, + 0x4b6: 0x000c, 0x4b7: 0x000c, 0x4b8: 0x000c, 0x4b9: 0x000c, 0x4ba: 0x000c, 0x4bb: 0x000c, + 0x4bc: 0x000c, 0x4bd: 0x000c, 0x4be: 0x000c, 0x4bf: 0x000c, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x000c, 0x4c1: 0x000c, 0x4c2: 0x000c, 0x4c3: 0x000c, 0x4c4: 0x000c, 0x4c5: 0x000c, + 0x4c6: 0x000c, 0x4c7: 0x000c, 0x4c8: 0x000c, 0x4c9: 0x000c, 0x4ca: 0x000c, 0x4cb: 0x000d, + 0x4cc: 0x000d, 0x4cd: 0x000d, 0x4ce: 0x000d, 0x4cf: 0x000d, 0x4d0: 0x000d, 0x4d1: 0x000d, + 0x4d2: 0x000d, 0x4d3: 0x000d, 0x4d4: 0x000d, 0x4d5: 0x000d, 0x4d6: 0x000d, 0x4d7: 0x000d, + 0x4d8: 0x000d, 0x4d9: 0x000d, 0x4da: 0x000d, 0x4db: 0x000d, 0x4dc: 0x000d, 0x4dd: 0x000d, + 0x4de: 0x000d, 0x4df: 0x000d, 0x4e0: 0x000d, 0x4e1: 0x000d, 0x4e2: 0x000d, 0x4e3: 0x000d, + 0x4e4: 0x000d, 0x4e5: 0x000d, 0x4e6: 0x000d, 0x4e7: 0x000d, 0x4e8: 0x000d, 0x4e9: 0x000d, + 0x4ea: 0x000d, 0x4eb: 0x000d, 0x4ec: 0x000d, 0x4ed: 0x000d, 0x4ee: 0x000d, 0x4ef: 0x000d, + 0x4f0: 0x000d, 0x4f1: 0x000d, 0x4f2: 0x000d, 0x4f3: 0x000d, 0x4f4: 0x000d, 0x4f5: 0x000d, + 0x4f6: 0x000d, 0x4f7: 0x000d, 0x4f8: 0x000d, 0x4f9: 0x000d, 0x4fa: 0x000d, 0x4fb: 0x000d, + 0x4fc: 0x000d, 0x4fd: 0x000d, 0x4fe: 0x000d, 0x4ff: 0x000d, + // Block 0x14, offset 0x500 + 0x500: 0x000d, 0x501: 0x000d, 0x502: 0x000d, 0x503: 0x000d, 0x504: 0x000d, 0x505: 0x000d, + 0x506: 0x000d, 0x507: 0x000d, 0x508: 0x000d, 0x509: 0x000d, 0x50a: 0x000d, 0x50b: 0x000d, + 0x50c: 0x000d, 0x50d: 0x000d, 0x50e: 0x000d, 0x50f: 0x000d, 0x510: 0x000d, 0x511: 0x000d, + 0x512: 0x000d, 0x513: 0x000d, 0x514: 0x000d, 0x515: 0x000d, 0x516: 0x000d, 0x517: 0x000d, + 0x518: 0x000d, 0x519: 0x000d, 0x51a: 0x000d, 0x51b: 0x000d, 0x51c: 0x000d, 0x51d: 0x000d, + 0x51e: 0x000d, 0x51f: 0x000d, 0x520: 0x000d, 0x521: 0x000d, 0x522: 0x000d, 0x523: 0x000d, + 0x524: 0x000d, 0x525: 0x000d, 0x526: 0x000c, 0x527: 0x000c, 0x528: 0x000c, 0x529: 0x000c, + 0x52a: 0x000c, 0x52b: 0x000c, 0x52c: 0x000c, 0x52d: 0x000c, 0x52e: 0x000c, 0x52f: 0x000c, + 0x530: 0x000c, 0x531: 0x000d, 0x532: 0x000d, 0x533: 0x000d, 0x534: 0x000d, 0x535: 0x000d, + 0x536: 0x000d, 0x537: 0x000d, 0x538: 0x000d, 0x539: 0x000d, 0x53a: 0x000d, 0x53b: 0x000d, + 0x53c: 0x000d, 0x53d: 0x000d, 0x53e: 0x000d, 0x53f: 0x000d, + // Block 0x15, offset 0x540 + 0x540: 0x0001, 0x541: 0x0001, 0x542: 0x0001, 0x543: 0x0001, 0x544: 0x0001, 0x545: 0x0001, + 0x546: 0x0001, 0x547: 0x0001, 0x548: 0x0001, 0x549: 0x0001, 0x54a: 0x0001, 0x54b: 0x0001, + 0x54c: 0x0001, 0x54d: 0x0001, 0x54e: 0x0001, 0x54f: 0x0001, 0x550: 0x0001, 0x551: 0x0001, + 0x552: 0x0001, 0x553: 0x0001, 0x554: 0x0001, 0x555: 0x0001, 0x556: 0x0001, 0x557: 0x0001, + 0x558: 0x0001, 0x559: 0x0001, 0x55a: 0x0001, 0x55b: 0x0001, 0x55c: 0x0001, 0x55d: 0x0001, + 0x55e: 0x0001, 0x55f: 0x0001, 0x560: 0x0001, 0x561: 0x0001, 0x562: 0x0001, 0x563: 0x0001, + 0x564: 0x0001, 0x565: 0x0001, 0x566: 0x0001, 0x567: 0x0001, 0x568: 0x0001, 0x569: 0x0001, + 0x56a: 0x0001, 0x56b: 0x000c, 0x56c: 0x000c, 0x56d: 0x000c, 0x56e: 0x000c, 0x56f: 0x000c, + 0x570: 0x000c, 0x571: 0x000c, 0x572: 0x000c, 0x573: 0x000c, 0x574: 0x0001, 0x575: 0x0001, + 0x576: 0x000a, 0x577: 0x000a, 0x578: 0x000a, 0x579: 0x000a, 0x57a: 0x0001, 0x57b: 0x0001, + 0x57c: 0x0001, 0x57d: 0x000c, 0x57e: 0x0001, 0x57f: 0x0001, + // Block 0x16, offset 0x580 + 0x580: 0x0001, 0x581: 0x0001, 0x582: 0x0001, 0x583: 0x0001, 0x584: 0x0001, 0x585: 0x0001, + 0x586: 0x0001, 0x587: 0x0001, 0x588: 0x0001, 0x589: 0x0001, 0x58a: 0x0001, 0x58b: 0x0001, + 0x58c: 0x0001, 0x58d: 0x0001, 0x58e: 0x0001, 0x58f: 0x0001, 0x590: 0x0001, 0x591: 0x0001, + 0x592: 0x0001, 0x593: 0x0001, 0x594: 0x0001, 0x595: 0x0001, 0x596: 0x000c, 0x597: 0x000c, + 0x598: 0x000c, 0x599: 0x000c, 0x59a: 0x0001, 0x59b: 0x000c, 0x59c: 0x000c, 0x59d: 0x000c, + 0x59e: 0x000c, 0x59f: 0x000c, 0x5a0: 0x000c, 0x5a1: 0x000c, 0x5a2: 0x000c, 0x5a3: 0x000c, + 0x5a4: 0x0001, 0x5a5: 0x000c, 0x5a6: 0x000c, 0x5a7: 0x000c, 0x5a8: 0x0001, 0x5a9: 0x000c, + 0x5aa: 0x000c, 0x5ab: 0x000c, 0x5ac: 0x000c, 0x5ad: 0x000c, 0x5ae: 0x0001, 0x5af: 0x0001, + 0x5b0: 0x0001, 0x5b1: 0x0001, 0x5b2: 0x0001, 0x5b3: 0x0001, 0x5b4: 0x0001, 0x5b5: 0x0001, + 0x5b6: 0x0001, 0x5b7: 0x0001, 0x5b8: 0x0001, 0x5b9: 0x0001, 0x5ba: 0x0001, 0x5bb: 0x0001, + 0x5bc: 0x0001, 0x5bd: 0x0001, 0x5be: 0x0001, 0x5bf: 0x0001, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x0001, 0x5c1: 0x0001, 0x5c2: 0x0001, 0x5c3: 0x0001, 0x5c4: 0x0001, 0x5c5: 0x0001, + 0x5c6: 0x0001, 0x5c7: 0x0001, 0x5c8: 0x0001, 0x5c9: 0x0001, 0x5ca: 0x0001, 0x5cb: 0x0001, + 0x5cc: 0x0001, 0x5cd: 0x0001, 0x5ce: 0x0001, 0x5cf: 0x0001, 0x5d0: 0x0001, 0x5d1: 0x0001, + 0x5d2: 0x0001, 0x5d3: 0x0001, 0x5d4: 0x0001, 0x5d5: 0x0001, 0x5d6: 0x0001, 0x5d7: 0x0001, + 0x5d8: 0x0001, 0x5d9: 0x000c, 0x5da: 0x000c, 0x5db: 0x000c, 0x5dc: 0x0001, 0x5dd: 0x0001, + 0x5de: 0x0001, 0x5df: 0x0001, 0x5e0: 0x000d, 0x5e1: 0x000d, 0x5e2: 0x000d, 0x5e3: 0x000d, + 0x5e4: 0x000d, 0x5e5: 0x000d, 0x5e6: 0x000d, 0x5e7: 0x000d, 0x5e8: 0x000d, 0x5e9: 0x000d, + 0x5ea: 0x000d, 0x5eb: 0x0001, 0x5ec: 0x0001, 0x5ed: 0x0001, 0x5ee: 0x0001, 0x5ef: 0x0001, + 0x5f0: 0x000d, 0x5f1: 0x000d, 0x5f2: 0x000d, 0x5f3: 0x000d, 0x5f4: 0x000d, 0x5f5: 0x000d, + 0x5f6: 0x000d, 0x5f7: 0x000d, 0x5f8: 0x000d, 0x5f9: 0x000d, 0x5fa: 0x000d, 0x5fb: 0x000d, + 0x5fc: 0x000d, 0x5fd: 0x000d, 0x5fe: 0x000d, 0x5ff: 0x000d, + // Block 0x18, offset 0x600 + 0x600: 0x000d, 0x601: 0x000d, 0x602: 0x000d, 0x603: 0x000d, 0x604: 0x000d, 0x605: 0x000d, + 0x606: 0x000d, 0x607: 0x000d, 0x608: 0x000d, 0x609: 0x000d, 0x60a: 0x000d, 0x60b: 0x000d, + 0x60c: 0x000d, 0x60d: 0x000d, 0x60e: 0x000d, 0x60f: 0x0001, 0x610: 0x0005, 0x611: 0x0005, + 0x612: 0x0001, 0x613: 0x0001, 0x614: 0x0001, 0x615: 0x0001, 0x616: 0x0001, 0x617: 0x0001, + 0x618: 0x000c, 0x619: 0x000c, 0x61a: 0x000c, 0x61b: 0x000c, 0x61c: 0x000c, 0x61d: 0x000c, + 0x61e: 0x000c, 0x61f: 0x000c, 0x620: 0x000d, 0x621: 0x000d, 0x622: 0x000d, 0x623: 0x000d, + 0x624: 0x000d, 0x625: 0x000d, 0x626: 0x000d, 0x627: 0x000d, 0x628: 0x000d, 0x629: 0x000d, + 0x62a: 0x000d, 0x62b: 0x000d, 0x62c: 0x000d, 0x62d: 0x000d, 0x62e: 0x000d, 0x62f: 0x000d, + 0x630: 0x000d, 0x631: 0x000d, 0x632: 0x000d, 0x633: 0x000d, 0x634: 0x000d, 0x635: 0x000d, + 0x636: 0x000d, 0x637: 0x000d, 0x638: 0x000d, 0x639: 0x000d, 0x63a: 0x000d, 0x63b: 0x000d, + 0x63c: 0x000d, 0x63d: 0x000d, 0x63e: 0x000d, 0x63f: 0x000d, + // Block 0x19, offset 0x640 + 0x640: 0x000d, 0x641: 0x000d, 0x642: 0x000d, 0x643: 0x000d, 0x644: 0x000d, 0x645: 0x000d, + 0x646: 0x000d, 0x647: 0x000d, 0x648: 0x000d, 0x649: 0x000d, 0x64a: 0x000c, 0x64b: 0x000c, + 0x64c: 0x000c, 0x64d: 0x000c, 0x64e: 0x000c, 0x64f: 0x000c, 0x650: 0x000c, 0x651: 0x000c, + 0x652: 0x000c, 0x653: 0x000c, 0x654: 0x000c, 0x655: 0x000c, 0x656: 0x000c, 0x657: 0x000c, + 0x658: 0x000c, 0x659: 0x000c, 0x65a: 0x000c, 0x65b: 0x000c, 0x65c: 0x000c, 0x65d: 0x000c, + 0x65e: 0x000c, 0x65f: 0x000c, 0x660: 0x000c, 0x661: 0x000c, 0x662: 0x0005, 0x663: 0x000c, + 0x664: 0x000c, 0x665: 0x000c, 0x666: 0x000c, 0x667: 0x000c, 0x668: 0x000c, 0x669: 0x000c, + 0x66a: 0x000c, 0x66b: 0x000c, 0x66c: 0x000c, 0x66d: 0x000c, 0x66e: 0x000c, 0x66f: 0x000c, + 0x670: 0x000c, 0x671: 0x000c, 0x672: 0x000c, 0x673: 0x000c, 0x674: 0x000c, 0x675: 0x000c, + 0x676: 0x000c, 0x677: 0x000c, 0x678: 0x000c, 0x679: 0x000c, 0x67a: 0x000c, 0x67b: 0x000c, + 0x67c: 0x000c, 0x67d: 0x000c, 0x67e: 0x000c, 0x67f: 0x000c, + // Block 0x1a, offset 0x680 + 0x680: 0x000c, 0x681: 0x000c, 0x682: 0x000c, + 0x6ba: 0x000c, + 0x6bc: 0x000c, + // Block 0x1b, offset 0x6c0 + 0x6c1: 0x000c, 0x6c2: 0x000c, 0x6c3: 0x000c, 0x6c4: 0x000c, 0x6c5: 0x000c, + 0x6c6: 0x000c, 0x6c7: 0x000c, 0x6c8: 0x000c, + 0x6cd: 0x000c, 0x6d1: 0x000c, + 0x6d2: 0x000c, 0x6d3: 0x000c, 0x6d4: 0x000c, 0x6d5: 0x000c, 0x6d6: 0x000c, 0x6d7: 0x000c, + 0x6e2: 0x000c, 0x6e3: 0x000c, + // Block 0x1c, offset 0x700 + 0x701: 0x000c, + 0x73c: 0x000c, + // Block 0x1d, offset 0x740 + 0x741: 0x000c, 0x742: 0x000c, 0x743: 0x000c, 0x744: 0x000c, + 0x74d: 0x000c, + 0x762: 0x000c, 0x763: 0x000c, + 0x772: 0x0004, 0x773: 0x0004, + 0x77b: 0x0004, + 0x77e: 0x000c, + // Block 0x1e, offset 0x780 + 0x781: 0x000c, 0x782: 0x000c, + 0x7bc: 0x000c, + // Block 0x1f, offset 0x7c0 + 0x7c1: 0x000c, 0x7c2: 0x000c, + 0x7c7: 0x000c, 0x7c8: 0x000c, 0x7cb: 0x000c, + 0x7cc: 0x000c, 0x7cd: 0x000c, 0x7d1: 0x000c, + 0x7f0: 0x000c, 0x7f1: 0x000c, 0x7f5: 0x000c, + // Block 0x20, offset 0x800 + 0x801: 0x000c, 0x802: 0x000c, 0x803: 0x000c, 0x804: 0x000c, 0x805: 0x000c, + 0x807: 0x000c, 0x808: 0x000c, + 0x80d: 0x000c, + 0x822: 0x000c, 0x823: 0x000c, + 0x831: 0x0004, + 0x83a: 0x000c, 0x83b: 0x000c, + 0x83c: 0x000c, 0x83d: 0x000c, 0x83e: 0x000c, 0x83f: 0x000c, + // Block 0x21, offset 0x840 + 0x841: 0x000c, + 0x87c: 0x000c, 0x87f: 0x000c, + // Block 0x22, offset 0x880 + 0x881: 0x000c, 0x882: 0x000c, 0x883: 0x000c, 0x884: 0x000c, + 0x88d: 0x000c, + 0x895: 0x000c, 0x896: 0x000c, + 0x8a2: 0x000c, 0x8a3: 0x000c, + // Block 0x23, offset 0x8c0 + 0x8c2: 0x000c, + // Block 0x24, offset 0x900 + 0x900: 0x000c, + 0x90d: 0x000c, + 0x933: 0x000a, 0x934: 0x000a, 0x935: 0x000a, + 0x936: 0x000a, 0x937: 0x000a, 0x938: 0x000a, 0x939: 0x0004, 0x93a: 0x000a, + // Block 0x25, offset 0x940 + 0x940: 0x000c, 0x944: 0x000c, + 0x97c: 0x000c, 0x97e: 0x000c, 0x97f: 0x000c, + // Block 0x26, offset 0x980 + 0x980: 0x000c, + 0x986: 0x000c, 0x987: 0x000c, 0x988: 0x000c, 0x98a: 0x000c, 0x98b: 0x000c, + 0x98c: 0x000c, 0x98d: 0x000c, + 0x995: 0x000c, 0x996: 0x000c, + 0x9a2: 0x000c, 0x9a3: 0x000c, + 0x9b8: 0x000a, 0x9b9: 0x000a, 0x9ba: 0x000a, 0x9bb: 0x000a, + 0x9bc: 0x000a, 0x9bd: 0x000a, 0x9be: 0x000a, + // Block 0x27, offset 0x9c0 + 0x9cc: 0x000c, 0x9cd: 0x000c, + 0x9e2: 0x000c, 0x9e3: 0x000c, + // Block 0x28, offset 0xa00 + 0xa00: 0x000c, 0xa01: 0x000c, + 0xa3b: 0x000c, + 0xa3c: 0x000c, + // Block 0x29, offset 0xa40 + 0xa41: 0x000c, 0xa42: 0x000c, 0xa43: 0x000c, 0xa44: 0x000c, + 0xa4d: 0x000c, + 0xa62: 0x000c, 0xa63: 0x000c, + // Block 0x2a, offset 0xa80 + 0xa81: 0x000c, + // Block 0x2b, offset 0xac0 + 0xaca: 0x000c, + 0xad2: 0x000c, 0xad3: 0x000c, 0xad4: 0x000c, 0xad6: 0x000c, + // Block 0x2c, offset 0xb00 + 0xb31: 0x000c, 0xb34: 0x000c, 0xb35: 0x000c, + 0xb36: 0x000c, 0xb37: 0x000c, 0xb38: 0x000c, 0xb39: 0x000c, 0xb3a: 0x000c, + 0xb3f: 0x0004, + // Block 0x2d, offset 0xb40 + 0xb47: 0x000c, 0xb48: 0x000c, 0xb49: 0x000c, 0xb4a: 0x000c, 0xb4b: 0x000c, + 0xb4c: 0x000c, 0xb4d: 0x000c, 0xb4e: 0x000c, + // Block 0x2e, offset 0xb80 + 0xbb1: 0x000c, 0xbb4: 0x000c, 0xbb5: 0x000c, + 0xbb6: 0x000c, 0xbb7: 0x000c, 0xbb8: 0x000c, 0xbb9: 0x000c, 0xbba: 0x000c, 0xbbb: 0x000c, + 0xbbc: 0x000c, + // Block 0x2f, offset 0xbc0 + 0xbc8: 0x000c, 0xbc9: 0x000c, 0xbca: 0x000c, 0xbcb: 0x000c, + 0xbcc: 0x000c, 0xbcd: 0x000c, 0xbce: 0x000c, + // Block 0x30, offset 0xc00 + 0xc18: 0x000c, 0xc19: 0x000c, + 0xc35: 0x000c, + 0xc37: 0x000c, 0xc39: 0x000c, 0xc3a: 0x003a, 0xc3b: 0x002a, + 0xc3c: 0x003a, 0xc3d: 0x002a, + // Block 0x31, offset 0xc40 + 0xc71: 0x000c, 0xc72: 0x000c, 0xc73: 0x000c, 0xc74: 0x000c, 0xc75: 0x000c, + 0xc76: 0x000c, 0xc77: 0x000c, 0xc78: 0x000c, 0xc79: 0x000c, 0xc7a: 0x000c, 0xc7b: 0x000c, + 0xc7c: 0x000c, 0xc7d: 0x000c, 0xc7e: 0x000c, + // Block 0x32, offset 0xc80 + 0xc80: 0x000c, 0xc81: 0x000c, 0xc82: 0x000c, 0xc83: 0x000c, 0xc84: 0x000c, + 0xc86: 0x000c, 0xc87: 0x000c, + 0xc8d: 0x000c, 0xc8e: 0x000c, 0xc8f: 0x000c, 0xc90: 0x000c, 0xc91: 0x000c, + 0xc92: 0x000c, 0xc93: 0x000c, 0xc94: 0x000c, 0xc95: 0x000c, 0xc96: 0x000c, 0xc97: 0x000c, + 0xc99: 0x000c, 0xc9a: 0x000c, 0xc9b: 0x000c, 0xc9c: 0x000c, 0xc9d: 0x000c, + 0xc9e: 0x000c, 0xc9f: 0x000c, 0xca0: 0x000c, 0xca1: 0x000c, 0xca2: 0x000c, 0xca3: 0x000c, + 0xca4: 0x000c, 0xca5: 0x000c, 0xca6: 0x000c, 0xca7: 0x000c, 0xca8: 0x000c, 0xca9: 0x000c, + 0xcaa: 0x000c, 0xcab: 0x000c, 0xcac: 0x000c, 0xcad: 0x000c, 0xcae: 0x000c, 0xcaf: 0x000c, + 0xcb0: 0x000c, 0xcb1: 0x000c, 0xcb2: 0x000c, 0xcb3: 0x000c, 0xcb4: 0x000c, 0xcb5: 0x000c, + 0xcb6: 0x000c, 0xcb7: 0x000c, 0xcb8: 0x000c, 0xcb9: 0x000c, 0xcba: 0x000c, 0xcbb: 0x000c, + 0xcbc: 0x000c, + // Block 0x33, offset 0xcc0 + 0xcc6: 0x000c, + // Block 0x34, offset 0xd00 + 0xd2d: 0x000c, 0xd2e: 0x000c, 0xd2f: 0x000c, + 0xd30: 0x000c, 0xd32: 0x000c, 0xd33: 0x000c, 0xd34: 0x000c, 0xd35: 0x000c, + 0xd36: 0x000c, 0xd37: 0x000c, 0xd39: 0x000c, 0xd3a: 0x000c, + 0xd3d: 0x000c, 0xd3e: 0x000c, + // Block 0x35, offset 0xd40 + 0xd58: 0x000c, 0xd59: 0x000c, + 0xd5e: 0x000c, 0xd5f: 0x000c, 0xd60: 0x000c, + 0xd71: 0x000c, 0xd72: 0x000c, 0xd73: 0x000c, 0xd74: 0x000c, + // Block 0x36, offset 0xd80 + 0xd82: 0x000c, 0xd85: 0x000c, + 0xd86: 0x000c, + 0xd8d: 0x000c, + 0xd9d: 0x000c, + // Block 0x37, offset 0xdc0 + 0xddd: 0x000c, + 0xdde: 0x000c, 0xddf: 0x000c, + // Block 0x38, offset 0xe00 + 0xe10: 0x000a, 0xe11: 0x000a, + 0xe12: 0x000a, 0xe13: 0x000a, 0xe14: 0x000a, 0xe15: 0x000a, 0xe16: 0x000a, 0xe17: 0x000a, + 0xe18: 0x000a, 0xe19: 0x000a, + // Block 0x39, offset 0xe40 + 0xe40: 0x000a, + // Block 0x3a, offset 0xe80 + 0xe80: 0x0009, + 0xe9b: 0x007a, 0xe9c: 0x006a, + // Block 0x3b, offset 0xec0 + 0xed2: 0x000c, 0xed3: 0x000c, 0xed4: 0x000c, + 0xef2: 0x000c, 0xef3: 0x000c, + // Block 0x3c, offset 0xf00 + 0xf12: 0x000c, 0xf13: 0x000c, + 0xf32: 0x000c, 0xf33: 0x000c, + // Block 0x3d, offset 0xf40 + 0xf74: 0x000c, 0xf75: 0x000c, + 0xf77: 0x000c, 0xf78: 0x000c, 0xf79: 0x000c, 0xf7a: 0x000c, 0xf7b: 0x000c, + 0xf7c: 0x000c, 0xf7d: 0x000c, + // Block 0x3e, offset 0xf80 + 0xf86: 0x000c, 0xf89: 0x000c, 0xf8a: 0x000c, 0xf8b: 0x000c, + 0xf8c: 0x000c, 0xf8d: 0x000c, 0xf8e: 0x000c, 0xf8f: 0x000c, 0xf90: 0x000c, 0xf91: 0x000c, + 0xf92: 0x000c, 0xf93: 0x000c, + 0xf9b: 0x0004, 0xf9d: 0x000c, + 0xfb0: 0x000a, 0xfb1: 0x000a, 0xfb2: 0x000a, 0xfb3: 0x000a, 0xfb4: 0x000a, 0xfb5: 0x000a, + 0xfb6: 0x000a, 0xfb7: 0x000a, 0xfb8: 0x000a, 0xfb9: 0x000a, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x000a, 0xfc1: 0x000a, 0xfc2: 0x000a, 0xfc3: 0x000a, 0xfc4: 0x000a, 0xfc5: 0x000a, + 0xfc6: 0x000a, 0xfc7: 0x000a, 0xfc8: 0x000a, 0xfc9: 0x000a, 0xfca: 0x000a, 0xfcb: 0x000c, + 0xfcc: 0x000c, 0xfcd: 0x000c, 0xfce: 0x000b, 0xfcf: 0x000c, + // Block 0x40, offset 0x1000 + 0x1005: 0x000c, + 0x1006: 0x000c, + 0x1029: 0x000c, + // Block 0x41, offset 0x1040 + 0x1060: 0x000c, 0x1061: 0x000c, 0x1062: 0x000c, + 0x1067: 0x000c, 0x1068: 0x000c, + 0x1072: 0x000c, + 0x1079: 0x000c, 0x107a: 0x000c, 0x107b: 0x000c, + // Block 0x42, offset 0x1080 + 0x1080: 0x000a, 0x1084: 0x000a, 0x1085: 0x000a, + // Block 0x43, offset 0x10c0 + 0x10de: 0x000a, 0x10df: 0x000a, 0x10e0: 0x000a, 0x10e1: 0x000a, 0x10e2: 0x000a, 0x10e3: 0x000a, + 0x10e4: 0x000a, 0x10e5: 0x000a, 0x10e6: 0x000a, 0x10e7: 0x000a, 0x10e8: 0x000a, 0x10e9: 0x000a, + 0x10ea: 0x000a, 0x10eb: 0x000a, 0x10ec: 0x000a, 0x10ed: 0x000a, 0x10ee: 0x000a, 0x10ef: 0x000a, + 0x10f0: 0x000a, 0x10f1: 0x000a, 0x10f2: 0x000a, 0x10f3: 0x000a, 0x10f4: 0x000a, 0x10f5: 0x000a, + 0x10f6: 0x000a, 0x10f7: 0x000a, 0x10f8: 0x000a, 0x10f9: 0x000a, 0x10fa: 0x000a, 0x10fb: 0x000a, + 0x10fc: 0x000a, 0x10fd: 0x000a, 0x10fe: 0x000a, 0x10ff: 0x000a, + // Block 0x44, offset 0x1100 + 0x1117: 0x000c, + 0x1118: 0x000c, 0x111b: 0x000c, + // Block 0x45, offset 0x1140 + 0x1156: 0x000c, + 0x1158: 0x000c, 0x1159: 0x000c, 0x115a: 0x000c, 0x115b: 0x000c, 0x115c: 0x000c, 0x115d: 0x000c, + 0x115e: 0x000c, 0x1160: 0x000c, 0x1162: 0x000c, + 0x1165: 0x000c, 0x1166: 0x000c, 0x1167: 0x000c, 0x1168: 0x000c, 0x1169: 0x000c, + 0x116a: 0x000c, 0x116b: 0x000c, 0x116c: 0x000c, + 0x1173: 0x000c, 0x1174: 0x000c, 0x1175: 0x000c, + 0x1176: 0x000c, 0x1177: 0x000c, 0x1178: 0x000c, 0x1179: 0x000c, 0x117a: 0x000c, 0x117b: 0x000c, + 0x117c: 0x000c, 0x117f: 0x000c, + // Block 0x46, offset 0x1180 + 0x11b0: 0x000c, 0x11b1: 0x000c, 0x11b2: 0x000c, 0x11b3: 0x000c, 0x11b4: 0x000c, 0x11b5: 0x000c, + 0x11b6: 0x000c, 0x11b7: 0x000c, 0x11b8: 0x000c, 0x11b9: 0x000c, 0x11ba: 0x000c, 0x11bb: 0x000c, + 0x11bc: 0x000c, 0x11bd: 0x000c, 0x11be: 0x000c, 0x11bf: 0x000c, + // Block 0x47, offset 0x11c0 + 0x11c0: 0x000c, 0x11c1: 0x000c, 0x11c2: 0x000c, 0x11c3: 0x000c, 0x11c4: 0x000c, 0x11c5: 0x000c, + 0x11c6: 0x000c, 0x11c7: 0x000c, 0x11c8: 0x000c, 0x11c9: 0x000c, 0x11ca: 0x000c, 0x11cb: 0x000c, + 0x11cc: 0x000c, 0x11cd: 0x000c, 0x11ce: 0x000c, + // Block 0x48, offset 0x1200 + 0x1200: 0x000c, 0x1201: 0x000c, 0x1202: 0x000c, 0x1203: 0x000c, + 0x1234: 0x000c, + 0x1236: 0x000c, 0x1237: 0x000c, 0x1238: 0x000c, 0x1239: 0x000c, 0x123a: 0x000c, + 0x123c: 0x000c, + // Block 0x49, offset 0x1240 + 0x1242: 0x000c, + 0x126b: 0x000c, 0x126c: 0x000c, 0x126d: 0x000c, 0x126e: 0x000c, 0x126f: 0x000c, + 0x1270: 0x000c, 0x1271: 0x000c, 0x1272: 0x000c, 0x1273: 0x000c, + // Block 0x4a, offset 0x1280 + 0x1280: 0x000c, 0x1281: 0x000c, + 0x12a2: 0x000c, 0x12a3: 0x000c, + 0x12a4: 0x000c, 0x12a5: 0x000c, 0x12a8: 0x000c, 0x12a9: 0x000c, + 0x12ab: 0x000c, 0x12ac: 0x000c, 0x12ad: 0x000c, + // Block 0x4b, offset 0x12c0 + 0x12e6: 0x000c, 0x12e8: 0x000c, 0x12e9: 0x000c, + 0x12ed: 0x000c, 0x12ef: 0x000c, + 0x12f0: 0x000c, 0x12f1: 0x000c, + // Block 0x4c, offset 0x1300 + 0x132c: 0x000c, 0x132d: 0x000c, 0x132e: 0x000c, 0x132f: 0x000c, + 0x1330: 0x000c, 0x1331: 0x000c, 0x1332: 0x000c, 0x1333: 0x000c, + 0x1336: 0x000c, 0x1337: 0x000c, + // Block 0x4d, offset 0x1340 + 0x1350: 0x000c, 0x1351: 0x000c, + 0x1352: 0x000c, 0x1354: 0x000c, 0x1355: 0x000c, 0x1356: 0x000c, 0x1357: 0x000c, + 0x1358: 0x000c, 0x1359: 0x000c, 0x135a: 0x000c, 0x135b: 0x000c, 0x135c: 0x000c, 0x135d: 0x000c, + 0x135e: 0x000c, 0x135f: 0x000c, 0x1360: 0x000c, 0x1362: 0x000c, 0x1363: 0x000c, + 0x1364: 0x000c, 0x1365: 0x000c, 0x1366: 0x000c, 0x1367: 0x000c, 0x1368: 0x000c, + 0x136d: 0x000c, + 0x1374: 0x000c, + 0x1378: 0x000c, 0x1379: 0x000c, + // Block 0x4e, offset 0x1380 + 0x13bd: 0x000a, 0x13bf: 0x000a, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x000a, 0x13c1: 0x000a, + 0x13cd: 0x000a, 0x13ce: 0x000a, 0x13cf: 0x000a, + 0x13dd: 0x000a, + 0x13de: 0x000a, 0x13df: 0x000a, + 0x13ed: 0x000a, 0x13ee: 0x000a, 0x13ef: 0x000a, + 0x13fd: 0x000a, 0x13fe: 0x000a, + // Block 0x50, offset 0x1400 + 0x1400: 0x0009, 0x1401: 0x0009, 0x1402: 0x0009, 0x1403: 0x0009, 0x1404: 0x0009, 0x1405: 0x0009, + 0x1406: 0x0009, 0x1407: 0x0009, 0x1408: 0x0009, 0x1409: 0x0009, 0x140a: 0x0009, 0x140b: 0x000b, + 0x140c: 0x000b, 0x140d: 0x000b, 0x140f: 0x0001, 0x1410: 0x000a, 0x1411: 0x000a, + 0x1412: 0x000a, 0x1413: 0x000a, 0x1414: 0x000a, 0x1415: 0x000a, 0x1416: 0x000a, 0x1417: 0x000a, + 0x1418: 0x000a, 0x1419: 0x000a, 0x141a: 0x000a, 0x141b: 0x000a, 0x141c: 0x000a, 0x141d: 0x000a, + 0x141e: 0x000a, 0x141f: 0x000a, 0x1420: 0x000a, 0x1421: 0x000a, 0x1422: 0x000a, 0x1423: 0x000a, + 0x1424: 0x000a, 0x1425: 0x000a, 0x1426: 0x000a, 0x1427: 0x000a, 0x1428: 0x0009, 0x1429: 0x0007, + 0x142a: 0x000e, 0x142b: 0x000e, 0x142c: 0x000e, 0x142d: 0x000e, 0x142e: 0x000e, 0x142f: 0x0006, + 0x1430: 0x0004, 0x1431: 0x0004, 0x1432: 0x0004, 0x1433: 0x0004, 0x1434: 0x0004, 0x1435: 0x000a, + 0x1436: 0x000a, 0x1437: 0x000a, 0x1438: 0x000a, 0x1439: 0x000a, 0x143a: 0x000a, 0x143b: 0x000a, + 0x143c: 0x000a, 0x143d: 0x000a, 0x143e: 0x000a, 0x143f: 0x000a, + // Block 0x51, offset 0x1440 + 0x1440: 0x000a, 0x1441: 0x000a, 0x1442: 0x000a, 0x1443: 0x000a, 0x1444: 0x0006, 0x1445: 0x009a, + 0x1446: 0x008a, 0x1447: 0x000a, 0x1448: 0x000a, 0x1449: 0x000a, 0x144a: 0x000a, 0x144b: 0x000a, + 0x144c: 0x000a, 0x144d: 0x000a, 0x144e: 0x000a, 0x144f: 0x000a, 0x1450: 0x000a, 0x1451: 0x000a, + 0x1452: 0x000a, 0x1453: 0x000a, 0x1454: 0x000a, 0x1455: 0x000a, 0x1456: 0x000a, 0x1457: 0x000a, + 0x1458: 0x000a, 0x1459: 0x000a, 0x145a: 0x000a, 0x145b: 0x000a, 0x145c: 0x000a, 0x145d: 0x000a, + 0x145e: 0x000a, 0x145f: 0x0009, 0x1460: 0x000b, 0x1461: 0x000b, 0x1462: 0x000b, 0x1463: 0x000b, + 0x1464: 0x000b, 0x1465: 0x000b, 0x1466: 0x000e, 0x1467: 0x000e, 0x1468: 0x000e, 0x1469: 0x000e, + 0x146a: 0x000b, 0x146b: 0x000b, 0x146c: 0x000b, 0x146d: 0x000b, 0x146e: 0x000b, 0x146f: 0x000b, + 0x1470: 0x0002, 0x1474: 0x0002, 0x1475: 0x0002, + 0x1476: 0x0002, 0x1477: 0x0002, 0x1478: 0x0002, 0x1479: 0x0002, 0x147a: 0x0003, 0x147b: 0x0003, + 0x147c: 0x000a, 0x147d: 0x009a, 0x147e: 0x008a, + // Block 0x52, offset 0x1480 + 0x1480: 0x0002, 0x1481: 0x0002, 0x1482: 0x0002, 0x1483: 0x0002, 0x1484: 0x0002, 0x1485: 0x0002, + 0x1486: 0x0002, 0x1487: 0x0002, 0x1488: 0x0002, 0x1489: 0x0002, 0x148a: 0x0003, 0x148b: 0x0003, + 0x148c: 0x000a, 0x148d: 0x009a, 0x148e: 0x008a, + 0x14a0: 0x0004, 0x14a1: 0x0004, 0x14a2: 0x0004, 0x14a3: 0x0004, + 0x14a4: 0x0004, 0x14a5: 0x0004, 0x14a6: 0x0004, 0x14a7: 0x0004, 0x14a8: 0x0004, 0x14a9: 0x0004, + 0x14aa: 0x0004, 0x14ab: 0x0004, 0x14ac: 0x0004, 0x14ad: 0x0004, 0x14ae: 0x0004, 0x14af: 0x0004, + 0x14b0: 0x0004, 0x14b1: 0x0004, 0x14b2: 0x0004, 0x14b3: 0x0004, 0x14b4: 0x0004, 0x14b5: 0x0004, + 0x14b6: 0x0004, 0x14b7: 0x0004, 0x14b8: 0x0004, 0x14b9: 0x0004, 0x14ba: 0x0004, 0x14bb: 0x0004, + 0x14bc: 0x0004, 0x14bd: 0x0004, 0x14be: 0x0004, 0x14bf: 0x0004, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x0004, 0x14c1: 0x0004, 0x14c2: 0x0004, 0x14c3: 0x0004, 0x14c4: 0x0004, 0x14c5: 0x0004, + 0x14c6: 0x0004, 0x14c7: 0x0004, 0x14c8: 0x0004, 0x14c9: 0x0004, 0x14ca: 0x0004, 0x14cb: 0x0004, + 0x14cc: 0x0004, 0x14cd: 0x0004, 0x14ce: 0x0004, 0x14cf: 0x0004, 0x14d0: 0x000c, 0x14d1: 0x000c, + 0x14d2: 0x000c, 0x14d3: 0x000c, 0x14d4: 0x000c, 0x14d5: 0x000c, 0x14d6: 0x000c, 0x14d7: 0x000c, + 0x14d8: 0x000c, 0x14d9: 0x000c, 0x14da: 0x000c, 0x14db: 0x000c, 0x14dc: 0x000c, 0x14dd: 0x000c, + 0x14de: 0x000c, 0x14df: 0x000c, 0x14e0: 0x000c, 0x14e1: 0x000c, 0x14e2: 0x000c, 0x14e3: 0x000c, + 0x14e4: 0x000c, 0x14e5: 0x000c, 0x14e6: 0x000c, 0x14e7: 0x000c, 0x14e8: 0x000c, 0x14e9: 0x000c, + 0x14ea: 0x000c, 0x14eb: 0x000c, 0x14ec: 0x000c, 0x14ed: 0x000c, 0x14ee: 0x000c, 0x14ef: 0x000c, + 0x14f0: 0x000c, + // Block 0x54, offset 0x1500 + 0x1500: 0x000a, 0x1501: 0x000a, 0x1503: 0x000a, 0x1504: 0x000a, 0x1505: 0x000a, + 0x1506: 0x000a, 0x1508: 0x000a, 0x1509: 0x000a, + 0x1514: 0x000a, 0x1516: 0x000a, 0x1517: 0x000a, + 0x1518: 0x000a, + 0x151e: 0x000a, 0x151f: 0x000a, 0x1520: 0x000a, 0x1521: 0x000a, 0x1522: 0x000a, 0x1523: 0x000a, + 0x1525: 0x000a, 0x1527: 0x000a, 0x1529: 0x000a, + 0x152e: 0x0004, + 0x153a: 0x000a, 0x153b: 0x000a, + // Block 0x55, offset 0x1540 + 0x1540: 0x000a, 0x1541: 0x000a, 0x1542: 0x000a, 0x1543: 0x000a, 0x1544: 0x000a, + 0x154a: 0x000a, 0x154b: 0x000a, + 0x154c: 0x000a, 0x154d: 0x000a, 0x1550: 0x000a, 0x1551: 0x000a, + 0x1552: 0x000a, 0x1553: 0x000a, 0x1554: 0x000a, 0x1555: 0x000a, 0x1556: 0x000a, 0x1557: 0x000a, + 0x1558: 0x000a, 0x1559: 0x000a, 0x155a: 0x000a, 0x155b: 0x000a, 0x155c: 0x000a, 0x155d: 0x000a, + 0x155e: 0x000a, 0x155f: 0x000a, + // Block 0x56, offset 0x1580 + 0x1589: 0x000a, 0x158a: 0x000a, 0x158b: 0x000a, + 0x1590: 0x000a, 0x1591: 0x000a, + 0x1592: 0x000a, 0x1593: 0x000a, 0x1594: 0x000a, 0x1595: 0x000a, 0x1596: 0x000a, 0x1597: 0x000a, + 0x1598: 0x000a, 0x1599: 0x000a, 0x159a: 0x000a, 0x159b: 0x000a, 0x159c: 0x000a, 0x159d: 0x000a, + 0x159e: 0x000a, 0x159f: 0x000a, 0x15a0: 0x000a, 0x15a1: 0x000a, 0x15a2: 0x000a, 0x15a3: 0x000a, + 0x15a4: 0x000a, 0x15a5: 0x000a, 0x15a6: 0x000a, 0x15a7: 0x000a, 0x15a8: 0x000a, 0x15a9: 0x000a, + 0x15aa: 0x000a, 0x15ab: 0x000a, 0x15ac: 0x000a, 0x15ad: 0x000a, 0x15ae: 0x000a, 0x15af: 0x000a, + 0x15b0: 0x000a, 0x15b1: 0x000a, 0x15b2: 0x000a, 0x15b3: 0x000a, 0x15b4: 0x000a, 0x15b5: 0x000a, + 0x15b6: 0x000a, 0x15b7: 0x000a, 0x15b8: 0x000a, 0x15b9: 0x000a, 0x15ba: 0x000a, 0x15bb: 0x000a, + 0x15bc: 0x000a, 0x15bd: 0x000a, 0x15be: 0x000a, 0x15bf: 0x000a, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x000a, 0x15c1: 0x000a, 0x15c2: 0x000a, 0x15c3: 0x000a, 0x15c4: 0x000a, 0x15c5: 0x000a, + 0x15c6: 0x000a, 0x15c7: 0x000a, 0x15c8: 0x000a, 0x15c9: 0x000a, 0x15ca: 0x000a, 0x15cb: 0x000a, + 0x15cc: 0x000a, 0x15cd: 0x000a, 0x15ce: 0x000a, 0x15cf: 0x000a, 0x15d0: 0x000a, 0x15d1: 0x000a, + 0x15d2: 0x000a, 0x15d3: 0x000a, 0x15d4: 0x000a, 0x15d5: 0x000a, 0x15d6: 0x000a, 0x15d7: 0x000a, + 0x15d8: 0x000a, 0x15d9: 0x000a, 0x15da: 0x000a, 0x15db: 0x000a, 0x15dc: 0x000a, 0x15dd: 0x000a, + 0x15de: 0x000a, 0x15df: 0x000a, 0x15e0: 0x000a, 0x15e1: 0x000a, 0x15e2: 0x000a, 0x15e3: 0x000a, + 0x15e4: 0x000a, 0x15e5: 0x000a, 0x15e6: 0x000a, 0x15e7: 0x000a, 0x15e8: 0x000a, 0x15e9: 0x000a, + 0x15ea: 0x000a, 0x15eb: 0x000a, 0x15ec: 0x000a, 0x15ed: 0x000a, 0x15ee: 0x000a, 0x15ef: 0x000a, + 0x15f0: 0x000a, 0x15f1: 0x000a, 0x15f2: 0x000a, 0x15f3: 0x000a, 0x15f4: 0x000a, 0x15f5: 0x000a, + 0x15f6: 0x000a, 0x15f7: 0x000a, 0x15f8: 0x000a, 0x15f9: 0x000a, 0x15fa: 0x000a, 0x15fb: 0x000a, + 0x15fc: 0x000a, 0x15fd: 0x000a, 0x15fe: 0x000a, 0x15ff: 0x000a, + // Block 0x58, offset 0x1600 + 0x1600: 0x000a, 0x1601: 0x000a, 0x1602: 0x000a, 0x1603: 0x000a, 0x1604: 0x000a, 0x1605: 0x000a, + 0x1606: 0x000a, 0x1607: 0x000a, 0x1608: 0x000a, 0x1609: 0x000a, 0x160a: 0x000a, 0x160b: 0x000a, + 0x160c: 0x000a, 0x160d: 0x000a, 0x160e: 0x000a, 0x160f: 0x000a, 0x1610: 0x000a, 0x1611: 0x000a, + 0x1612: 0x0003, 0x1613: 0x0004, 0x1614: 0x000a, 0x1615: 0x000a, 0x1616: 0x000a, 0x1617: 0x000a, + 0x1618: 0x000a, 0x1619: 0x000a, 0x161a: 0x000a, 0x161b: 0x000a, 0x161c: 0x000a, 0x161d: 0x000a, + 0x161e: 0x000a, 0x161f: 0x000a, 0x1620: 0x000a, 0x1621: 0x000a, 0x1622: 0x000a, 0x1623: 0x000a, + 0x1624: 0x000a, 0x1625: 0x000a, 0x1626: 0x000a, 0x1627: 0x000a, 0x1628: 0x000a, 0x1629: 0x000a, + 0x162a: 0x000a, 0x162b: 0x000a, 0x162c: 0x000a, 0x162d: 0x000a, 0x162e: 0x000a, 0x162f: 0x000a, + 0x1630: 0x000a, 0x1631: 0x000a, 0x1632: 0x000a, 0x1633: 0x000a, 0x1634: 0x000a, 0x1635: 0x000a, + 0x1636: 0x000a, 0x1637: 0x000a, 0x1638: 0x000a, 0x1639: 0x000a, 0x163a: 0x000a, 0x163b: 0x000a, + 0x163c: 0x000a, 0x163d: 0x000a, 0x163e: 0x000a, 0x163f: 0x000a, + // Block 0x59, offset 0x1640 + 0x1640: 0x000a, 0x1641: 0x000a, 0x1642: 0x000a, 0x1643: 0x000a, 0x1644: 0x000a, 0x1645: 0x000a, + 0x1646: 0x000a, 0x1647: 0x000a, 0x1648: 0x003a, 0x1649: 0x002a, 0x164a: 0x003a, 0x164b: 0x002a, + 0x164c: 0x000a, 0x164d: 0x000a, 0x164e: 0x000a, 0x164f: 0x000a, 0x1650: 0x000a, 0x1651: 0x000a, + 0x1652: 0x000a, 0x1653: 0x000a, 0x1654: 0x000a, 0x1655: 0x000a, 0x1656: 0x000a, 0x1657: 0x000a, + 0x1658: 0x000a, 0x1659: 0x000a, 0x165a: 0x000a, 0x165b: 0x000a, 0x165c: 0x000a, 0x165d: 0x000a, + 0x165e: 0x000a, 0x165f: 0x000a, 0x1660: 0x000a, 0x1661: 0x000a, 0x1662: 0x000a, 0x1663: 0x000a, + 0x1664: 0x000a, 0x1665: 0x000a, 0x1666: 0x000a, 0x1667: 0x000a, 0x1668: 0x000a, 0x1669: 0x009a, + 0x166a: 0x008a, 0x166b: 0x000a, 0x166c: 0x000a, 0x166d: 0x000a, 0x166e: 0x000a, 0x166f: 0x000a, + 0x1670: 0x000a, 0x1671: 0x000a, 0x1672: 0x000a, 0x1673: 0x000a, 0x1674: 0x000a, 0x1675: 0x000a, + // Block 0x5a, offset 0x1680 + 0x16bb: 0x000a, + 0x16bc: 0x000a, 0x16bd: 0x000a, 0x16be: 0x000a, 0x16bf: 0x000a, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x000a, 0x16c1: 0x000a, 0x16c2: 0x000a, 0x16c3: 0x000a, 0x16c4: 0x000a, 0x16c5: 0x000a, + 0x16c6: 0x000a, 0x16c7: 0x000a, 0x16c8: 0x000a, 0x16c9: 0x000a, 0x16ca: 0x000a, 0x16cb: 0x000a, + 0x16cc: 0x000a, 0x16cd: 0x000a, 0x16ce: 0x000a, 0x16cf: 0x000a, 0x16d0: 0x000a, 0x16d1: 0x000a, + 0x16d2: 0x000a, 0x16d3: 0x000a, 0x16d4: 0x000a, 0x16d6: 0x000a, 0x16d7: 0x000a, + 0x16d8: 0x000a, 0x16d9: 0x000a, 0x16da: 0x000a, 0x16db: 0x000a, 0x16dc: 0x000a, 0x16dd: 0x000a, + 0x16de: 0x000a, 0x16df: 0x000a, 0x16e0: 0x000a, 0x16e1: 0x000a, 0x16e2: 0x000a, 0x16e3: 0x000a, + 0x16e4: 0x000a, 0x16e5: 0x000a, 0x16e6: 0x000a, 0x16e7: 0x000a, 0x16e8: 0x000a, 0x16e9: 0x000a, + 0x16ea: 0x000a, 0x16eb: 0x000a, 0x16ec: 0x000a, 0x16ed: 0x000a, 0x16ee: 0x000a, 0x16ef: 0x000a, + 0x16f0: 0x000a, 0x16f1: 0x000a, 0x16f2: 0x000a, 0x16f3: 0x000a, 0x16f4: 0x000a, 0x16f5: 0x000a, + 0x16f6: 0x000a, 0x16f7: 0x000a, 0x16f8: 0x000a, 0x16f9: 0x000a, 0x16fa: 0x000a, 0x16fb: 0x000a, + 0x16fc: 0x000a, 0x16fd: 0x000a, 0x16fe: 0x000a, 0x16ff: 0x000a, + // Block 0x5c, offset 0x1700 + 0x1700: 0x000a, 0x1701: 0x000a, 0x1702: 0x000a, 0x1703: 0x000a, 0x1704: 0x000a, 0x1705: 0x000a, + 0x1706: 0x000a, 0x1707: 0x000a, 0x1708: 0x000a, 0x1709: 0x000a, 0x170a: 0x000a, 0x170b: 0x000a, + 0x170c: 0x000a, 0x170d: 0x000a, 0x170e: 0x000a, 0x170f: 0x000a, 0x1710: 0x000a, 0x1711: 0x000a, + 0x1712: 0x000a, 0x1713: 0x000a, 0x1714: 0x000a, 0x1715: 0x000a, 0x1716: 0x000a, 0x1717: 0x000a, + 0x1718: 0x000a, 0x1719: 0x000a, 0x171a: 0x000a, 0x171b: 0x000a, 0x171c: 0x000a, 0x171d: 0x000a, + 0x171e: 0x000a, 0x171f: 0x000a, 0x1720: 0x000a, 0x1721: 0x000a, 0x1722: 0x000a, 0x1723: 0x000a, + 0x1724: 0x000a, 0x1725: 0x000a, 0x1726: 0x000a, + // Block 0x5d, offset 0x1740 + 0x1740: 0x000a, 0x1741: 0x000a, 0x1742: 0x000a, 0x1743: 0x000a, 0x1744: 0x000a, 0x1745: 0x000a, + 0x1746: 0x000a, 0x1747: 0x000a, 0x1748: 0x000a, 0x1749: 0x000a, 0x174a: 0x000a, + 0x1760: 0x000a, 0x1761: 0x000a, 0x1762: 0x000a, 0x1763: 0x000a, + 0x1764: 0x000a, 0x1765: 0x000a, 0x1766: 0x000a, 0x1767: 0x000a, 0x1768: 0x000a, 0x1769: 0x000a, + 0x176a: 0x000a, 0x176b: 0x000a, 0x176c: 0x000a, 0x176d: 0x000a, 0x176e: 0x000a, 0x176f: 0x000a, + 0x1770: 0x000a, 0x1771: 0x000a, 0x1772: 0x000a, 0x1773: 0x000a, 0x1774: 0x000a, 0x1775: 0x000a, + 0x1776: 0x000a, 0x1777: 0x000a, 0x1778: 0x000a, 0x1779: 0x000a, 0x177a: 0x000a, 0x177b: 0x000a, + 0x177c: 0x000a, 0x177d: 0x000a, 0x177e: 0x000a, 0x177f: 0x000a, + // Block 0x5e, offset 0x1780 + 0x1780: 0x000a, 0x1781: 0x000a, 0x1782: 0x000a, 0x1783: 0x000a, 0x1784: 0x000a, 0x1785: 0x000a, + 0x1786: 0x000a, 0x1787: 0x000a, 0x1788: 0x0002, 0x1789: 0x0002, 0x178a: 0x0002, 0x178b: 0x0002, + 0x178c: 0x0002, 0x178d: 0x0002, 0x178e: 0x0002, 0x178f: 0x0002, 0x1790: 0x0002, 0x1791: 0x0002, + 0x1792: 0x0002, 0x1793: 0x0002, 0x1794: 0x0002, 0x1795: 0x0002, 0x1796: 0x0002, 0x1797: 0x0002, + 0x1798: 0x0002, 0x1799: 0x0002, 0x179a: 0x0002, 0x179b: 0x0002, + // Block 0x5f, offset 0x17c0 + 0x17ea: 0x000a, 0x17eb: 0x000a, 0x17ec: 0x000a, 0x17ed: 0x000a, 0x17ee: 0x000a, 0x17ef: 0x000a, + 0x17f0: 0x000a, 0x17f1: 0x000a, 0x17f2: 0x000a, 0x17f3: 0x000a, 0x17f4: 0x000a, 0x17f5: 0x000a, + 0x17f6: 0x000a, 0x17f7: 0x000a, 0x17f8: 0x000a, 0x17f9: 0x000a, 0x17fa: 0x000a, 0x17fb: 0x000a, + 0x17fc: 0x000a, 0x17fd: 0x000a, 0x17fe: 0x000a, 0x17ff: 0x000a, + // Block 0x60, offset 0x1800 + 0x1800: 0x000a, 0x1801: 0x000a, 0x1802: 0x000a, 0x1803: 0x000a, 0x1804: 0x000a, 0x1805: 0x000a, + 0x1806: 0x000a, 0x1807: 0x000a, 0x1808: 0x000a, 0x1809: 0x000a, 0x180a: 0x000a, 0x180b: 0x000a, + 0x180c: 0x000a, 0x180d: 0x000a, 0x180e: 0x000a, 0x180f: 0x000a, 0x1810: 0x000a, 0x1811: 0x000a, + 0x1812: 0x000a, 0x1813: 0x000a, 0x1814: 0x000a, 0x1815: 0x000a, 0x1816: 0x000a, 0x1817: 0x000a, + 0x1818: 0x000a, 0x1819: 0x000a, 0x181a: 0x000a, 0x181b: 0x000a, 0x181c: 0x000a, 0x181d: 0x000a, + 0x181e: 0x000a, 0x181f: 0x000a, 0x1820: 0x000a, 0x1821: 0x000a, 0x1822: 0x000a, 0x1823: 0x000a, + 0x1824: 0x000a, 0x1825: 0x000a, 0x1826: 0x000a, 0x1827: 0x000a, 0x1828: 0x000a, 0x1829: 0x000a, + 0x182a: 0x000a, 0x182b: 0x000a, 0x182d: 0x000a, 0x182e: 0x000a, 0x182f: 0x000a, + 0x1830: 0x000a, 0x1831: 0x000a, 0x1832: 0x000a, 0x1833: 0x000a, 0x1834: 0x000a, 0x1835: 0x000a, + 0x1836: 0x000a, 0x1837: 0x000a, 0x1838: 0x000a, 0x1839: 0x000a, 0x183a: 0x000a, 0x183b: 0x000a, + 0x183c: 0x000a, 0x183d: 0x000a, 0x183e: 0x000a, 0x183f: 0x000a, + // Block 0x61, offset 0x1840 + 0x1840: 0x000a, 0x1841: 0x000a, 0x1842: 0x000a, 0x1843: 0x000a, 0x1844: 0x000a, 0x1845: 0x000a, + 0x1846: 0x000a, 0x1847: 0x000a, 0x1848: 0x000a, 0x1849: 0x000a, 0x184a: 0x000a, 0x184b: 0x000a, + 0x184c: 0x000a, 0x184d: 0x000a, 0x184e: 0x000a, 0x184f: 0x000a, 0x1850: 0x000a, 0x1851: 0x000a, + 0x1852: 0x000a, 0x1853: 0x000a, 0x1854: 0x000a, 0x1855: 0x000a, 0x1856: 0x000a, 0x1857: 0x000a, + 0x1858: 0x000a, 0x1859: 0x000a, 0x185a: 0x000a, 0x185b: 0x000a, 0x185c: 0x000a, 0x185d: 0x000a, + 0x185e: 0x000a, 0x185f: 0x000a, 0x1860: 0x000a, 0x1861: 0x000a, 0x1862: 0x000a, 0x1863: 0x000a, + 0x1864: 0x000a, 0x1865: 0x000a, 0x1866: 0x000a, 0x1867: 0x000a, 0x1868: 0x003a, 0x1869: 0x002a, + 0x186a: 0x003a, 0x186b: 0x002a, 0x186c: 0x003a, 0x186d: 0x002a, 0x186e: 0x003a, 0x186f: 0x002a, + 0x1870: 0x003a, 0x1871: 0x002a, 0x1872: 0x003a, 0x1873: 0x002a, 0x1874: 0x003a, 0x1875: 0x002a, + 0x1876: 0x000a, 0x1877: 0x000a, 0x1878: 0x000a, 0x1879: 0x000a, 0x187a: 0x000a, 0x187b: 0x000a, + 0x187c: 0x000a, 0x187d: 0x000a, 0x187e: 0x000a, 0x187f: 0x000a, + // Block 0x62, offset 0x1880 + 0x1880: 0x000a, 0x1881: 0x000a, 0x1882: 0x000a, 0x1883: 0x000a, 0x1884: 0x000a, 0x1885: 0x009a, + 0x1886: 0x008a, 0x1887: 0x000a, 0x1888: 0x000a, 0x1889: 0x000a, 0x188a: 0x000a, 0x188b: 0x000a, + 0x188c: 0x000a, 0x188d: 0x000a, 0x188e: 0x000a, 0x188f: 0x000a, 0x1890: 0x000a, 0x1891: 0x000a, + 0x1892: 0x000a, 0x1893: 0x000a, 0x1894: 0x000a, 0x1895: 0x000a, 0x1896: 0x000a, 0x1897: 0x000a, + 0x1898: 0x000a, 0x1899: 0x000a, 0x189a: 0x000a, 0x189b: 0x000a, 0x189c: 0x000a, 0x189d: 0x000a, + 0x189e: 0x000a, 0x189f: 0x000a, 0x18a0: 0x000a, 0x18a1: 0x000a, 0x18a2: 0x000a, 0x18a3: 0x000a, + 0x18a4: 0x000a, 0x18a5: 0x000a, 0x18a6: 0x003a, 0x18a7: 0x002a, 0x18a8: 0x003a, 0x18a9: 0x002a, + 0x18aa: 0x003a, 0x18ab: 0x002a, 0x18ac: 0x003a, 0x18ad: 0x002a, 0x18ae: 0x003a, 0x18af: 0x002a, + 0x18b0: 0x000a, 0x18b1: 0x000a, 0x18b2: 0x000a, 0x18b3: 0x000a, 0x18b4: 0x000a, 0x18b5: 0x000a, + 0x18b6: 0x000a, 0x18b7: 0x000a, 0x18b8: 0x000a, 0x18b9: 0x000a, 0x18ba: 0x000a, 0x18bb: 0x000a, + 0x18bc: 0x000a, 0x18bd: 0x000a, 0x18be: 0x000a, 0x18bf: 0x000a, + // Block 0x63, offset 0x18c0 + 0x18c0: 0x000a, 0x18c1: 0x000a, 0x18c2: 0x000a, 0x18c3: 0x007a, 0x18c4: 0x006a, 0x18c5: 0x009a, + 0x18c6: 0x008a, 0x18c7: 0x00ba, 0x18c8: 0x00aa, 0x18c9: 0x009a, 0x18ca: 0x008a, 0x18cb: 0x007a, + 0x18cc: 0x006a, 0x18cd: 0x00da, 0x18ce: 0x002a, 0x18cf: 0x003a, 0x18d0: 0x00ca, 0x18d1: 0x009a, + 0x18d2: 0x008a, 0x18d3: 0x007a, 0x18d4: 0x006a, 0x18d5: 0x009a, 0x18d6: 0x008a, 0x18d7: 0x00ba, + 0x18d8: 0x00aa, 0x18d9: 0x000a, 0x18da: 0x000a, 0x18db: 0x000a, 0x18dc: 0x000a, 0x18dd: 0x000a, + 0x18de: 0x000a, 0x18df: 0x000a, 0x18e0: 0x000a, 0x18e1: 0x000a, 0x18e2: 0x000a, 0x18e3: 0x000a, + 0x18e4: 0x000a, 0x18e5: 0x000a, 0x18e6: 0x000a, 0x18e7: 0x000a, 0x18e8: 0x000a, 0x18e9: 0x000a, + 0x18ea: 0x000a, 0x18eb: 0x000a, 0x18ec: 0x000a, 0x18ed: 0x000a, 0x18ee: 0x000a, 0x18ef: 0x000a, + 0x18f0: 0x000a, 0x18f1: 0x000a, 0x18f2: 0x000a, 0x18f3: 0x000a, 0x18f4: 0x000a, 0x18f5: 0x000a, + 0x18f6: 0x000a, 0x18f7: 0x000a, 0x18f8: 0x000a, 0x18f9: 0x000a, 0x18fa: 0x000a, 0x18fb: 0x000a, + 0x18fc: 0x000a, 0x18fd: 0x000a, 0x18fe: 0x000a, 0x18ff: 0x000a, + // Block 0x64, offset 0x1900 + 0x1900: 0x000a, 0x1901: 0x000a, 0x1902: 0x000a, 0x1903: 0x000a, 0x1904: 0x000a, 0x1905: 0x000a, + 0x1906: 0x000a, 0x1907: 0x000a, 0x1908: 0x000a, 0x1909: 0x000a, 0x190a: 0x000a, 0x190b: 0x000a, + 0x190c: 0x000a, 0x190d: 0x000a, 0x190e: 0x000a, 0x190f: 0x000a, 0x1910: 0x000a, 0x1911: 0x000a, + 0x1912: 0x000a, 0x1913: 0x000a, 0x1914: 0x000a, 0x1915: 0x000a, 0x1916: 0x000a, 0x1917: 0x000a, + 0x1918: 0x003a, 0x1919: 0x002a, 0x191a: 0x003a, 0x191b: 0x002a, 0x191c: 0x000a, 0x191d: 0x000a, + 0x191e: 0x000a, 0x191f: 0x000a, 0x1920: 0x000a, 0x1921: 0x000a, 0x1922: 0x000a, 0x1923: 0x000a, + 0x1924: 0x000a, 0x1925: 0x000a, 0x1926: 0x000a, 0x1927: 0x000a, 0x1928: 0x000a, 0x1929: 0x000a, + 0x192a: 0x000a, 0x192b: 0x000a, 0x192c: 0x000a, 0x192d: 0x000a, 0x192e: 0x000a, 0x192f: 0x000a, + 0x1930: 0x000a, 0x1931: 0x000a, 0x1932: 0x000a, 0x1933: 0x000a, 0x1934: 0x000a, 0x1935: 0x000a, + 0x1936: 0x000a, 0x1937: 0x000a, 0x1938: 0x000a, 0x1939: 0x000a, 0x193a: 0x000a, 0x193b: 0x000a, + 0x193c: 0x003a, 0x193d: 0x002a, 0x193e: 0x000a, 0x193f: 0x000a, + // Block 0x65, offset 0x1940 + 0x1940: 0x000a, 0x1941: 0x000a, 0x1942: 0x000a, 0x1943: 0x000a, 0x1944: 0x000a, 0x1945: 0x000a, + 0x1946: 0x000a, 0x1947: 0x000a, 0x1948: 0x000a, 0x1949: 0x000a, 0x194a: 0x000a, 0x194b: 0x000a, + 0x194c: 0x000a, 0x194d: 0x000a, 0x194e: 0x000a, 0x194f: 0x000a, 0x1950: 0x000a, 0x1951: 0x000a, + 0x1952: 0x000a, 0x1953: 0x000a, 0x1954: 0x000a, 0x1955: 0x000a, 0x1956: 0x000a, 0x1957: 0x000a, + 0x1958: 0x000a, 0x1959: 0x000a, 0x195a: 0x000a, 0x195b: 0x000a, 0x195c: 0x000a, 0x195d: 0x000a, + 0x195e: 0x000a, 0x195f: 0x000a, 0x1960: 0x000a, 0x1961: 0x000a, 0x1962: 0x000a, 0x1963: 0x000a, + 0x1964: 0x000a, 0x1965: 0x000a, 0x1966: 0x000a, 0x1967: 0x000a, 0x1968: 0x000a, 0x1969: 0x000a, + 0x196a: 0x000a, 0x196b: 0x000a, 0x196c: 0x000a, 0x196d: 0x000a, 0x196e: 0x000a, 0x196f: 0x000a, + 0x1970: 0x000a, 0x1971: 0x000a, 0x1972: 0x000a, 0x1973: 0x000a, + 0x1976: 0x000a, 0x1977: 0x000a, 0x1978: 0x000a, 0x1979: 0x000a, 0x197a: 0x000a, 0x197b: 0x000a, + 0x197c: 0x000a, 0x197d: 0x000a, 0x197e: 0x000a, 0x197f: 0x000a, + // Block 0x66, offset 0x1980 + 0x1980: 0x000a, 0x1981: 0x000a, 0x1982: 0x000a, 0x1983: 0x000a, 0x1984: 0x000a, 0x1985: 0x000a, + 0x1986: 0x000a, 0x1987: 0x000a, 0x1988: 0x000a, 0x1989: 0x000a, 0x198a: 0x000a, 0x198b: 0x000a, + 0x198c: 0x000a, 0x198d: 0x000a, 0x198e: 0x000a, 0x198f: 0x000a, 0x1990: 0x000a, 0x1991: 0x000a, + 0x1992: 0x000a, 0x1993: 0x000a, 0x1994: 0x000a, 0x1995: 0x000a, 0x1997: 0x000a, + 0x1998: 0x000a, 0x1999: 0x000a, 0x199a: 0x000a, 0x199b: 0x000a, 0x199c: 0x000a, 0x199d: 0x000a, + 0x199e: 0x000a, 0x199f: 0x000a, 0x19a0: 0x000a, 0x19a1: 0x000a, 0x19a2: 0x000a, 0x19a3: 0x000a, + 0x19a4: 0x000a, 0x19a5: 0x000a, 0x19a6: 0x000a, 0x19a7: 0x000a, 0x19a8: 0x000a, 0x19a9: 0x000a, + 0x19aa: 0x000a, 0x19ab: 0x000a, 0x19ac: 0x000a, 0x19ad: 0x000a, 0x19ae: 0x000a, 0x19af: 0x000a, + 0x19b0: 0x000a, 0x19b1: 0x000a, 0x19b2: 0x000a, 0x19b3: 0x000a, 0x19b4: 0x000a, 0x19b5: 0x000a, + 0x19b6: 0x000a, 0x19b7: 0x000a, 0x19b8: 0x000a, 0x19b9: 0x000a, 0x19ba: 0x000a, 0x19bb: 0x000a, + 0x19bc: 0x000a, 0x19bd: 0x000a, 0x19be: 0x000a, 0x19bf: 0x000a, + // Block 0x67, offset 0x19c0 + 0x19e5: 0x000a, 0x19e6: 0x000a, 0x19e7: 0x000a, 0x19e8: 0x000a, 0x19e9: 0x000a, + 0x19ea: 0x000a, 0x19ef: 0x000c, + 0x19f0: 0x000c, 0x19f1: 0x000c, + 0x19f9: 0x000a, 0x19fa: 0x000a, 0x19fb: 0x000a, + 0x19fc: 0x000a, 0x19fd: 0x000a, 0x19fe: 0x000a, 0x19ff: 0x000a, + // Block 0x68, offset 0x1a00 + 0x1a3f: 0x000c, + // Block 0x69, offset 0x1a40 + 0x1a60: 0x000c, 0x1a61: 0x000c, 0x1a62: 0x000c, 0x1a63: 0x000c, + 0x1a64: 0x000c, 0x1a65: 0x000c, 0x1a66: 0x000c, 0x1a67: 0x000c, 0x1a68: 0x000c, 0x1a69: 0x000c, + 0x1a6a: 0x000c, 0x1a6b: 0x000c, 0x1a6c: 0x000c, 0x1a6d: 0x000c, 0x1a6e: 0x000c, 0x1a6f: 0x000c, + 0x1a70: 0x000c, 0x1a71: 0x000c, 0x1a72: 0x000c, 0x1a73: 0x000c, 0x1a74: 0x000c, 0x1a75: 0x000c, + 0x1a76: 0x000c, 0x1a77: 0x000c, 0x1a78: 0x000c, 0x1a79: 0x000c, 0x1a7a: 0x000c, 0x1a7b: 0x000c, + 0x1a7c: 0x000c, 0x1a7d: 0x000c, 0x1a7e: 0x000c, 0x1a7f: 0x000c, + // Block 0x6a, offset 0x1a80 + 0x1a80: 0x000a, 0x1a81: 0x000a, 0x1a82: 0x000a, 0x1a83: 0x000a, 0x1a84: 0x000a, 0x1a85: 0x000a, + 0x1a86: 0x000a, 0x1a87: 0x000a, 0x1a88: 0x000a, 0x1a89: 0x000a, 0x1a8a: 0x000a, 0x1a8b: 0x000a, + 0x1a8c: 0x000a, 0x1a8d: 0x000a, 0x1a8e: 0x000a, 0x1a8f: 0x000a, 0x1a90: 0x000a, 0x1a91: 0x000a, + 0x1a92: 0x000a, 0x1a93: 0x000a, 0x1a94: 0x000a, 0x1a95: 0x000a, 0x1a96: 0x000a, 0x1a97: 0x000a, + 0x1a98: 0x000a, 0x1a99: 0x000a, 0x1a9a: 0x000a, 0x1a9b: 0x000a, 0x1a9c: 0x000a, 0x1a9d: 0x000a, + 0x1a9e: 0x000a, 0x1a9f: 0x000a, 0x1aa0: 0x000a, 0x1aa1: 0x000a, 0x1aa2: 0x003a, 0x1aa3: 0x002a, + 0x1aa4: 0x003a, 0x1aa5: 0x002a, 0x1aa6: 0x003a, 0x1aa7: 0x002a, 0x1aa8: 0x003a, 0x1aa9: 0x002a, + 0x1aaa: 0x000a, 0x1aab: 0x000a, 0x1aac: 0x000a, 0x1aad: 0x000a, 0x1aae: 0x000a, 0x1aaf: 0x000a, + 0x1ab0: 0x000a, 0x1ab1: 0x000a, 0x1ab2: 0x000a, 0x1ab3: 0x000a, 0x1ab4: 0x000a, 0x1ab5: 0x000a, + 0x1ab6: 0x000a, 0x1ab7: 0x000a, 0x1ab8: 0x000a, 0x1ab9: 0x000a, 0x1aba: 0x000a, 0x1abb: 0x000a, + 0x1abc: 0x000a, 0x1abd: 0x000a, 0x1abe: 0x000a, 0x1abf: 0x000a, + // Block 0x6b, offset 0x1ac0 + 0x1ac0: 0x000a, 0x1ac1: 0x000a, 0x1ac2: 0x000a, 0x1ac3: 0x000a, 0x1ac4: 0x000a, 0x1ac5: 0x000a, + 0x1ac6: 0x000a, 0x1ac7: 0x000a, 0x1ac8: 0x000a, 0x1ac9: 0x000a, 0x1aca: 0x000a, 0x1acb: 0x000a, + 0x1acc: 0x000a, 0x1acd: 0x000a, 0x1ace: 0x000a, 0x1acf: 0x000a, 0x1ad0: 0x000a, 0x1ad1: 0x000a, + 0x1ad2: 0x000a, 0x1ad3: 0x000a, 0x1ad4: 0x000a, 0x1ad5: 0x009a, 0x1ad6: 0x008a, 0x1ad7: 0x00ba, + 0x1ad8: 0x00aa, 0x1ad9: 0x009a, 0x1ada: 0x008a, 0x1adb: 0x007a, 0x1adc: 0x006a, 0x1add: 0x000a, + // Block 0x6c, offset 0x1b00 + 0x1b00: 0x000a, 0x1b01: 0x000a, 0x1b02: 0x000a, 0x1b03: 0x000a, 0x1b04: 0x000a, 0x1b05: 0x000a, + 0x1b06: 0x000a, 0x1b07: 0x000a, 0x1b08: 0x000a, 0x1b09: 0x000a, 0x1b0a: 0x000a, 0x1b0b: 0x000a, + 0x1b0c: 0x000a, 0x1b0d: 0x000a, 0x1b0e: 0x000a, 0x1b0f: 0x000a, 0x1b10: 0x000a, 0x1b11: 0x000a, + 0x1b12: 0x000a, 0x1b13: 0x000a, 0x1b14: 0x000a, 0x1b15: 0x000a, 0x1b16: 0x000a, 0x1b17: 0x000a, + 0x1b18: 0x000a, 0x1b19: 0x000a, 0x1b1b: 0x000a, 0x1b1c: 0x000a, 0x1b1d: 0x000a, + 0x1b1e: 0x000a, 0x1b1f: 0x000a, 0x1b20: 0x000a, 0x1b21: 0x000a, 0x1b22: 0x000a, 0x1b23: 0x000a, + 0x1b24: 0x000a, 0x1b25: 0x000a, 0x1b26: 0x000a, 0x1b27: 0x000a, 0x1b28: 0x000a, 0x1b29: 0x000a, + 0x1b2a: 0x000a, 0x1b2b: 0x000a, 0x1b2c: 0x000a, 0x1b2d: 0x000a, 0x1b2e: 0x000a, 0x1b2f: 0x000a, + 0x1b30: 0x000a, 0x1b31: 0x000a, 0x1b32: 0x000a, 0x1b33: 0x000a, 0x1b34: 0x000a, 0x1b35: 0x000a, + 0x1b36: 0x000a, 0x1b37: 0x000a, 0x1b38: 0x000a, 0x1b39: 0x000a, 0x1b3a: 0x000a, 0x1b3b: 0x000a, + 0x1b3c: 0x000a, 0x1b3d: 0x000a, 0x1b3e: 0x000a, 0x1b3f: 0x000a, + // Block 0x6d, offset 0x1b40 + 0x1b40: 0x000a, 0x1b41: 0x000a, 0x1b42: 0x000a, 0x1b43: 0x000a, 0x1b44: 0x000a, 0x1b45: 0x000a, + 0x1b46: 0x000a, 0x1b47: 0x000a, 0x1b48: 0x000a, 0x1b49: 0x000a, 0x1b4a: 0x000a, 0x1b4b: 0x000a, + 0x1b4c: 0x000a, 0x1b4d: 0x000a, 0x1b4e: 0x000a, 0x1b4f: 0x000a, 0x1b50: 0x000a, 0x1b51: 0x000a, + 0x1b52: 0x000a, 0x1b53: 0x000a, 0x1b54: 0x000a, 0x1b55: 0x000a, 0x1b56: 0x000a, 0x1b57: 0x000a, + 0x1b58: 0x000a, 0x1b59: 0x000a, 0x1b5a: 0x000a, 0x1b5b: 0x000a, 0x1b5c: 0x000a, 0x1b5d: 0x000a, + 0x1b5e: 0x000a, 0x1b5f: 0x000a, 0x1b60: 0x000a, 0x1b61: 0x000a, 0x1b62: 0x000a, 0x1b63: 0x000a, + 0x1b64: 0x000a, 0x1b65: 0x000a, 0x1b66: 0x000a, 0x1b67: 0x000a, 0x1b68: 0x000a, 0x1b69: 0x000a, + 0x1b6a: 0x000a, 0x1b6b: 0x000a, 0x1b6c: 0x000a, 0x1b6d: 0x000a, 0x1b6e: 0x000a, 0x1b6f: 0x000a, + 0x1b70: 0x000a, 0x1b71: 0x000a, 0x1b72: 0x000a, 0x1b73: 0x000a, + // Block 0x6e, offset 0x1b80 + 0x1b80: 0x000a, 0x1b81: 0x000a, 0x1b82: 0x000a, 0x1b83: 0x000a, 0x1b84: 0x000a, 0x1b85: 0x000a, + 0x1b86: 0x000a, 0x1b87: 0x000a, 0x1b88: 0x000a, 0x1b89: 0x000a, 0x1b8a: 0x000a, 0x1b8b: 0x000a, + 0x1b8c: 0x000a, 0x1b8d: 0x000a, 0x1b8e: 0x000a, 0x1b8f: 0x000a, 0x1b90: 0x000a, 0x1b91: 0x000a, + 0x1b92: 0x000a, 0x1b93: 0x000a, 0x1b94: 0x000a, 0x1b95: 0x000a, + 0x1bb0: 0x000a, 0x1bb1: 0x000a, 0x1bb2: 0x000a, 0x1bb3: 0x000a, 0x1bb4: 0x000a, 0x1bb5: 0x000a, + 0x1bb6: 0x000a, 0x1bb7: 0x000a, 0x1bb8: 0x000a, 0x1bb9: 0x000a, 0x1bba: 0x000a, 0x1bbb: 0x000a, + // Block 0x6f, offset 0x1bc0 + 0x1bc0: 0x0009, 0x1bc1: 0x000a, 0x1bc2: 0x000a, 0x1bc3: 0x000a, 0x1bc4: 0x000a, + 0x1bc8: 0x003a, 0x1bc9: 0x002a, 0x1bca: 0x003a, 0x1bcb: 0x002a, + 0x1bcc: 0x003a, 0x1bcd: 0x002a, 0x1bce: 0x003a, 0x1bcf: 0x002a, 0x1bd0: 0x003a, 0x1bd1: 0x002a, + 0x1bd2: 0x000a, 0x1bd3: 0x000a, 0x1bd4: 0x003a, 0x1bd5: 0x002a, 0x1bd6: 0x003a, 0x1bd7: 0x002a, + 0x1bd8: 0x003a, 0x1bd9: 0x002a, 0x1bda: 0x003a, 0x1bdb: 0x002a, 0x1bdc: 0x000a, 0x1bdd: 0x000a, + 0x1bde: 0x000a, 0x1bdf: 0x000a, 0x1be0: 0x000a, + 0x1bea: 0x000c, 0x1beb: 0x000c, 0x1bec: 0x000c, 0x1bed: 0x000c, + 0x1bf0: 0x000a, + 0x1bf6: 0x000a, 0x1bf7: 0x000a, + 0x1bfd: 0x000a, 0x1bfe: 0x000a, 0x1bff: 0x000a, + // Block 0x70, offset 0x1c00 + 0x1c19: 0x000c, 0x1c1a: 0x000c, 0x1c1b: 0x000a, 0x1c1c: 0x000a, + 0x1c20: 0x000a, + // Block 0x71, offset 0x1c40 + 0x1c7b: 0x000a, + // Block 0x72, offset 0x1c80 + 0x1c80: 0x000a, 0x1c81: 0x000a, 0x1c82: 0x000a, 0x1c83: 0x000a, 0x1c84: 0x000a, 0x1c85: 0x000a, + 0x1c86: 0x000a, 0x1c87: 0x000a, 0x1c88: 0x000a, 0x1c89: 0x000a, 0x1c8a: 0x000a, 0x1c8b: 0x000a, + 0x1c8c: 0x000a, 0x1c8d: 0x000a, 0x1c8e: 0x000a, 0x1c8f: 0x000a, 0x1c90: 0x000a, 0x1c91: 0x000a, + 0x1c92: 0x000a, 0x1c93: 0x000a, 0x1c94: 0x000a, 0x1c95: 0x000a, 0x1c96: 0x000a, 0x1c97: 0x000a, + 0x1c98: 0x000a, 0x1c99: 0x000a, 0x1c9a: 0x000a, 0x1c9b: 0x000a, 0x1c9c: 0x000a, 0x1c9d: 0x000a, + 0x1c9e: 0x000a, 0x1c9f: 0x000a, 0x1ca0: 0x000a, 0x1ca1: 0x000a, 0x1ca2: 0x000a, 0x1ca3: 0x000a, + // Block 0x73, offset 0x1cc0 + 0x1cdd: 0x000a, + 0x1cde: 0x000a, + // Block 0x74, offset 0x1d00 + 0x1d10: 0x000a, 0x1d11: 0x000a, + 0x1d12: 0x000a, 0x1d13: 0x000a, 0x1d14: 0x000a, 0x1d15: 0x000a, 0x1d16: 0x000a, 0x1d17: 0x000a, + 0x1d18: 0x000a, 0x1d19: 0x000a, 0x1d1a: 0x000a, 0x1d1b: 0x000a, 0x1d1c: 0x000a, 0x1d1d: 0x000a, + 0x1d1e: 0x000a, 0x1d1f: 0x000a, + 0x1d3c: 0x000a, 0x1d3d: 0x000a, 0x1d3e: 0x000a, + // Block 0x75, offset 0x1d40 + 0x1d71: 0x000a, 0x1d72: 0x000a, 0x1d73: 0x000a, 0x1d74: 0x000a, 0x1d75: 0x000a, + 0x1d76: 0x000a, 0x1d77: 0x000a, 0x1d78: 0x000a, 0x1d79: 0x000a, 0x1d7a: 0x000a, 0x1d7b: 0x000a, + 0x1d7c: 0x000a, 0x1d7d: 0x000a, 0x1d7e: 0x000a, 0x1d7f: 0x000a, + // Block 0x76, offset 0x1d80 + 0x1d8c: 0x000a, 0x1d8d: 0x000a, 0x1d8e: 0x000a, 0x1d8f: 0x000a, + // Block 0x77, offset 0x1dc0 + 0x1df7: 0x000a, 0x1df8: 0x000a, 0x1df9: 0x000a, 0x1dfa: 0x000a, + // Block 0x78, offset 0x1e00 + 0x1e1e: 0x000a, 0x1e1f: 0x000a, + 0x1e3f: 0x000a, + // Block 0x79, offset 0x1e40 + 0x1e50: 0x000a, 0x1e51: 0x000a, + 0x1e52: 0x000a, 0x1e53: 0x000a, 0x1e54: 0x000a, 0x1e55: 0x000a, 0x1e56: 0x000a, 0x1e57: 0x000a, + 0x1e58: 0x000a, 0x1e59: 0x000a, 0x1e5a: 0x000a, 0x1e5b: 0x000a, 0x1e5c: 0x000a, 0x1e5d: 0x000a, + 0x1e5e: 0x000a, 0x1e5f: 0x000a, 0x1e60: 0x000a, 0x1e61: 0x000a, 0x1e62: 0x000a, 0x1e63: 0x000a, + 0x1e64: 0x000a, 0x1e65: 0x000a, 0x1e66: 0x000a, 0x1e67: 0x000a, 0x1e68: 0x000a, 0x1e69: 0x000a, + 0x1e6a: 0x000a, 0x1e6b: 0x000a, 0x1e6c: 0x000a, 0x1e6d: 0x000a, 0x1e6e: 0x000a, 0x1e6f: 0x000a, + 0x1e70: 0x000a, 0x1e71: 0x000a, 0x1e72: 0x000a, 0x1e73: 0x000a, 0x1e74: 0x000a, 0x1e75: 0x000a, + 0x1e76: 0x000a, 0x1e77: 0x000a, 0x1e78: 0x000a, 0x1e79: 0x000a, 0x1e7a: 0x000a, 0x1e7b: 0x000a, + 0x1e7c: 0x000a, 0x1e7d: 0x000a, 0x1e7e: 0x000a, 0x1e7f: 0x000a, + // Block 0x7a, offset 0x1e80 + 0x1e80: 0x000a, 0x1e81: 0x000a, 0x1e82: 0x000a, 0x1e83: 0x000a, 0x1e84: 0x000a, 0x1e85: 0x000a, + 0x1e86: 0x000a, + // Block 0x7b, offset 0x1ec0 + 0x1ecd: 0x000a, 0x1ece: 0x000a, 0x1ecf: 0x000a, + // Block 0x7c, offset 0x1f00 + 0x1f2f: 0x000c, + 0x1f30: 0x000c, 0x1f31: 0x000c, 0x1f32: 0x000c, 0x1f33: 0x000a, 0x1f34: 0x000c, 0x1f35: 0x000c, + 0x1f36: 0x000c, 0x1f37: 0x000c, 0x1f38: 0x000c, 0x1f39: 0x000c, 0x1f3a: 0x000c, 0x1f3b: 0x000c, + 0x1f3c: 0x000c, 0x1f3d: 0x000c, 0x1f3e: 0x000a, 0x1f3f: 0x000a, + // Block 0x7d, offset 0x1f40 + 0x1f5e: 0x000c, 0x1f5f: 0x000c, + // Block 0x7e, offset 0x1f80 + 0x1fb0: 0x000c, 0x1fb1: 0x000c, + // Block 0x7f, offset 0x1fc0 + 0x1fc0: 0x000a, 0x1fc1: 0x000a, 0x1fc2: 0x000a, 0x1fc3: 0x000a, 0x1fc4: 0x000a, 0x1fc5: 0x000a, + 0x1fc6: 0x000a, 0x1fc7: 0x000a, 0x1fc8: 0x000a, 0x1fc9: 0x000a, 0x1fca: 0x000a, 0x1fcb: 0x000a, + 0x1fcc: 0x000a, 0x1fcd: 0x000a, 0x1fce: 0x000a, 0x1fcf: 0x000a, 0x1fd0: 0x000a, 0x1fd1: 0x000a, + 0x1fd2: 0x000a, 0x1fd3: 0x000a, 0x1fd4: 0x000a, 0x1fd5: 0x000a, 0x1fd6: 0x000a, 0x1fd7: 0x000a, + 0x1fd8: 0x000a, 0x1fd9: 0x000a, 0x1fda: 0x000a, 0x1fdb: 0x000a, 0x1fdc: 0x000a, 0x1fdd: 0x000a, + 0x1fde: 0x000a, 0x1fdf: 0x000a, 0x1fe0: 0x000a, 0x1fe1: 0x000a, + // Block 0x80, offset 0x2000 + 0x2008: 0x000a, + // Block 0x81, offset 0x2040 + 0x2042: 0x000c, + 0x2046: 0x000c, 0x204b: 0x000c, + 0x2065: 0x000c, 0x2066: 0x000c, 0x2068: 0x000a, 0x2069: 0x000a, + 0x206a: 0x000a, 0x206b: 0x000a, 0x206c: 0x000c, + 0x2078: 0x0004, 0x2079: 0x0004, + // Block 0x82, offset 0x2080 + 0x20b4: 0x000a, 0x20b5: 0x000a, + 0x20b6: 0x000a, 0x20b7: 0x000a, + // Block 0x83, offset 0x20c0 + 0x20c4: 0x000c, 0x20c5: 0x000c, + 0x20e0: 0x000c, 0x20e1: 0x000c, 0x20e2: 0x000c, 0x20e3: 0x000c, + 0x20e4: 0x000c, 0x20e5: 0x000c, 0x20e6: 0x000c, 0x20e7: 0x000c, 0x20e8: 0x000c, 0x20e9: 0x000c, + 0x20ea: 0x000c, 0x20eb: 0x000c, 0x20ec: 0x000c, 0x20ed: 0x000c, 0x20ee: 0x000c, 0x20ef: 0x000c, + 0x20f0: 0x000c, 0x20f1: 0x000c, + 0x20ff: 0x000c, + // Block 0x84, offset 0x2100 + 0x2126: 0x000c, 0x2127: 0x000c, 0x2128: 0x000c, 0x2129: 0x000c, + 0x212a: 0x000c, 0x212b: 0x000c, 0x212c: 0x000c, 0x212d: 0x000c, + // Block 0x85, offset 0x2140 + 0x2147: 0x000c, 0x2148: 0x000c, 0x2149: 0x000c, 0x214a: 0x000c, 0x214b: 0x000c, + 0x214c: 0x000c, 0x214d: 0x000c, 0x214e: 0x000c, 0x214f: 0x000c, 0x2150: 0x000c, 0x2151: 0x000c, + // Block 0x86, offset 0x2180 + 0x2180: 0x000c, 0x2181: 0x000c, 0x2182: 0x000c, + 0x21b3: 0x000c, + 0x21b6: 0x000c, 0x21b7: 0x000c, 0x21b8: 0x000c, 0x21b9: 0x000c, + 0x21bc: 0x000c, 0x21bd: 0x000c, + // Block 0x87, offset 0x21c0 + 0x21e5: 0x000c, + // Block 0x88, offset 0x2200 + 0x2229: 0x000c, + 0x222a: 0x000c, 0x222b: 0x000c, 0x222c: 0x000c, 0x222d: 0x000c, 0x222e: 0x000c, + 0x2231: 0x000c, 0x2232: 0x000c, 0x2235: 0x000c, + 0x2236: 0x000c, + // Block 0x89, offset 0x2240 + 0x2243: 0x000c, + 0x224c: 0x000c, + 0x227c: 0x000c, + // Block 0x8a, offset 0x2280 + 0x22b0: 0x000c, 0x22b2: 0x000c, 0x22b3: 0x000c, 0x22b4: 0x000c, + 0x22b7: 0x000c, 0x22b8: 0x000c, + 0x22be: 0x000c, 0x22bf: 0x000c, + // Block 0x8b, offset 0x22c0 + 0x22c1: 0x000c, + 0x22ec: 0x000c, 0x22ed: 0x000c, + 0x22f6: 0x000c, + // Block 0x8c, offset 0x2300 + 0x232a: 0x000a, 0x232b: 0x000a, + // Block 0x8d, offset 0x2340 + 0x2365: 0x000c, 0x2368: 0x000c, + 0x236d: 0x000c, + // Block 0x8e, offset 0x2380 + 0x239d: 0x0001, + 0x239e: 0x000c, 0x239f: 0x0001, 0x23a0: 0x0001, 0x23a1: 0x0001, 0x23a2: 0x0001, 0x23a3: 0x0001, + 0x23a4: 0x0001, 0x23a5: 0x0001, 0x23a6: 0x0001, 0x23a7: 0x0001, 0x23a8: 0x0001, 0x23a9: 0x0003, + 0x23aa: 0x0001, 0x23ab: 0x0001, 0x23ac: 0x0001, 0x23ad: 0x0001, 0x23ae: 0x0001, 0x23af: 0x0001, + 0x23b0: 0x0001, 0x23b1: 0x0001, 0x23b2: 0x0001, 0x23b3: 0x0001, 0x23b4: 0x0001, 0x23b5: 0x0001, + 0x23b6: 0x0001, 0x23b7: 0x0001, 0x23b8: 0x0001, 0x23b9: 0x0001, 0x23ba: 0x0001, 0x23bb: 0x0001, + 0x23bc: 0x0001, 0x23bd: 0x0001, 0x23be: 0x0001, 0x23bf: 0x0001, + // Block 0x8f, offset 0x23c0 + 0x23c0: 0x0001, 0x23c1: 0x0001, 0x23c2: 0x0001, 0x23c3: 0x0001, 0x23c4: 0x0001, 0x23c5: 0x0001, + 0x23c6: 0x0001, 0x23c7: 0x0001, 0x23c8: 0x0001, 0x23c9: 0x0001, 0x23ca: 0x0001, 0x23cb: 0x0001, + 0x23cc: 0x0001, 0x23cd: 0x0001, 0x23ce: 0x0001, 0x23cf: 0x0001, 0x23d0: 0x000d, 0x23d1: 0x000d, + 0x23d2: 0x000d, 0x23d3: 0x000d, 0x23d4: 0x000d, 0x23d5: 0x000d, 0x23d6: 0x000d, 0x23d7: 0x000d, + 0x23d8: 0x000d, 0x23d9: 0x000d, 0x23da: 0x000d, 0x23db: 0x000d, 0x23dc: 0x000d, 0x23dd: 0x000d, + 0x23de: 0x000d, 0x23df: 0x000d, 0x23e0: 0x000d, 0x23e1: 0x000d, 0x23e2: 0x000d, 0x23e3: 0x000d, + 0x23e4: 0x000d, 0x23e5: 0x000d, 0x23e6: 0x000d, 0x23e7: 0x000d, 0x23e8: 0x000d, 0x23e9: 0x000d, + 0x23ea: 0x000d, 0x23eb: 0x000d, 0x23ec: 0x000d, 0x23ed: 0x000d, 0x23ee: 0x000d, 0x23ef: 0x000d, + 0x23f0: 0x000d, 0x23f1: 0x000d, 0x23f2: 0x000d, 0x23f3: 0x000d, 0x23f4: 0x000d, 0x23f5: 0x000d, + 0x23f6: 0x000d, 0x23f7: 0x000d, 0x23f8: 0x000d, 0x23f9: 0x000d, 0x23fa: 0x000d, 0x23fb: 0x000d, + 0x23fc: 0x000d, 0x23fd: 0x000d, 0x23fe: 0x000d, 0x23ff: 0x000d, + // Block 0x90, offset 0x2400 + 0x2400: 0x000d, 0x2401: 0x000d, 0x2402: 0x000d, 0x2403: 0x000d, 0x2404: 0x000d, 0x2405: 0x000d, + 0x2406: 0x000d, 0x2407: 0x000d, 0x2408: 0x000d, 0x2409: 0x000d, 0x240a: 0x000d, 0x240b: 0x000d, + 0x240c: 0x000d, 0x240d: 0x000d, 0x240e: 0x000d, 0x240f: 0x000d, 0x2410: 0x000d, 0x2411: 0x000d, + 0x2412: 0x000d, 0x2413: 0x000d, 0x2414: 0x000d, 0x2415: 0x000d, 0x2416: 0x000d, 0x2417: 0x000d, + 0x2418: 0x000d, 0x2419: 0x000d, 0x241a: 0x000d, 0x241b: 0x000d, 0x241c: 0x000d, 0x241d: 0x000d, + 0x241e: 0x000d, 0x241f: 0x000d, 0x2420: 0x000d, 0x2421: 0x000d, 0x2422: 0x000d, 0x2423: 0x000d, + 0x2424: 0x000d, 0x2425: 0x000d, 0x2426: 0x000d, 0x2427: 0x000d, 0x2428: 0x000d, 0x2429: 0x000d, + 0x242a: 0x000d, 0x242b: 0x000d, 0x242c: 0x000d, 0x242d: 0x000d, 0x242e: 0x000d, 0x242f: 0x000d, + 0x2430: 0x000d, 0x2431: 0x000d, 0x2432: 0x000d, 0x2433: 0x000d, 0x2434: 0x000d, 0x2435: 0x000d, + 0x2436: 0x000d, 0x2437: 0x000d, 0x2438: 0x000d, 0x2439: 0x000d, 0x243a: 0x000d, 0x243b: 0x000d, + 0x243c: 0x000d, 0x243d: 0x000d, 0x243e: 0x000a, 0x243f: 0x000a, + // Block 0x91, offset 0x2440 + 0x2440: 0x000a, 0x2441: 0x000a, 0x2442: 0x000a, 0x2443: 0x000a, 0x2444: 0x000a, 0x2445: 0x000a, + 0x2446: 0x000a, 0x2447: 0x000a, 0x2448: 0x000a, 0x2449: 0x000a, 0x244a: 0x000a, 0x244b: 0x000a, + 0x244c: 0x000a, 0x244d: 0x000a, 0x244e: 0x000a, 0x244f: 0x000a, 0x2450: 0x000d, 0x2451: 0x000d, + 0x2452: 0x000d, 0x2453: 0x000d, 0x2454: 0x000d, 0x2455: 0x000d, 0x2456: 0x000d, 0x2457: 0x000d, + 0x2458: 0x000d, 0x2459: 0x000d, 0x245a: 0x000d, 0x245b: 0x000d, 0x245c: 0x000d, 0x245d: 0x000d, + 0x245e: 0x000d, 0x245f: 0x000d, 0x2460: 0x000d, 0x2461: 0x000d, 0x2462: 0x000d, 0x2463: 0x000d, + 0x2464: 0x000d, 0x2465: 0x000d, 0x2466: 0x000d, 0x2467: 0x000d, 0x2468: 0x000d, 0x2469: 0x000d, + 0x246a: 0x000d, 0x246b: 0x000d, 0x246c: 0x000d, 0x246d: 0x000d, 0x246e: 0x000d, 0x246f: 0x000d, + 0x2470: 0x000d, 0x2471: 0x000d, 0x2472: 0x000d, 0x2473: 0x000d, 0x2474: 0x000d, 0x2475: 0x000d, + 0x2476: 0x000d, 0x2477: 0x000d, 0x2478: 0x000d, 0x2479: 0x000d, 0x247a: 0x000d, 0x247b: 0x000d, + 0x247c: 0x000d, 0x247d: 0x000d, 0x247e: 0x000d, 0x247f: 0x000d, + // Block 0x92, offset 0x2480 + 0x2480: 0x000d, 0x2481: 0x000d, 0x2482: 0x000d, 0x2483: 0x000d, 0x2484: 0x000d, 0x2485: 0x000d, + 0x2486: 0x000d, 0x2487: 0x000d, 0x2488: 0x000d, 0x2489: 0x000d, 0x248a: 0x000d, 0x248b: 0x000d, + 0x248c: 0x000d, 0x248d: 0x000d, 0x248e: 0x000d, 0x248f: 0x000a, 0x2490: 0x000b, 0x2491: 0x000b, + 0x2492: 0x000b, 0x2493: 0x000b, 0x2494: 0x000b, 0x2495: 0x000b, 0x2496: 0x000b, 0x2497: 0x000b, + 0x2498: 0x000b, 0x2499: 0x000b, 0x249a: 0x000b, 0x249b: 0x000b, 0x249c: 0x000b, 0x249d: 0x000b, + 0x249e: 0x000b, 0x249f: 0x000b, 0x24a0: 0x000b, 0x24a1: 0x000b, 0x24a2: 0x000b, 0x24a3: 0x000b, + 0x24a4: 0x000b, 0x24a5: 0x000b, 0x24a6: 0x000b, 0x24a7: 0x000b, 0x24a8: 0x000b, 0x24a9: 0x000b, + 0x24aa: 0x000b, 0x24ab: 0x000b, 0x24ac: 0x000b, 0x24ad: 0x000b, 0x24ae: 0x000b, 0x24af: 0x000b, + 0x24b0: 0x000d, 0x24b1: 0x000d, 0x24b2: 0x000d, 0x24b3: 0x000d, 0x24b4: 0x000d, 0x24b5: 0x000d, + 0x24b6: 0x000d, 0x24b7: 0x000d, 0x24b8: 0x000d, 0x24b9: 0x000d, 0x24ba: 0x000d, 0x24bb: 0x000d, + 0x24bc: 0x000d, 0x24bd: 0x000a, 0x24be: 0x000a, 0x24bf: 0x000a, + // Block 0x93, offset 0x24c0 + 0x24c0: 0x000c, 0x24c1: 0x000c, 0x24c2: 0x000c, 0x24c3: 0x000c, 0x24c4: 0x000c, 0x24c5: 0x000c, + 0x24c6: 0x000c, 0x24c7: 0x000c, 0x24c8: 0x000c, 0x24c9: 0x000c, 0x24ca: 0x000c, 0x24cb: 0x000c, + 0x24cc: 0x000c, 0x24cd: 0x000c, 0x24ce: 0x000c, 0x24cf: 0x000c, 0x24d0: 0x000a, 0x24d1: 0x000a, + 0x24d2: 0x000a, 0x24d3: 0x000a, 0x24d4: 0x000a, 0x24d5: 0x000a, 0x24d6: 0x000a, 0x24d7: 0x000a, + 0x24d8: 0x000a, 0x24d9: 0x000a, + 0x24e0: 0x000c, 0x24e1: 0x000c, 0x24e2: 0x000c, 0x24e3: 0x000c, + 0x24e4: 0x000c, 0x24e5: 0x000c, 0x24e6: 0x000c, 0x24e7: 0x000c, 0x24e8: 0x000c, 0x24e9: 0x000c, + 0x24ea: 0x000c, 0x24eb: 0x000c, 0x24ec: 0x000c, 0x24ed: 0x000c, 0x24ee: 0x000c, 0x24ef: 0x000c, + 0x24f0: 0x000a, 0x24f1: 0x000a, 0x24f2: 0x000a, 0x24f3: 0x000a, 0x24f4: 0x000a, 0x24f5: 0x000a, + 0x24f6: 0x000a, 0x24f7: 0x000a, 0x24f8: 0x000a, 0x24f9: 0x000a, 0x24fa: 0x000a, 0x24fb: 0x000a, + 0x24fc: 0x000a, 0x24fd: 0x000a, 0x24fe: 0x000a, 0x24ff: 0x000a, + // Block 0x94, offset 0x2500 + 0x2500: 0x000a, 0x2501: 0x000a, 0x2502: 0x000a, 0x2503: 0x000a, 0x2504: 0x000a, 0x2505: 0x000a, + 0x2506: 0x000a, 0x2507: 0x000a, 0x2508: 0x000a, 0x2509: 0x000a, 0x250a: 0x000a, 0x250b: 0x000a, + 0x250c: 0x000a, 0x250d: 0x000a, 0x250e: 0x000a, 0x250f: 0x000a, 0x2510: 0x0006, 0x2511: 0x000a, + 0x2512: 0x0006, 0x2514: 0x000a, 0x2515: 0x0006, 0x2516: 0x000a, 0x2517: 0x000a, + 0x2518: 0x000a, 0x2519: 0x009a, 0x251a: 0x008a, 0x251b: 0x007a, 0x251c: 0x006a, 0x251d: 0x009a, + 0x251e: 0x008a, 0x251f: 0x0004, 0x2520: 0x000a, 0x2521: 0x000a, 0x2522: 0x0003, 0x2523: 0x0003, + 0x2524: 0x000a, 0x2525: 0x000a, 0x2526: 0x000a, 0x2528: 0x000a, 0x2529: 0x0004, + 0x252a: 0x0004, 0x252b: 0x000a, + 0x2530: 0x000d, 0x2531: 0x000d, 0x2532: 0x000d, 0x2533: 0x000d, 0x2534: 0x000d, 0x2535: 0x000d, + 0x2536: 0x000d, 0x2537: 0x000d, 0x2538: 0x000d, 0x2539: 0x000d, 0x253a: 0x000d, 0x253b: 0x000d, + 0x253c: 0x000d, 0x253d: 0x000d, 0x253e: 0x000d, 0x253f: 0x000d, + // Block 0x95, offset 0x2540 + 0x2540: 0x000d, 0x2541: 0x000d, 0x2542: 0x000d, 0x2543: 0x000d, 0x2544: 0x000d, 0x2545: 0x000d, + 0x2546: 0x000d, 0x2547: 0x000d, 0x2548: 0x000d, 0x2549: 0x000d, 0x254a: 0x000d, 0x254b: 0x000d, + 0x254c: 0x000d, 0x254d: 0x000d, 0x254e: 0x000d, 0x254f: 0x000d, 0x2550: 0x000d, 0x2551: 0x000d, + 0x2552: 0x000d, 0x2553: 0x000d, 0x2554: 0x000d, 0x2555: 0x000d, 0x2556: 0x000d, 0x2557: 0x000d, + 0x2558: 0x000d, 0x2559: 0x000d, 0x255a: 0x000d, 0x255b: 0x000d, 0x255c: 0x000d, 0x255d: 0x000d, + 0x255e: 0x000d, 0x255f: 0x000d, 0x2560: 0x000d, 0x2561: 0x000d, 0x2562: 0x000d, 0x2563: 0x000d, + 0x2564: 0x000d, 0x2565: 0x000d, 0x2566: 0x000d, 0x2567: 0x000d, 0x2568: 0x000d, 0x2569: 0x000d, + 0x256a: 0x000d, 0x256b: 0x000d, 0x256c: 0x000d, 0x256d: 0x000d, 0x256e: 0x000d, 0x256f: 0x000d, + 0x2570: 0x000d, 0x2571: 0x000d, 0x2572: 0x000d, 0x2573: 0x000d, 0x2574: 0x000d, 0x2575: 0x000d, + 0x2576: 0x000d, 0x2577: 0x000d, 0x2578: 0x000d, 0x2579: 0x000d, 0x257a: 0x000d, 0x257b: 0x000d, + 0x257c: 0x000d, 0x257d: 0x000d, 0x257e: 0x000d, 0x257f: 0x000b, + // Block 0x96, offset 0x2580 + 0x2581: 0x000a, 0x2582: 0x000a, 0x2583: 0x0004, 0x2584: 0x0004, 0x2585: 0x0004, + 0x2586: 0x000a, 0x2587: 0x000a, 0x2588: 0x003a, 0x2589: 0x002a, 0x258a: 0x000a, 0x258b: 0x0003, + 0x258c: 0x0006, 0x258d: 0x0003, 0x258e: 0x0006, 0x258f: 0x0006, 0x2590: 0x0002, 0x2591: 0x0002, + 0x2592: 0x0002, 0x2593: 0x0002, 0x2594: 0x0002, 0x2595: 0x0002, 0x2596: 0x0002, 0x2597: 0x0002, + 0x2598: 0x0002, 0x2599: 0x0002, 0x259a: 0x0006, 0x259b: 0x000a, 0x259c: 0x000a, 0x259d: 0x000a, + 0x259e: 0x000a, 0x259f: 0x000a, 0x25a0: 0x000a, + 0x25bb: 0x005a, + 0x25bc: 0x000a, 0x25bd: 0x004a, 0x25be: 0x000a, 0x25bf: 0x000a, + // Block 0x97, offset 0x25c0 + 0x25c0: 0x000a, + 0x25db: 0x005a, 0x25dc: 0x000a, 0x25dd: 0x004a, + 0x25de: 0x000a, 0x25df: 0x00fa, 0x25e0: 0x00ea, 0x25e1: 0x000a, 0x25e2: 0x003a, 0x25e3: 0x002a, + 0x25e4: 0x000a, 0x25e5: 0x000a, + // Block 0x98, offset 0x2600 + 0x2620: 0x0004, 0x2621: 0x0004, 0x2622: 0x000a, 0x2623: 0x000a, + 0x2624: 0x000a, 0x2625: 0x0004, 0x2626: 0x0004, 0x2628: 0x000a, 0x2629: 0x000a, + 0x262a: 0x000a, 0x262b: 0x000a, 0x262c: 0x000a, 0x262d: 0x000a, 0x262e: 0x000a, + 0x2630: 0x000b, 0x2631: 0x000b, 0x2632: 0x000b, 0x2633: 0x000b, 0x2634: 0x000b, 0x2635: 0x000b, + 0x2636: 0x000b, 0x2637: 0x000b, 0x2638: 0x000b, 0x2639: 0x000a, 0x263a: 0x000a, 0x263b: 0x000a, + 0x263c: 0x000a, 0x263d: 0x000a, 0x263e: 0x000b, 0x263f: 0x000b, + // Block 0x99, offset 0x2640 + 0x2641: 0x000a, + // Block 0x9a, offset 0x2680 + 0x2680: 0x000a, 0x2681: 0x000a, 0x2682: 0x000a, 0x2683: 0x000a, 0x2684: 0x000a, 0x2685: 0x000a, + 0x2686: 0x000a, 0x2687: 0x000a, 0x2688: 0x000a, 0x2689: 0x000a, 0x268a: 0x000a, 0x268b: 0x000a, + 0x268c: 0x000a, 0x2690: 0x000a, 0x2691: 0x000a, + 0x2692: 0x000a, 0x2693: 0x000a, 0x2694: 0x000a, 0x2695: 0x000a, 0x2696: 0x000a, 0x2697: 0x000a, + 0x2698: 0x000a, 0x2699: 0x000a, 0x269a: 0x000a, 0x269b: 0x000a, 0x269c: 0x000a, + 0x26a0: 0x000a, + // Block 0x9b, offset 0x26c0 + 0x26fd: 0x000c, + // Block 0x9c, offset 0x2700 + 0x2720: 0x000c, 0x2721: 0x0002, 0x2722: 0x0002, 0x2723: 0x0002, + 0x2724: 0x0002, 0x2725: 0x0002, 0x2726: 0x0002, 0x2727: 0x0002, 0x2728: 0x0002, 0x2729: 0x0002, + 0x272a: 0x0002, 0x272b: 0x0002, 0x272c: 0x0002, 0x272d: 0x0002, 0x272e: 0x0002, 0x272f: 0x0002, + 0x2730: 0x0002, 0x2731: 0x0002, 0x2732: 0x0002, 0x2733: 0x0002, 0x2734: 0x0002, 0x2735: 0x0002, + 0x2736: 0x0002, 0x2737: 0x0002, 0x2738: 0x0002, 0x2739: 0x0002, 0x273a: 0x0002, 0x273b: 0x0002, + // Block 0x9d, offset 0x2740 + 0x2776: 0x000c, 0x2777: 0x000c, 0x2778: 0x000c, 0x2779: 0x000c, 0x277a: 0x000c, + // Block 0x9e, offset 0x2780 + 0x2780: 0x0001, 0x2781: 0x0001, 0x2782: 0x0001, 0x2783: 0x0001, 0x2784: 0x0001, 0x2785: 0x0001, + 0x2786: 0x0001, 0x2787: 0x0001, 0x2788: 0x0001, 0x2789: 0x0001, 0x278a: 0x0001, 0x278b: 0x0001, + 0x278c: 0x0001, 0x278d: 0x0001, 0x278e: 0x0001, 0x278f: 0x0001, 0x2790: 0x0001, 0x2791: 0x0001, + 0x2792: 0x0001, 0x2793: 0x0001, 0x2794: 0x0001, 0x2795: 0x0001, 0x2796: 0x0001, 0x2797: 0x0001, + 0x2798: 0x0001, 0x2799: 0x0001, 0x279a: 0x0001, 0x279b: 0x0001, 0x279c: 0x0001, 0x279d: 0x0001, + 0x279e: 0x0001, 0x279f: 0x0001, 0x27a0: 0x0001, 0x27a1: 0x0001, 0x27a2: 0x0001, 0x27a3: 0x0001, + 0x27a4: 0x0001, 0x27a5: 0x0001, 0x27a6: 0x0001, 0x27a7: 0x0001, 0x27a8: 0x0001, 0x27a9: 0x0001, + 0x27aa: 0x0001, 0x27ab: 0x0001, 0x27ac: 0x0001, 0x27ad: 0x0001, 0x27ae: 0x0001, 0x27af: 0x0001, + 0x27b0: 0x0001, 0x27b1: 0x0001, 0x27b2: 0x0001, 0x27b3: 0x0001, 0x27b4: 0x0001, 0x27b5: 0x0001, + 0x27b6: 0x0001, 0x27b7: 0x0001, 0x27b8: 0x0001, 0x27b9: 0x0001, 0x27ba: 0x0001, 0x27bb: 0x0001, + 0x27bc: 0x0001, 0x27bd: 0x0001, 0x27be: 0x0001, 0x27bf: 0x0001, + // Block 0x9f, offset 0x27c0 + 0x27c0: 0x0001, 0x27c1: 0x0001, 0x27c2: 0x0001, 0x27c3: 0x0001, 0x27c4: 0x0001, 0x27c5: 0x0001, + 0x27c6: 0x0001, 0x27c7: 0x0001, 0x27c8: 0x0001, 0x27c9: 0x0001, 0x27ca: 0x0001, 0x27cb: 0x0001, + 0x27cc: 0x0001, 0x27cd: 0x0001, 0x27ce: 0x0001, 0x27cf: 0x0001, 0x27d0: 0x0001, 0x27d1: 0x0001, + 0x27d2: 0x0001, 0x27d3: 0x0001, 0x27d4: 0x0001, 0x27d5: 0x0001, 0x27d6: 0x0001, 0x27d7: 0x0001, + 0x27d8: 0x0001, 0x27d9: 0x0001, 0x27da: 0x0001, 0x27db: 0x0001, 0x27dc: 0x0001, 0x27dd: 0x0001, + 0x27de: 0x0001, 0x27df: 0x000a, 0x27e0: 0x0001, 0x27e1: 0x0001, 0x27e2: 0x0001, 0x27e3: 0x0001, + 0x27e4: 0x0001, 0x27e5: 0x0001, 0x27e6: 0x0001, 0x27e7: 0x0001, 0x27e8: 0x0001, 0x27e9: 0x0001, + 0x27ea: 0x0001, 0x27eb: 0x0001, 0x27ec: 0x0001, 0x27ed: 0x0001, 0x27ee: 0x0001, 0x27ef: 0x0001, + 0x27f0: 0x0001, 0x27f1: 0x0001, 0x27f2: 0x0001, 0x27f3: 0x0001, 0x27f4: 0x0001, 0x27f5: 0x0001, + 0x27f6: 0x0001, 0x27f7: 0x0001, 0x27f8: 0x0001, 0x27f9: 0x0001, 0x27fa: 0x0001, 0x27fb: 0x0001, + 0x27fc: 0x0001, 0x27fd: 0x0001, 0x27fe: 0x0001, 0x27ff: 0x0001, + // Block 0xa0, offset 0x2800 + 0x2800: 0x0001, 0x2801: 0x000c, 0x2802: 0x000c, 0x2803: 0x000c, 0x2804: 0x0001, 0x2805: 0x000c, + 0x2806: 0x000c, 0x2807: 0x0001, 0x2808: 0x0001, 0x2809: 0x0001, 0x280a: 0x0001, 0x280b: 0x0001, + 0x280c: 0x000c, 0x280d: 0x000c, 0x280e: 0x000c, 0x280f: 0x000c, 0x2810: 0x0001, 0x2811: 0x0001, + 0x2812: 0x0001, 0x2813: 0x0001, 0x2814: 0x0001, 0x2815: 0x0001, 0x2816: 0x0001, 0x2817: 0x0001, + 0x2818: 0x0001, 0x2819: 0x0001, 0x281a: 0x0001, 0x281b: 0x0001, 0x281c: 0x0001, 0x281d: 0x0001, + 0x281e: 0x0001, 0x281f: 0x0001, 0x2820: 0x0001, 0x2821: 0x0001, 0x2822: 0x0001, 0x2823: 0x0001, + 0x2824: 0x0001, 0x2825: 0x0001, 0x2826: 0x0001, 0x2827: 0x0001, 0x2828: 0x0001, 0x2829: 0x0001, + 0x282a: 0x0001, 0x282b: 0x0001, 0x282c: 0x0001, 0x282d: 0x0001, 0x282e: 0x0001, 0x282f: 0x0001, + 0x2830: 0x0001, 0x2831: 0x0001, 0x2832: 0x0001, 0x2833: 0x0001, 0x2834: 0x0001, 0x2835: 0x0001, + 0x2836: 0x0001, 0x2837: 0x0001, 0x2838: 0x000c, 0x2839: 0x000c, 0x283a: 0x000c, 0x283b: 0x0001, + 0x283c: 0x0001, 0x283d: 0x0001, 0x283e: 0x0001, 0x283f: 0x000c, + // Block 0xa1, offset 0x2840 + 0x2840: 0x0001, 0x2841: 0x0001, 0x2842: 0x0001, 0x2843: 0x0001, 0x2844: 0x0001, 0x2845: 0x0001, + 0x2846: 0x0001, 0x2847: 0x0001, 0x2848: 0x0001, 0x2849: 0x0001, 0x284a: 0x0001, 0x284b: 0x0001, + 0x284c: 0x0001, 0x284d: 0x0001, 0x284e: 0x0001, 0x284f: 0x0001, 0x2850: 0x0001, 0x2851: 0x0001, + 0x2852: 0x0001, 0x2853: 0x0001, 0x2854: 0x0001, 0x2855: 0x0001, 0x2856: 0x0001, 0x2857: 0x0001, + 0x2858: 0x0001, 0x2859: 0x0001, 0x285a: 0x0001, 0x285b: 0x0001, 0x285c: 0x0001, 0x285d: 0x0001, + 0x285e: 0x0001, 0x285f: 0x0001, 0x2860: 0x0001, 0x2861: 0x0001, 0x2862: 0x0001, 0x2863: 0x0001, + 0x2864: 0x0001, 0x2865: 0x000c, 0x2866: 0x000c, 0x2867: 0x0001, 0x2868: 0x0001, 0x2869: 0x0001, + 0x286a: 0x0001, 0x286b: 0x0001, 0x286c: 0x0001, 0x286d: 0x0001, 0x286e: 0x0001, 0x286f: 0x0001, + 0x2870: 0x0001, 0x2871: 0x0001, 0x2872: 0x0001, 0x2873: 0x0001, 0x2874: 0x0001, 0x2875: 0x0001, + 0x2876: 0x0001, 0x2877: 0x0001, 0x2878: 0x0001, 0x2879: 0x0001, 0x287a: 0x0001, 0x287b: 0x0001, + 0x287c: 0x0001, 0x287d: 0x0001, 0x287e: 0x0001, 0x287f: 0x0001, + // Block 0xa2, offset 0x2880 + 0x2880: 0x0001, 0x2881: 0x0001, 0x2882: 0x0001, 0x2883: 0x0001, 0x2884: 0x0001, 0x2885: 0x0001, + 0x2886: 0x0001, 0x2887: 0x0001, 0x2888: 0x0001, 0x2889: 0x0001, 0x288a: 0x0001, 0x288b: 0x0001, + 0x288c: 0x0001, 0x288d: 0x0001, 0x288e: 0x0001, 0x288f: 0x0001, 0x2890: 0x0001, 0x2891: 0x0001, + 0x2892: 0x0001, 0x2893: 0x0001, 0x2894: 0x0001, 0x2895: 0x0001, 0x2896: 0x0001, 0x2897: 0x0001, + 0x2898: 0x0001, 0x2899: 0x0001, 0x289a: 0x0001, 0x289b: 0x0001, 0x289c: 0x0001, 0x289d: 0x0001, + 0x289e: 0x0001, 0x289f: 0x0001, 0x28a0: 0x0001, 0x28a1: 0x0001, 0x28a2: 0x0001, 0x28a3: 0x0001, + 0x28a4: 0x0001, 0x28a5: 0x0001, 0x28a6: 0x0001, 0x28a7: 0x0001, 0x28a8: 0x0001, 0x28a9: 0x0001, + 0x28aa: 0x0001, 0x28ab: 0x0001, 0x28ac: 0x0001, 0x28ad: 0x0001, 0x28ae: 0x0001, 0x28af: 0x0001, + 0x28b0: 0x0001, 0x28b1: 0x0001, 0x28b2: 0x0001, 0x28b3: 0x0001, 0x28b4: 0x0001, 0x28b5: 0x0001, + 0x28b6: 0x0001, 0x28b7: 0x0001, 0x28b8: 0x0001, 0x28b9: 0x000a, 0x28ba: 0x000a, 0x28bb: 0x000a, + 0x28bc: 0x000a, 0x28bd: 0x000a, 0x28be: 0x000a, 0x28bf: 0x000a, + // Block 0xa3, offset 0x28c0 + 0x28c0: 0x000d, 0x28c1: 0x000d, 0x28c2: 0x000d, 0x28c3: 0x000d, 0x28c4: 0x000d, 0x28c5: 0x000d, + 0x28c6: 0x000d, 0x28c7: 0x000d, 0x28c8: 0x000d, 0x28c9: 0x000d, 0x28ca: 0x000d, 0x28cb: 0x000d, + 0x28cc: 0x000d, 0x28cd: 0x000d, 0x28ce: 0x000d, 0x28cf: 0x000d, 0x28d0: 0x000d, 0x28d1: 0x000d, + 0x28d2: 0x000d, 0x28d3: 0x000d, 0x28d4: 0x000d, 0x28d5: 0x000d, 0x28d6: 0x000d, 0x28d7: 0x000d, + 0x28d8: 0x000d, 0x28d9: 0x000d, 0x28da: 0x000d, 0x28db: 0x000d, 0x28dc: 0x000d, 0x28dd: 0x000d, + 0x28de: 0x000d, 0x28df: 0x000d, 0x28e0: 0x000d, 0x28e1: 0x000d, 0x28e2: 0x000d, 0x28e3: 0x000d, + 0x28e4: 0x000c, 0x28e5: 0x000c, 0x28e6: 0x000c, 0x28e7: 0x000c, 0x28e8: 0x0001, 0x28e9: 0x0001, + 0x28ea: 0x0001, 0x28eb: 0x0001, 0x28ec: 0x0001, 0x28ed: 0x0001, 0x28ee: 0x0001, 0x28ef: 0x0001, + 0x28f0: 0x0005, 0x28f1: 0x0005, 0x28f2: 0x0005, 0x28f3: 0x0005, 0x28f4: 0x0005, 0x28f5: 0x0005, + 0x28f6: 0x0005, 0x28f7: 0x0005, 0x28f8: 0x0005, 0x28f9: 0x0005, 0x28fa: 0x0001, 0x28fb: 0x0001, + 0x28fc: 0x0001, 0x28fd: 0x0001, 0x28fe: 0x0001, 0x28ff: 0x0001, + // Block 0xa4, offset 0x2900 + 0x2900: 0x0001, 0x2901: 0x0001, 0x2902: 0x0001, 0x2903: 0x0001, 0x2904: 0x0001, 0x2905: 0x0001, + 0x2906: 0x0001, 0x2907: 0x0001, 0x2908: 0x0001, 0x2909: 0x0001, 0x290a: 0x0001, 0x290b: 0x0001, + 0x290c: 0x0001, 0x290d: 0x0001, 0x290e: 0x0001, 0x290f: 0x0001, 0x2910: 0x0001, 0x2911: 0x0001, + 0x2912: 0x0001, 0x2913: 0x0001, 0x2914: 0x0001, 0x2915: 0x0001, 0x2916: 0x0001, 0x2917: 0x0001, + 0x2918: 0x0001, 0x2919: 0x0001, 0x291a: 0x0001, 0x291b: 0x0001, 0x291c: 0x0001, 0x291d: 0x0001, + 0x291e: 0x0001, 0x291f: 0x0001, 0x2920: 0x0005, 0x2921: 0x0005, 0x2922: 0x0005, 0x2923: 0x0005, + 0x2924: 0x0005, 0x2925: 0x0005, 0x2926: 0x0005, 0x2927: 0x0005, 0x2928: 0x0005, 0x2929: 0x0005, + 0x292a: 0x0005, 0x292b: 0x0005, 0x292c: 0x0005, 0x292d: 0x0005, 0x292e: 0x0005, 0x292f: 0x0005, + 0x2930: 0x0005, 0x2931: 0x0005, 0x2932: 0x0005, 0x2933: 0x0005, 0x2934: 0x0005, 0x2935: 0x0005, + 0x2936: 0x0005, 0x2937: 0x0005, 0x2938: 0x0005, 0x2939: 0x0005, 0x293a: 0x0005, 0x293b: 0x0005, + 0x293c: 0x0005, 0x293d: 0x0005, 0x293e: 0x0005, 0x293f: 0x0001, + // Block 0xa5, offset 0x2940 + 0x2940: 0x0001, 0x2941: 0x0001, 0x2942: 0x0001, 0x2943: 0x0001, 0x2944: 0x0001, 0x2945: 0x0001, + 0x2946: 0x0001, 0x2947: 0x0001, 0x2948: 0x0001, 0x2949: 0x0001, 0x294a: 0x0001, 0x294b: 0x0001, + 0x294c: 0x0001, 0x294d: 0x0001, 0x294e: 0x0001, 0x294f: 0x0001, 0x2950: 0x0001, 0x2951: 0x0001, + 0x2952: 0x0001, 0x2953: 0x0001, 0x2954: 0x0001, 0x2955: 0x0001, 0x2956: 0x0001, 0x2957: 0x0001, + 0x2958: 0x0001, 0x2959: 0x0001, 0x295a: 0x0001, 0x295b: 0x0001, 0x295c: 0x0001, 0x295d: 0x0001, + 0x295e: 0x0001, 0x295f: 0x0001, 0x2960: 0x0001, 0x2961: 0x0001, 0x2962: 0x0001, 0x2963: 0x0001, + 0x2964: 0x0001, 0x2965: 0x0001, 0x2966: 0x0001, 0x2967: 0x0001, 0x2968: 0x0001, 0x2969: 0x0001, + 0x296a: 0x0001, 0x296b: 0x000c, 0x296c: 0x000c, 0x296d: 0x0001, 0x296e: 0x0001, 0x296f: 0x0001, + 0x2970: 0x0001, 0x2971: 0x0001, 0x2972: 0x0001, 0x2973: 0x0001, 0x2974: 0x0001, 0x2975: 0x0001, + 0x2976: 0x0001, 0x2977: 0x0001, 0x2978: 0x0001, 0x2979: 0x0001, 0x297a: 0x0001, 0x297b: 0x0001, + 0x297c: 0x0001, 0x297d: 0x0001, 0x297e: 0x0001, 0x297f: 0x0001, + // Block 0xa6, offset 0x2980 + 0x2980: 0x0001, 0x2981: 0x0001, 0x2982: 0x0001, 0x2983: 0x0001, 0x2984: 0x0001, 0x2985: 0x0001, + 0x2986: 0x0001, 0x2987: 0x0001, 0x2988: 0x0001, 0x2989: 0x0001, 0x298a: 0x0001, 0x298b: 0x0001, + 0x298c: 0x0001, 0x298d: 0x0001, 0x298e: 0x0001, 0x298f: 0x0001, 0x2990: 0x0001, 0x2991: 0x0001, + 0x2992: 0x0001, 0x2993: 0x0001, 0x2994: 0x0001, 0x2995: 0x0001, 0x2996: 0x0001, 0x2997: 0x0001, + 0x2998: 0x0001, 0x2999: 0x0001, 0x299a: 0x0001, 0x299b: 0x0001, 0x299c: 0x0001, 0x299d: 0x0001, + 0x299e: 0x0001, 0x299f: 0x0001, 0x29a0: 0x0001, 0x29a1: 0x0001, 0x29a2: 0x0001, 0x29a3: 0x0001, + 0x29a4: 0x0001, 0x29a5: 0x0001, 0x29a6: 0x0001, 0x29a7: 0x0001, 0x29a8: 0x0001, 0x29a9: 0x0001, + 0x29aa: 0x0001, 0x29ab: 0x0001, 0x29ac: 0x0001, 0x29ad: 0x0001, 0x29ae: 0x0001, 0x29af: 0x0001, + 0x29b0: 0x0001, 0x29b1: 0x0001, 0x29b2: 0x0001, 0x29b3: 0x0001, 0x29b4: 0x0001, 0x29b5: 0x0001, + 0x29b6: 0x0001, 0x29b7: 0x0001, 0x29b8: 0x0001, 0x29b9: 0x0001, 0x29ba: 0x0001, 0x29bb: 0x0001, + 0x29bc: 0x0001, 0x29bd: 0x000c, 0x29be: 0x000c, 0x29bf: 0x000c, + // Block 0xa7, offset 0x29c0 + 0x29c0: 0x0001, 0x29c1: 0x0001, 0x29c2: 0x0001, 0x29c3: 0x0001, 0x29c4: 0x0001, 0x29c5: 0x0001, + 0x29c6: 0x0001, 0x29c7: 0x0001, 0x29c8: 0x0001, 0x29c9: 0x0001, 0x29ca: 0x0001, 0x29cb: 0x0001, + 0x29cc: 0x0001, 0x29cd: 0x0001, 0x29ce: 0x0001, 0x29cf: 0x0001, 0x29d0: 0x0001, 0x29d1: 0x0001, + 0x29d2: 0x0001, 0x29d3: 0x0001, 0x29d4: 0x0001, 0x29d5: 0x0001, 0x29d6: 0x0001, 0x29d7: 0x0001, + 0x29d8: 0x0001, 0x29d9: 0x0001, 0x29da: 0x0001, 0x29db: 0x0001, 0x29dc: 0x0001, 0x29dd: 0x0001, + 0x29de: 0x0001, 0x29df: 0x0001, 0x29e0: 0x0001, 0x29e1: 0x0001, 0x29e2: 0x0001, 0x29e3: 0x0001, + 0x29e4: 0x0001, 0x29e5: 0x0001, 0x29e6: 0x0001, 0x29e7: 0x0001, 0x29e8: 0x0001, 0x29e9: 0x0001, + 0x29ea: 0x0001, 0x29eb: 0x0001, 0x29ec: 0x0001, 0x29ed: 0x0001, 0x29ee: 0x0001, 0x29ef: 0x0001, + 0x29f0: 0x000d, 0x29f1: 0x000d, 0x29f2: 0x000d, 0x29f3: 0x000d, 0x29f4: 0x000d, 0x29f5: 0x000d, + 0x29f6: 0x000d, 0x29f7: 0x000d, 0x29f8: 0x000d, 0x29f9: 0x000d, 0x29fa: 0x000d, 0x29fb: 0x000d, + 0x29fc: 0x000d, 0x29fd: 0x000d, 0x29fe: 0x000d, 0x29ff: 0x000d, + // Block 0xa8, offset 0x2a00 + 0x2a00: 0x000d, 0x2a01: 0x000d, 0x2a02: 0x000d, 0x2a03: 0x000d, 0x2a04: 0x000d, 0x2a05: 0x000d, + 0x2a06: 0x000c, 0x2a07: 0x000c, 0x2a08: 0x000c, 0x2a09: 0x000c, 0x2a0a: 0x000c, 0x2a0b: 0x000c, + 0x2a0c: 0x000c, 0x2a0d: 0x000c, 0x2a0e: 0x000c, 0x2a0f: 0x000c, 0x2a10: 0x000c, 0x2a11: 0x000d, + 0x2a12: 0x000d, 0x2a13: 0x000d, 0x2a14: 0x000d, 0x2a15: 0x000d, 0x2a16: 0x000d, 0x2a17: 0x000d, + 0x2a18: 0x000d, 0x2a19: 0x000d, 0x2a1a: 0x0001, 0x2a1b: 0x0001, 0x2a1c: 0x0001, 0x2a1d: 0x0001, + 0x2a1e: 0x0001, 0x2a1f: 0x0001, 0x2a20: 0x0001, 0x2a21: 0x0001, 0x2a22: 0x0001, 0x2a23: 0x0001, + 0x2a24: 0x0001, 0x2a25: 0x0001, 0x2a26: 0x0001, 0x2a27: 0x0001, 0x2a28: 0x0001, 0x2a29: 0x0001, + 0x2a2a: 0x0001, 0x2a2b: 0x0001, 0x2a2c: 0x0001, 0x2a2d: 0x0001, 0x2a2e: 0x0001, 0x2a2f: 0x0001, + 0x2a30: 0x0001, 0x2a31: 0x0001, 0x2a32: 0x0001, 0x2a33: 0x0001, 0x2a34: 0x0001, 0x2a35: 0x0001, + 0x2a36: 0x0001, 0x2a37: 0x0001, 0x2a38: 0x0001, 0x2a39: 0x0001, 0x2a3a: 0x0001, 0x2a3b: 0x0001, + 0x2a3c: 0x0001, 0x2a3d: 0x0001, 0x2a3e: 0x0001, 0x2a3f: 0x0001, + // Block 0xa9, offset 0x2a40 + 0x2a40: 0x0001, 0x2a41: 0x0001, 0x2a42: 0x000c, 0x2a43: 0x000c, 0x2a44: 0x000c, 0x2a45: 0x000c, + 0x2a46: 0x0001, 0x2a47: 0x0001, 0x2a48: 0x0001, 0x2a49: 0x0001, 0x2a4a: 0x0001, 0x2a4b: 0x0001, + 0x2a4c: 0x0001, 0x2a4d: 0x0001, 0x2a4e: 0x0001, 0x2a4f: 0x0001, 0x2a50: 0x0001, 0x2a51: 0x0001, + 0x2a52: 0x0001, 0x2a53: 0x0001, 0x2a54: 0x0001, 0x2a55: 0x0001, 0x2a56: 0x0001, 0x2a57: 0x0001, + 0x2a58: 0x0001, 0x2a59: 0x0001, 0x2a5a: 0x0001, 0x2a5b: 0x0001, 0x2a5c: 0x0001, 0x2a5d: 0x0001, + 0x2a5e: 0x0001, 0x2a5f: 0x0001, 0x2a60: 0x0001, 0x2a61: 0x0001, 0x2a62: 0x0001, 0x2a63: 0x0001, + 0x2a64: 0x0001, 0x2a65: 0x0001, 0x2a66: 0x0001, 0x2a67: 0x0001, 0x2a68: 0x0001, 0x2a69: 0x0001, + 0x2a6a: 0x0001, 0x2a6b: 0x0001, 0x2a6c: 0x0001, 0x2a6d: 0x0001, 0x2a6e: 0x0001, 0x2a6f: 0x0001, + 0x2a70: 0x0001, 0x2a71: 0x0001, 0x2a72: 0x0001, 0x2a73: 0x0001, 0x2a74: 0x0001, 0x2a75: 0x0001, + 0x2a76: 0x0001, 0x2a77: 0x0001, 0x2a78: 0x0001, 0x2a79: 0x0001, 0x2a7a: 0x0001, 0x2a7b: 0x0001, + 0x2a7c: 0x0001, 0x2a7d: 0x0001, 0x2a7e: 0x0001, 0x2a7f: 0x0001, + // Block 0xaa, offset 0x2a80 + 0x2a81: 0x000c, + 0x2ab8: 0x000c, 0x2ab9: 0x000c, 0x2aba: 0x000c, 0x2abb: 0x000c, + 0x2abc: 0x000c, 0x2abd: 0x000c, 0x2abe: 0x000c, 0x2abf: 0x000c, + // Block 0xab, offset 0x2ac0 + 0x2ac0: 0x000c, 0x2ac1: 0x000c, 0x2ac2: 0x000c, 0x2ac3: 0x000c, 0x2ac4: 0x000c, 0x2ac5: 0x000c, + 0x2ac6: 0x000c, + 0x2ad2: 0x000a, 0x2ad3: 0x000a, 0x2ad4: 0x000a, 0x2ad5: 0x000a, 0x2ad6: 0x000a, 0x2ad7: 0x000a, + 0x2ad8: 0x000a, 0x2ad9: 0x000a, 0x2ada: 0x000a, 0x2adb: 0x000a, 0x2adc: 0x000a, 0x2add: 0x000a, + 0x2ade: 0x000a, 0x2adf: 0x000a, 0x2ae0: 0x000a, 0x2ae1: 0x000a, 0x2ae2: 0x000a, 0x2ae3: 0x000a, + 0x2ae4: 0x000a, 0x2ae5: 0x000a, + 0x2af0: 0x000c, 0x2af3: 0x000c, 0x2af4: 0x000c, + 0x2aff: 0x000c, + // Block 0xac, offset 0x2b00 + 0x2b00: 0x000c, 0x2b01: 0x000c, + 0x2b33: 0x000c, 0x2b34: 0x000c, 0x2b35: 0x000c, + 0x2b36: 0x000c, 0x2b39: 0x000c, 0x2b3a: 0x000c, + // Block 0xad, offset 0x2b40 + 0x2b40: 0x000c, 0x2b41: 0x000c, 0x2b42: 0x000c, + 0x2b67: 0x000c, 0x2b68: 0x000c, 0x2b69: 0x000c, + 0x2b6a: 0x000c, 0x2b6b: 0x000c, 0x2b6d: 0x000c, 0x2b6e: 0x000c, 0x2b6f: 0x000c, + 0x2b70: 0x000c, 0x2b71: 0x000c, 0x2b72: 0x000c, 0x2b73: 0x000c, 0x2b74: 0x000c, + // Block 0xae, offset 0x2b80 + 0x2bb3: 0x000c, + // Block 0xaf, offset 0x2bc0 + 0x2bc0: 0x000c, 0x2bc1: 0x000c, + 0x2bf6: 0x000c, 0x2bf7: 0x000c, 0x2bf8: 0x000c, 0x2bf9: 0x000c, 0x2bfa: 0x000c, 0x2bfb: 0x000c, + 0x2bfc: 0x000c, 0x2bfd: 0x000c, 0x2bfe: 0x000c, + // Block 0xb0, offset 0x2c00 + 0x2c09: 0x000c, 0x2c0a: 0x000c, 0x2c0b: 0x000c, + 0x2c0c: 0x000c, 0x2c0f: 0x000c, + // Block 0xb1, offset 0x2c40 + 0x2c6f: 0x000c, + 0x2c70: 0x000c, 0x2c71: 0x000c, 0x2c74: 0x000c, + 0x2c76: 0x000c, 0x2c77: 0x000c, + 0x2c7e: 0x000c, + // Block 0xb2, offset 0x2c80 + 0x2c9f: 0x000c, 0x2ca3: 0x000c, + 0x2ca4: 0x000c, 0x2ca5: 0x000c, 0x2ca6: 0x000c, 0x2ca7: 0x000c, 0x2ca8: 0x000c, 0x2ca9: 0x000c, + 0x2caa: 0x000c, + // Block 0xb3, offset 0x2cc0 + 0x2cc0: 0x000c, + 0x2ce6: 0x000c, 0x2ce7: 0x000c, 0x2ce8: 0x000c, 0x2ce9: 0x000c, + 0x2cea: 0x000c, 0x2ceb: 0x000c, 0x2cec: 0x000c, + 0x2cf0: 0x000c, 0x2cf1: 0x000c, 0x2cf2: 0x000c, 0x2cf3: 0x000c, 0x2cf4: 0x000c, + // Block 0xb4, offset 0x2d00 + 0x2d38: 0x000c, 0x2d39: 0x000c, 0x2d3a: 0x000c, 0x2d3b: 0x000c, + 0x2d3c: 0x000c, 0x2d3d: 0x000c, 0x2d3e: 0x000c, 0x2d3f: 0x000c, + // Block 0xb5, offset 0x2d40 + 0x2d42: 0x000c, 0x2d43: 0x000c, 0x2d44: 0x000c, + 0x2d46: 0x000c, + 0x2d5e: 0x000c, + // Block 0xb6, offset 0x2d80 + 0x2db3: 0x000c, 0x2db4: 0x000c, 0x2db5: 0x000c, + 0x2db6: 0x000c, 0x2db7: 0x000c, 0x2db8: 0x000c, 0x2dba: 0x000c, + 0x2dbf: 0x000c, + // Block 0xb7, offset 0x2dc0 + 0x2dc0: 0x000c, 0x2dc2: 0x000c, 0x2dc3: 0x000c, + // Block 0xb8, offset 0x2e00 + 0x2e32: 0x000c, 0x2e33: 0x000c, 0x2e34: 0x000c, 0x2e35: 0x000c, + 0x2e3c: 0x000c, 0x2e3d: 0x000c, 0x2e3f: 0x000c, + // Block 0xb9, offset 0x2e40 + 0x2e40: 0x000c, + 0x2e5c: 0x000c, 0x2e5d: 0x000c, + // Block 0xba, offset 0x2e80 + 0x2eb3: 0x000c, 0x2eb4: 0x000c, 0x2eb5: 0x000c, + 0x2eb6: 0x000c, 0x2eb7: 0x000c, 0x2eb8: 0x000c, 0x2eb9: 0x000c, 0x2eba: 0x000c, + 0x2ebd: 0x000c, 0x2ebf: 0x000c, + // Block 0xbb, offset 0x2ec0 + 0x2ec0: 0x000c, + 0x2ee0: 0x000a, 0x2ee1: 0x000a, 0x2ee2: 0x000a, 0x2ee3: 0x000a, + 0x2ee4: 0x000a, 0x2ee5: 0x000a, 0x2ee6: 0x000a, 0x2ee7: 0x000a, 0x2ee8: 0x000a, 0x2ee9: 0x000a, + 0x2eea: 0x000a, 0x2eeb: 0x000a, 0x2eec: 0x000a, + // Block 0xbc, offset 0x2f00 + 0x2f2b: 0x000c, 0x2f2d: 0x000c, + 0x2f30: 0x000c, 0x2f31: 0x000c, 0x2f32: 0x000c, 0x2f33: 0x000c, 0x2f34: 0x000c, 0x2f35: 0x000c, + 0x2f37: 0x000c, + // Block 0xbd, offset 0x2f40 + 0x2f5d: 0x000c, + 0x2f5e: 0x000c, 0x2f5f: 0x000c, 0x2f62: 0x000c, 0x2f63: 0x000c, + 0x2f64: 0x000c, 0x2f65: 0x000c, 0x2f67: 0x000c, 0x2f68: 0x000c, 0x2f69: 0x000c, + 0x2f6a: 0x000c, 0x2f6b: 0x000c, + // Block 0xbe, offset 0x2f80 + 0x2faf: 0x000c, + 0x2fb0: 0x000c, 0x2fb1: 0x000c, 0x2fb2: 0x000c, 0x2fb3: 0x000c, 0x2fb4: 0x000c, 0x2fb5: 0x000c, + 0x2fb6: 0x000c, 0x2fb7: 0x000c, 0x2fb9: 0x000c, 0x2fba: 0x000c, + // Block 0xbf, offset 0x2fc0 + 0x2ffb: 0x000c, + 0x2ffc: 0x000c, 0x2ffe: 0x000c, + // Block 0xc0, offset 0x3000 + 0x3003: 0x000c, + // Block 0xc1, offset 0x3040 + 0x3054: 0x000c, 0x3055: 0x000c, 0x3056: 0x000c, 0x3057: 0x000c, + 0x305a: 0x000c, 0x305b: 0x000c, + 0x3060: 0x000c, + // Block 0xc2, offset 0x3080 + 0x3081: 0x000c, 0x3082: 0x000c, 0x3083: 0x000c, 0x3084: 0x000c, 0x3085: 0x000c, + 0x3086: 0x000c, 0x3089: 0x000c, 0x308a: 0x000c, + 0x30b3: 0x000c, 0x30b4: 0x000c, 0x30b5: 0x000c, + 0x30b6: 0x000c, 0x30b7: 0x000c, 0x30b8: 0x000c, 0x30bb: 0x000c, + 0x30bc: 0x000c, 0x30bd: 0x000c, 0x30be: 0x000c, + // Block 0xc3, offset 0x30c0 + 0x30c7: 0x000c, + 0x30d1: 0x000c, + 0x30d2: 0x000c, 0x30d3: 0x000c, 0x30d4: 0x000c, 0x30d5: 0x000c, 0x30d6: 0x000c, + 0x30d9: 0x000c, 0x30da: 0x000c, 0x30db: 0x000c, + // Block 0xc4, offset 0x3100 + 0x310a: 0x000c, 0x310b: 0x000c, + 0x310c: 0x000c, 0x310d: 0x000c, 0x310e: 0x000c, 0x310f: 0x000c, 0x3110: 0x000c, 0x3111: 0x000c, + 0x3112: 0x000c, 0x3113: 0x000c, 0x3114: 0x000c, 0x3115: 0x000c, 0x3116: 0x000c, + 0x3118: 0x000c, 0x3119: 0x000c, + // Block 0xc5, offset 0x3140 + 0x3170: 0x000c, 0x3171: 0x000c, 0x3172: 0x000c, 0x3173: 0x000c, 0x3174: 0x000c, 0x3175: 0x000c, + 0x3176: 0x000c, 0x3178: 0x000c, 0x3179: 0x000c, 0x317a: 0x000c, 0x317b: 0x000c, + 0x317c: 0x000c, 0x317d: 0x000c, + // Block 0xc6, offset 0x3180 + 0x3192: 0x000c, 0x3193: 0x000c, 0x3194: 0x000c, 0x3195: 0x000c, 0x3196: 0x000c, 0x3197: 0x000c, + 0x3198: 0x000c, 0x3199: 0x000c, 0x319a: 0x000c, 0x319b: 0x000c, 0x319c: 0x000c, 0x319d: 0x000c, + 0x319e: 0x000c, 0x319f: 0x000c, 0x31a0: 0x000c, 0x31a1: 0x000c, 0x31a2: 0x000c, 0x31a3: 0x000c, + 0x31a4: 0x000c, 0x31a5: 0x000c, 0x31a6: 0x000c, 0x31a7: 0x000c, + 0x31aa: 0x000c, 0x31ab: 0x000c, 0x31ac: 0x000c, 0x31ad: 0x000c, 0x31ae: 0x000c, 0x31af: 0x000c, + 0x31b0: 0x000c, 0x31b2: 0x000c, 0x31b3: 0x000c, 0x31b5: 0x000c, + 0x31b6: 0x000c, + // Block 0xc7, offset 0x31c0 + 0x31f1: 0x000c, 0x31f2: 0x000c, 0x31f3: 0x000c, 0x31f4: 0x000c, 0x31f5: 0x000c, + 0x31f6: 0x000c, 0x31fa: 0x000c, + 0x31fc: 0x000c, 0x31fd: 0x000c, 0x31ff: 0x000c, + // Block 0xc8, offset 0x3200 + 0x3200: 0x000c, 0x3201: 0x000c, 0x3202: 0x000c, 0x3203: 0x000c, 0x3204: 0x000c, 0x3205: 0x000c, + 0x3207: 0x000c, + // Block 0xc9, offset 0x3240 + 0x3250: 0x000c, 0x3251: 0x000c, + 0x3255: 0x000c, 0x3257: 0x000c, + // Block 0xca, offset 0x3280 + 0x32b3: 0x000c, 0x32b4: 0x000c, + // Block 0xcb, offset 0x32c0 + 0x32c0: 0x000c, 0x32c1: 0x000c, + 0x32f6: 0x000c, 0x32f7: 0x000c, 0x32f8: 0x000c, 0x32f9: 0x000c, 0x32fa: 0x000c, + // Block 0xcc, offset 0x3300 + 0x3300: 0x000c, 0x3302: 0x000c, + // Block 0xcd, offset 0x3340 + 0x3355: 0x000a, 0x3356: 0x000a, 0x3357: 0x000a, + 0x3358: 0x000a, 0x3359: 0x000a, 0x335a: 0x000a, 0x335b: 0x000a, 0x335c: 0x000a, 0x335d: 0x0004, + 0x335e: 0x0004, 0x335f: 0x0004, 0x3360: 0x0004, 0x3361: 0x000a, 0x3362: 0x000a, 0x3363: 0x000a, + 0x3364: 0x000a, 0x3365: 0x000a, 0x3366: 0x000a, 0x3367: 0x000a, 0x3368: 0x000a, 0x3369: 0x000a, + 0x336a: 0x000a, 0x336b: 0x000a, 0x336c: 0x000a, 0x336d: 0x000a, 0x336e: 0x000a, 0x336f: 0x000a, + 0x3370: 0x000a, 0x3371: 0x000a, + // Block 0xce, offset 0x3380 + 0x3380: 0x000c, + 0x3387: 0x000c, 0x3388: 0x000c, 0x3389: 0x000c, 0x338a: 0x000c, 0x338b: 0x000c, + 0x338c: 0x000c, 0x338d: 0x000c, 0x338e: 0x000c, 0x338f: 0x000c, 0x3390: 0x000c, 0x3391: 0x000c, + 0x3392: 0x000c, 0x3393: 0x000c, 0x3394: 0x000c, 0x3395: 0x000c, + // Block 0xcf, offset 0x33c0 + 0x33f0: 0x000c, 0x33f1: 0x000c, 0x33f2: 0x000c, 0x33f3: 0x000c, 0x33f4: 0x000c, + // Block 0xd0, offset 0x3400 + 0x3430: 0x000c, 0x3431: 0x000c, 0x3432: 0x000c, 0x3433: 0x000c, 0x3434: 0x000c, 0x3435: 0x000c, + 0x3436: 0x000c, + // Block 0xd1, offset 0x3440 + 0x344f: 0x000c, + // Block 0xd2, offset 0x3480 + 0x348f: 0x000c, 0x3490: 0x000c, 0x3491: 0x000c, + 0x3492: 0x000c, + // Block 0xd3, offset 0x34c0 + 0x34e2: 0x000a, + 0x34e4: 0x000c, + // Block 0xd4, offset 0x3500 + 0x351d: 0x000c, + 0x351e: 0x000c, 0x3520: 0x000b, 0x3521: 0x000b, 0x3522: 0x000b, 0x3523: 0x000b, + // Block 0xd5, offset 0x3540 + 0x3540: 0x000c, 0x3541: 0x000c, 0x3542: 0x000c, 0x3543: 0x000c, 0x3544: 0x000c, 0x3545: 0x000c, + 0x3546: 0x000c, 0x3547: 0x000c, 0x3548: 0x000c, 0x3549: 0x000c, 0x354a: 0x000c, 0x354b: 0x000c, + 0x354c: 0x000c, 0x354d: 0x000c, 0x354e: 0x000c, 0x354f: 0x000c, 0x3550: 0x000c, 0x3551: 0x000c, + 0x3552: 0x000c, 0x3553: 0x000c, 0x3554: 0x000c, 0x3555: 0x000c, 0x3556: 0x000c, 0x3557: 0x000c, + 0x3558: 0x000c, 0x3559: 0x000c, 0x355a: 0x000c, 0x355b: 0x000c, 0x355c: 0x000c, 0x355d: 0x000c, + 0x355e: 0x000c, 0x355f: 0x000c, 0x3560: 0x000c, 0x3561: 0x000c, 0x3562: 0x000c, 0x3563: 0x000c, + 0x3564: 0x000c, 0x3565: 0x000c, 0x3566: 0x000c, 0x3567: 0x000c, 0x3568: 0x000c, 0x3569: 0x000c, + 0x356a: 0x000c, 0x356b: 0x000c, 0x356c: 0x000c, 0x356d: 0x000c, + 0x3570: 0x000c, 0x3571: 0x000c, 0x3572: 0x000c, 0x3573: 0x000c, 0x3574: 0x000c, 0x3575: 0x000c, + 0x3576: 0x000c, 0x3577: 0x000c, 0x3578: 0x000c, 0x3579: 0x000c, 0x357a: 0x000c, 0x357b: 0x000c, + 0x357c: 0x000c, 0x357d: 0x000c, 0x357e: 0x000c, 0x357f: 0x000c, + // Block 0xd6, offset 0x3580 + 0x3580: 0x000c, 0x3581: 0x000c, 0x3582: 0x000c, 0x3583: 0x000c, 0x3584: 0x000c, 0x3585: 0x000c, + 0x3586: 0x000c, + // Block 0xd7, offset 0x35c0 + 0x35e7: 0x000c, 0x35e8: 0x000c, 0x35e9: 0x000c, + 0x35f3: 0x000b, 0x35f4: 0x000b, 0x35f5: 0x000b, + 0x35f6: 0x000b, 0x35f7: 0x000b, 0x35f8: 0x000b, 0x35f9: 0x000b, 0x35fa: 0x000b, 0x35fb: 0x000c, + 0x35fc: 0x000c, 0x35fd: 0x000c, 0x35fe: 0x000c, 0x35ff: 0x000c, + // Block 0xd8, offset 0x3600 + 0x3600: 0x000c, 0x3601: 0x000c, 0x3602: 0x000c, 0x3605: 0x000c, + 0x3606: 0x000c, 0x3607: 0x000c, 0x3608: 0x000c, 0x3609: 0x000c, 0x360a: 0x000c, 0x360b: 0x000c, + 0x362a: 0x000c, 0x362b: 0x000c, 0x362c: 0x000c, 0x362d: 0x000c, + // Block 0xd9, offset 0x3640 + 0x3669: 0x000a, + 0x366a: 0x000a, + // Block 0xda, offset 0x3680 + 0x3680: 0x000a, 0x3681: 0x000a, 0x3682: 0x000c, 0x3683: 0x000c, 0x3684: 0x000c, 0x3685: 0x000a, + // Block 0xdb, offset 0x36c0 + 0x36c0: 0x000a, 0x36c1: 0x000a, 0x36c2: 0x000a, 0x36c3: 0x000a, 0x36c4: 0x000a, 0x36c5: 0x000a, + 0x36c6: 0x000a, 0x36c7: 0x000a, 0x36c8: 0x000a, 0x36c9: 0x000a, 0x36ca: 0x000a, 0x36cb: 0x000a, + 0x36cc: 0x000a, 0x36cd: 0x000a, 0x36ce: 0x000a, 0x36cf: 0x000a, 0x36d0: 0x000a, 0x36d1: 0x000a, + 0x36d2: 0x000a, 0x36d3: 0x000a, 0x36d4: 0x000a, 0x36d5: 0x000a, 0x36d6: 0x000a, + // Block 0xdc, offset 0x3700 + 0x371b: 0x000a, + // Block 0xdd, offset 0x3740 + 0x3755: 0x000a, + // Block 0xde, offset 0x3780 + 0x378f: 0x000a, + // Block 0xdf, offset 0x37c0 + 0x37c9: 0x000a, + // Block 0xe0, offset 0x3800 + 0x3803: 0x000a, + 0x380e: 0x0002, 0x380f: 0x0002, 0x3810: 0x0002, 0x3811: 0x0002, + 0x3812: 0x0002, 0x3813: 0x0002, 0x3814: 0x0002, 0x3815: 0x0002, 0x3816: 0x0002, 0x3817: 0x0002, + 0x3818: 0x0002, 0x3819: 0x0002, 0x381a: 0x0002, 0x381b: 0x0002, 0x381c: 0x0002, 0x381d: 0x0002, + 0x381e: 0x0002, 0x381f: 0x0002, 0x3820: 0x0002, 0x3821: 0x0002, 0x3822: 0x0002, 0x3823: 0x0002, + 0x3824: 0x0002, 0x3825: 0x0002, 0x3826: 0x0002, 0x3827: 0x0002, 0x3828: 0x0002, 0x3829: 0x0002, + 0x382a: 0x0002, 0x382b: 0x0002, 0x382c: 0x0002, 0x382d: 0x0002, 0x382e: 0x0002, 0x382f: 0x0002, + 0x3830: 0x0002, 0x3831: 0x0002, 0x3832: 0x0002, 0x3833: 0x0002, 0x3834: 0x0002, 0x3835: 0x0002, + 0x3836: 0x0002, 0x3837: 0x0002, 0x3838: 0x0002, 0x3839: 0x0002, 0x383a: 0x0002, 0x383b: 0x0002, + 0x383c: 0x0002, 0x383d: 0x0002, 0x383e: 0x0002, 0x383f: 0x0002, + // Block 0xe1, offset 0x3840 + 0x3840: 0x000c, 0x3841: 0x000c, 0x3842: 0x000c, 0x3843: 0x000c, 0x3844: 0x000c, 0x3845: 0x000c, + 0x3846: 0x000c, 0x3847: 0x000c, 0x3848: 0x000c, 0x3849: 0x000c, 0x384a: 0x000c, 0x384b: 0x000c, + 0x384c: 0x000c, 0x384d: 0x000c, 0x384e: 0x000c, 0x384f: 0x000c, 0x3850: 0x000c, 0x3851: 0x000c, + 0x3852: 0x000c, 0x3853: 0x000c, 0x3854: 0x000c, 0x3855: 0x000c, 0x3856: 0x000c, 0x3857: 0x000c, + 0x3858: 0x000c, 0x3859: 0x000c, 0x385a: 0x000c, 0x385b: 0x000c, 0x385c: 0x000c, 0x385d: 0x000c, + 0x385e: 0x000c, 0x385f: 0x000c, 0x3860: 0x000c, 0x3861: 0x000c, 0x3862: 0x000c, 0x3863: 0x000c, + 0x3864: 0x000c, 0x3865: 0x000c, 0x3866: 0x000c, 0x3867: 0x000c, 0x3868: 0x000c, 0x3869: 0x000c, + 0x386a: 0x000c, 0x386b: 0x000c, 0x386c: 0x000c, 0x386d: 0x000c, 0x386e: 0x000c, 0x386f: 0x000c, + 0x3870: 0x000c, 0x3871: 0x000c, 0x3872: 0x000c, 0x3873: 0x000c, 0x3874: 0x000c, 0x3875: 0x000c, + 0x3876: 0x000c, 0x387b: 0x000c, + 0x387c: 0x000c, 0x387d: 0x000c, 0x387e: 0x000c, 0x387f: 0x000c, + // Block 0xe2, offset 0x3880 + 0x3880: 0x000c, 0x3881: 0x000c, 0x3882: 0x000c, 0x3883: 0x000c, 0x3884: 0x000c, 0x3885: 0x000c, + 0x3886: 0x000c, 0x3887: 0x000c, 0x3888: 0x000c, 0x3889: 0x000c, 0x388a: 0x000c, 0x388b: 0x000c, + 0x388c: 0x000c, 0x388d: 0x000c, 0x388e: 0x000c, 0x388f: 0x000c, 0x3890: 0x000c, 0x3891: 0x000c, + 0x3892: 0x000c, 0x3893: 0x000c, 0x3894: 0x000c, 0x3895: 0x000c, 0x3896: 0x000c, 0x3897: 0x000c, + 0x3898: 0x000c, 0x3899: 0x000c, 0x389a: 0x000c, 0x389b: 0x000c, 0x389c: 0x000c, 0x389d: 0x000c, + 0x389e: 0x000c, 0x389f: 0x000c, 0x38a0: 0x000c, 0x38a1: 0x000c, 0x38a2: 0x000c, 0x38a3: 0x000c, + 0x38a4: 0x000c, 0x38a5: 0x000c, 0x38a6: 0x000c, 0x38a7: 0x000c, 0x38a8: 0x000c, 0x38a9: 0x000c, + 0x38aa: 0x000c, 0x38ab: 0x000c, 0x38ac: 0x000c, + 0x38b5: 0x000c, + // Block 0xe3, offset 0x38c0 + 0x38c4: 0x000c, + 0x38db: 0x000c, 0x38dc: 0x000c, 0x38dd: 0x000c, + 0x38de: 0x000c, 0x38df: 0x000c, 0x38e1: 0x000c, 0x38e2: 0x000c, 0x38e3: 0x000c, + 0x38e4: 0x000c, 0x38e5: 0x000c, 0x38e6: 0x000c, 0x38e7: 0x000c, 0x38e8: 0x000c, 0x38e9: 0x000c, + 0x38ea: 0x000c, 0x38eb: 0x000c, 0x38ec: 0x000c, 0x38ed: 0x000c, 0x38ee: 0x000c, 0x38ef: 0x000c, + // Block 0xe4, offset 0x3900 + 0x3900: 0x000c, 0x3901: 0x000c, 0x3902: 0x000c, 0x3903: 0x000c, 0x3904: 0x000c, 0x3905: 0x000c, + 0x3906: 0x000c, 0x3908: 0x000c, 0x3909: 0x000c, 0x390a: 0x000c, 0x390b: 0x000c, + 0x390c: 0x000c, 0x390d: 0x000c, 0x390e: 0x000c, 0x390f: 0x000c, 0x3910: 0x000c, 0x3911: 0x000c, + 0x3912: 0x000c, 0x3913: 0x000c, 0x3914: 0x000c, 0x3915: 0x000c, 0x3916: 0x000c, 0x3917: 0x000c, + 0x3918: 0x000c, 0x391b: 0x000c, 0x391c: 0x000c, 0x391d: 0x000c, + 0x391e: 0x000c, 0x391f: 0x000c, 0x3920: 0x000c, 0x3921: 0x000c, 0x3923: 0x000c, + 0x3924: 0x000c, 0x3926: 0x000c, 0x3927: 0x000c, 0x3928: 0x000c, 0x3929: 0x000c, + 0x392a: 0x000c, + // Block 0xe5, offset 0x3940 + 0x396e: 0x000c, + // Block 0xe6, offset 0x3980 + 0x39ac: 0x000c, 0x39ad: 0x000c, 0x39ae: 0x000c, 0x39af: 0x000c, + 0x39bf: 0x0004, + // Block 0xe7, offset 0x39c0 + 0x39ec: 0x000c, 0x39ed: 0x000c, 0x39ee: 0x000c, 0x39ef: 0x000c, + // Block 0xe8, offset 0x3a00 + 0x3a00: 0x0001, 0x3a01: 0x0001, 0x3a02: 0x0001, 0x3a03: 0x0001, 0x3a04: 0x0001, 0x3a05: 0x0001, + 0x3a06: 0x0001, 0x3a07: 0x0001, 0x3a08: 0x0001, 0x3a09: 0x0001, 0x3a0a: 0x0001, 0x3a0b: 0x0001, + 0x3a0c: 0x0001, 0x3a0d: 0x0001, 0x3a0e: 0x0001, 0x3a0f: 0x0001, 0x3a10: 0x000c, 0x3a11: 0x000c, + 0x3a12: 0x000c, 0x3a13: 0x000c, 0x3a14: 0x000c, 0x3a15: 0x000c, 0x3a16: 0x000c, 0x3a17: 0x0001, + 0x3a18: 0x0001, 0x3a19: 0x0001, 0x3a1a: 0x0001, 0x3a1b: 0x0001, 0x3a1c: 0x0001, 0x3a1d: 0x0001, + 0x3a1e: 0x0001, 0x3a1f: 0x0001, 0x3a20: 0x0001, 0x3a21: 0x0001, 0x3a22: 0x0001, 0x3a23: 0x0001, + 0x3a24: 0x0001, 0x3a25: 0x0001, 0x3a26: 0x0001, 0x3a27: 0x0001, 0x3a28: 0x0001, 0x3a29: 0x0001, + 0x3a2a: 0x0001, 0x3a2b: 0x0001, 0x3a2c: 0x0001, 0x3a2d: 0x0001, 0x3a2e: 0x0001, 0x3a2f: 0x0001, + 0x3a30: 0x0001, 0x3a31: 0x0001, 0x3a32: 0x0001, 0x3a33: 0x0001, 0x3a34: 0x0001, 0x3a35: 0x0001, + 0x3a36: 0x0001, 0x3a37: 0x0001, 0x3a38: 0x0001, 0x3a39: 0x0001, 0x3a3a: 0x0001, 0x3a3b: 0x0001, + 0x3a3c: 0x0001, 0x3a3d: 0x0001, 0x3a3e: 0x0001, 0x3a3f: 0x0001, + // Block 0xe9, offset 0x3a40 + 0x3a40: 0x0001, 0x3a41: 0x0001, 0x3a42: 0x0001, 0x3a43: 0x0001, 0x3a44: 0x000c, 0x3a45: 0x000c, + 0x3a46: 0x000c, 0x3a47: 0x000c, 0x3a48: 0x000c, 0x3a49: 0x000c, 0x3a4a: 0x000c, 0x3a4b: 0x0001, + 0x3a4c: 0x0001, 0x3a4d: 0x0001, 0x3a4e: 0x0001, 0x3a4f: 0x0001, 0x3a50: 0x0001, 0x3a51: 0x0001, + 0x3a52: 0x0001, 0x3a53: 0x0001, 0x3a54: 0x0001, 0x3a55: 0x0001, 0x3a56: 0x0001, 0x3a57: 0x0001, + 0x3a58: 0x0001, 0x3a59: 0x0001, 0x3a5a: 0x0001, 0x3a5b: 0x0001, 0x3a5c: 0x0001, 0x3a5d: 0x0001, + 0x3a5e: 0x0001, 0x3a5f: 0x0001, 0x3a60: 0x0001, 0x3a61: 0x0001, 0x3a62: 0x0001, 0x3a63: 0x0001, + 0x3a64: 0x0001, 0x3a65: 0x0001, 0x3a66: 0x0001, 0x3a67: 0x0001, 0x3a68: 0x0001, 0x3a69: 0x0001, + 0x3a6a: 0x0001, 0x3a6b: 0x0001, 0x3a6c: 0x0001, 0x3a6d: 0x0001, 0x3a6e: 0x0001, 0x3a6f: 0x0001, + 0x3a70: 0x0001, 0x3a71: 0x0001, 0x3a72: 0x0001, 0x3a73: 0x0001, 0x3a74: 0x0001, 0x3a75: 0x0001, + 0x3a76: 0x0001, 0x3a77: 0x0001, 0x3a78: 0x0001, 0x3a79: 0x0001, 0x3a7a: 0x0001, 0x3a7b: 0x0001, + 0x3a7c: 0x0001, 0x3a7d: 0x0001, 0x3a7e: 0x0001, 0x3a7f: 0x0001, + // Block 0xea, offset 0x3a80 + 0x3a80: 0x0001, 0x3a81: 0x0001, 0x3a82: 0x0001, 0x3a83: 0x0001, 0x3a84: 0x0001, 0x3a85: 0x0001, + 0x3a86: 0x0001, 0x3a87: 0x0001, 0x3a88: 0x0001, 0x3a89: 0x0001, 0x3a8a: 0x0001, 0x3a8b: 0x0001, + 0x3a8c: 0x0001, 0x3a8d: 0x0001, 0x3a8e: 0x0001, 0x3a8f: 0x0001, 0x3a90: 0x0001, 0x3a91: 0x0001, + 0x3a92: 0x0001, 0x3a93: 0x0001, 0x3a94: 0x0001, 0x3a95: 0x0001, 0x3a96: 0x0001, 0x3a97: 0x0001, + 0x3a98: 0x0001, 0x3a99: 0x0001, 0x3a9a: 0x0001, 0x3a9b: 0x0001, 0x3a9c: 0x0001, 0x3a9d: 0x0001, + 0x3a9e: 0x0001, 0x3a9f: 0x0001, 0x3aa0: 0x0001, 0x3aa1: 0x0001, 0x3aa2: 0x0001, 0x3aa3: 0x0001, + 0x3aa4: 0x0001, 0x3aa5: 0x0001, 0x3aa6: 0x0001, 0x3aa7: 0x0001, 0x3aa8: 0x0001, 0x3aa9: 0x0001, + 0x3aaa: 0x0001, 0x3aab: 0x0001, 0x3aac: 0x0001, 0x3aad: 0x0001, 0x3aae: 0x0001, 0x3aaf: 0x0001, + 0x3ab0: 0x0001, 0x3ab1: 0x000d, 0x3ab2: 0x000d, 0x3ab3: 0x000d, 0x3ab4: 0x000d, 0x3ab5: 0x000d, + 0x3ab6: 0x000d, 0x3ab7: 0x000d, 0x3ab8: 0x000d, 0x3ab9: 0x000d, 0x3aba: 0x000d, 0x3abb: 0x000d, + 0x3abc: 0x000d, 0x3abd: 0x000d, 0x3abe: 0x000d, 0x3abf: 0x000d, + // Block 0xeb, offset 0x3ac0 + 0x3ac0: 0x000d, 0x3ac1: 0x000d, 0x3ac2: 0x000d, 0x3ac3: 0x000d, 0x3ac4: 0x000d, 0x3ac5: 0x000d, + 0x3ac6: 0x000d, 0x3ac7: 0x000d, 0x3ac8: 0x000d, 0x3ac9: 0x000d, 0x3aca: 0x000d, 0x3acb: 0x000d, + 0x3acc: 0x000d, 0x3acd: 0x000d, 0x3ace: 0x000d, 0x3acf: 0x000d, 0x3ad0: 0x000d, 0x3ad1: 0x000d, + 0x3ad2: 0x000d, 0x3ad3: 0x000d, 0x3ad4: 0x000d, 0x3ad5: 0x000d, 0x3ad6: 0x000d, 0x3ad7: 0x000d, + 0x3ad8: 0x000d, 0x3ad9: 0x000d, 0x3ada: 0x000d, 0x3adb: 0x000d, 0x3adc: 0x000d, 0x3add: 0x000d, + 0x3ade: 0x000d, 0x3adf: 0x000d, 0x3ae0: 0x000d, 0x3ae1: 0x000d, 0x3ae2: 0x000d, 0x3ae3: 0x000d, + 0x3ae4: 0x000d, 0x3ae5: 0x000d, 0x3ae6: 0x000d, 0x3ae7: 0x000d, 0x3ae8: 0x000d, 0x3ae9: 0x000d, + 0x3aea: 0x000d, 0x3aeb: 0x000d, 0x3aec: 0x000d, 0x3aed: 0x000d, 0x3aee: 0x000d, 0x3aef: 0x000d, + 0x3af0: 0x000d, 0x3af1: 0x000d, 0x3af2: 0x000d, 0x3af3: 0x000d, 0x3af4: 0x000d, 0x3af5: 0x0001, + 0x3af6: 0x0001, 0x3af7: 0x0001, 0x3af8: 0x0001, 0x3af9: 0x0001, 0x3afa: 0x0001, 0x3afb: 0x0001, + 0x3afc: 0x0001, 0x3afd: 0x0001, 0x3afe: 0x0001, 0x3aff: 0x0001, + // Block 0xec, offset 0x3b00 + 0x3b00: 0x0001, 0x3b01: 0x000d, 0x3b02: 0x000d, 0x3b03: 0x000d, 0x3b04: 0x000d, 0x3b05: 0x000d, + 0x3b06: 0x000d, 0x3b07: 0x000d, 0x3b08: 0x000d, 0x3b09: 0x000d, 0x3b0a: 0x000d, 0x3b0b: 0x000d, + 0x3b0c: 0x000d, 0x3b0d: 0x000d, 0x3b0e: 0x000d, 0x3b0f: 0x000d, 0x3b10: 0x000d, 0x3b11: 0x000d, + 0x3b12: 0x000d, 0x3b13: 0x000d, 0x3b14: 0x000d, 0x3b15: 0x000d, 0x3b16: 0x000d, 0x3b17: 0x000d, + 0x3b18: 0x000d, 0x3b19: 0x000d, 0x3b1a: 0x000d, 0x3b1b: 0x000d, 0x3b1c: 0x000d, 0x3b1d: 0x000d, + 0x3b1e: 0x000d, 0x3b1f: 0x000d, 0x3b20: 0x000d, 0x3b21: 0x000d, 0x3b22: 0x000d, 0x3b23: 0x000d, + 0x3b24: 0x000d, 0x3b25: 0x000d, 0x3b26: 0x000d, 0x3b27: 0x000d, 0x3b28: 0x000d, 0x3b29: 0x000d, + 0x3b2a: 0x000d, 0x3b2b: 0x000d, 0x3b2c: 0x000d, 0x3b2d: 0x000d, 0x3b2e: 0x000d, 0x3b2f: 0x000d, + 0x3b30: 0x000d, 0x3b31: 0x000d, 0x3b32: 0x000d, 0x3b33: 0x000d, 0x3b34: 0x000d, 0x3b35: 0x000d, + 0x3b36: 0x000d, 0x3b37: 0x000d, 0x3b38: 0x000d, 0x3b39: 0x000d, 0x3b3a: 0x000d, 0x3b3b: 0x000d, + 0x3b3c: 0x000d, 0x3b3d: 0x000d, 0x3b3e: 0x0001, 0x3b3f: 0x0001, + // Block 0xed, offset 0x3b40 + 0x3b40: 0x000d, 0x3b41: 0x000d, 0x3b42: 0x000d, 0x3b43: 0x000d, 0x3b44: 0x000d, 0x3b45: 0x000d, + 0x3b46: 0x000d, 0x3b47: 0x000d, 0x3b48: 0x000d, 0x3b49: 0x000d, 0x3b4a: 0x000d, 0x3b4b: 0x000d, + 0x3b4c: 0x000d, 0x3b4d: 0x000d, 0x3b4e: 0x000d, 0x3b4f: 0x000d, 0x3b50: 0x000d, 0x3b51: 0x000d, + 0x3b52: 0x000d, 0x3b53: 0x000d, 0x3b54: 0x000d, 0x3b55: 0x000d, 0x3b56: 0x000d, 0x3b57: 0x000d, + 0x3b58: 0x000d, 0x3b59: 0x000d, 0x3b5a: 0x000d, 0x3b5b: 0x000d, 0x3b5c: 0x000d, 0x3b5d: 0x000d, + 0x3b5e: 0x000d, 0x3b5f: 0x000d, 0x3b60: 0x000d, 0x3b61: 0x000d, 0x3b62: 0x000d, 0x3b63: 0x000d, + 0x3b64: 0x000d, 0x3b65: 0x000d, 0x3b66: 0x000d, 0x3b67: 0x000d, 0x3b68: 0x000d, 0x3b69: 0x000d, + 0x3b6a: 0x000d, 0x3b6b: 0x000d, 0x3b6c: 0x000d, 0x3b6d: 0x000d, 0x3b6e: 0x000d, 0x3b6f: 0x000d, + 0x3b70: 0x000a, 0x3b71: 0x000a, 0x3b72: 0x000d, 0x3b73: 0x000d, 0x3b74: 0x000d, 0x3b75: 0x000d, + 0x3b76: 0x000d, 0x3b77: 0x000d, 0x3b78: 0x000d, 0x3b79: 0x000d, 0x3b7a: 0x000d, 0x3b7b: 0x000d, + 0x3b7c: 0x000d, 0x3b7d: 0x000d, 0x3b7e: 0x000d, 0x3b7f: 0x000d, + // Block 0xee, offset 0x3b80 + 0x3b80: 0x000a, 0x3b81: 0x000a, 0x3b82: 0x000a, 0x3b83: 0x000a, 0x3b84: 0x000a, 0x3b85: 0x000a, + 0x3b86: 0x000a, 0x3b87: 0x000a, 0x3b88: 0x000a, 0x3b89: 0x000a, 0x3b8a: 0x000a, 0x3b8b: 0x000a, + 0x3b8c: 0x000a, 0x3b8d: 0x000a, 0x3b8e: 0x000a, 0x3b8f: 0x000a, 0x3b90: 0x000a, 0x3b91: 0x000a, + 0x3b92: 0x000a, 0x3b93: 0x000a, 0x3b94: 0x000a, 0x3b95: 0x000a, 0x3b96: 0x000a, 0x3b97: 0x000a, + 0x3b98: 0x000a, 0x3b99: 0x000a, 0x3b9a: 0x000a, 0x3b9b: 0x000a, 0x3b9c: 0x000a, 0x3b9d: 0x000a, + 0x3b9e: 0x000a, 0x3b9f: 0x000a, 0x3ba0: 0x000a, 0x3ba1: 0x000a, 0x3ba2: 0x000a, 0x3ba3: 0x000a, + 0x3ba4: 0x000a, 0x3ba5: 0x000a, 0x3ba6: 0x000a, 0x3ba7: 0x000a, 0x3ba8: 0x000a, 0x3ba9: 0x000a, + 0x3baa: 0x000a, 0x3bab: 0x000a, + 0x3bb0: 0x000a, 0x3bb1: 0x000a, 0x3bb2: 0x000a, 0x3bb3: 0x000a, 0x3bb4: 0x000a, 0x3bb5: 0x000a, + 0x3bb6: 0x000a, 0x3bb7: 0x000a, 0x3bb8: 0x000a, 0x3bb9: 0x000a, 0x3bba: 0x000a, 0x3bbb: 0x000a, + 0x3bbc: 0x000a, 0x3bbd: 0x000a, 0x3bbe: 0x000a, 0x3bbf: 0x000a, + // Block 0xef, offset 0x3bc0 + 0x3bc0: 0x000a, 0x3bc1: 0x000a, 0x3bc2: 0x000a, 0x3bc3: 0x000a, 0x3bc4: 0x000a, 0x3bc5: 0x000a, + 0x3bc6: 0x000a, 0x3bc7: 0x000a, 0x3bc8: 0x000a, 0x3bc9: 0x000a, 0x3bca: 0x000a, 0x3bcb: 0x000a, + 0x3bcc: 0x000a, 0x3bcd: 0x000a, 0x3bce: 0x000a, 0x3bcf: 0x000a, 0x3bd0: 0x000a, 0x3bd1: 0x000a, + 0x3bd2: 0x000a, 0x3bd3: 0x000a, + 0x3be0: 0x000a, 0x3be1: 0x000a, 0x3be2: 0x000a, 0x3be3: 0x000a, + 0x3be4: 0x000a, 0x3be5: 0x000a, 0x3be6: 0x000a, 0x3be7: 0x000a, 0x3be8: 0x000a, 0x3be9: 0x000a, + 0x3bea: 0x000a, 0x3beb: 0x000a, 0x3bec: 0x000a, 0x3bed: 0x000a, 0x3bee: 0x000a, + 0x3bf1: 0x000a, 0x3bf2: 0x000a, 0x3bf3: 0x000a, 0x3bf4: 0x000a, 0x3bf5: 0x000a, + 0x3bf6: 0x000a, 0x3bf7: 0x000a, 0x3bf8: 0x000a, 0x3bf9: 0x000a, 0x3bfa: 0x000a, 0x3bfb: 0x000a, + 0x3bfc: 0x000a, 0x3bfd: 0x000a, 0x3bfe: 0x000a, 0x3bff: 0x000a, + // Block 0xf0, offset 0x3c00 + 0x3c01: 0x000a, 0x3c02: 0x000a, 0x3c03: 0x000a, 0x3c04: 0x000a, 0x3c05: 0x000a, + 0x3c06: 0x000a, 0x3c07: 0x000a, 0x3c08: 0x000a, 0x3c09: 0x000a, 0x3c0a: 0x000a, 0x3c0b: 0x000a, + 0x3c0c: 0x000a, 0x3c0d: 0x000a, 0x3c0e: 0x000a, 0x3c0f: 0x000a, 0x3c11: 0x000a, + 0x3c12: 0x000a, 0x3c13: 0x000a, 0x3c14: 0x000a, 0x3c15: 0x000a, 0x3c16: 0x000a, 0x3c17: 0x000a, + 0x3c18: 0x000a, 0x3c19: 0x000a, 0x3c1a: 0x000a, 0x3c1b: 0x000a, 0x3c1c: 0x000a, 0x3c1d: 0x000a, + 0x3c1e: 0x000a, 0x3c1f: 0x000a, 0x3c20: 0x000a, 0x3c21: 0x000a, 0x3c22: 0x000a, 0x3c23: 0x000a, + 0x3c24: 0x000a, 0x3c25: 0x000a, 0x3c26: 0x000a, 0x3c27: 0x000a, 0x3c28: 0x000a, 0x3c29: 0x000a, + 0x3c2a: 0x000a, 0x3c2b: 0x000a, 0x3c2c: 0x000a, 0x3c2d: 0x000a, 0x3c2e: 0x000a, 0x3c2f: 0x000a, + 0x3c30: 0x000a, 0x3c31: 0x000a, 0x3c32: 0x000a, 0x3c33: 0x000a, 0x3c34: 0x000a, 0x3c35: 0x000a, + // Block 0xf1, offset 0x3c40 + 0x3c40: 0x0002, 0x3c41: 0x0002, 0x3c42: 0x0002, 0x3c43: 0x0002, 0x3c44: 0x0002, 0x3c45: 0x0002, + 0x3c46: 0x0002, 0x3c47: 0x0002, 0x3c48: 0x0002, 0x3c49: 0x0002, 0x3c4a: 0x0002, 0x3c4b: 0x000a, + 0x3c4c: 0x000a, 0x3c4d: 0x000a, 0x3c4e: 0x000a, 0x3c4f: 0x000a, + 0x3c6f: 0x000a, + // Block 0xf2, offset 0x3c80 + 0x3caa: 0x000a, 0x3cab: 0x000a, 0x3cac: 0x000a, 0x3cad: 0x000a, 0x3cae: 0x000a, 0x3caf: 0x000a, + // Block 0xf3, offset 0x3cc0 + 0x3ced: 0x000a, + // Block 0xf4, offset 0x3d00 + 0x3d20: 0x000a, 0x3d21: 0x000a, 0x3d22: 0x000a, 0x3d23: 0x000a, + 0x3d24: 0x000a, 0x3d25: 0x000a, + // Block 0xf5, offset 0x3d40 + 0x3d40: 0x000a, 0x3d41: 0x000a, 0x3d42: 0x000a, 0x3d43: 0x000a, 0x3d44: 0x000a, 0x3d45: 0x000a, + 0x3d46: 0x000a, 0x3d47: 0x000a, 0x3d48: 0x000a, 0x3d49: 0x000a, 0x3d4a: 0x000a, 0x3d4b: 0x000a, + 0x3d4c: 0x000a, 0x3d4d: 0x000a, 0x3d4e: 0x000a, 0x3d4f: 0x000a, 0x3d50: 0x000a, 0x3d51: 0x000a, + 0x3d52: 0x000a, 0x3d53: 0x000a, 0x3d54: 0x000a, 0x3d55: 0x000a, 0x3d56: 0x000a, 0x3d57: 0x000a, + 0x3d5c: 0x000a, 0x3d5d: 0x000a, + 0x3d5e: 0x000a, 0x3d5f: 0x000a, 0x3d60: 0x000a, 0x3d61: 0x000a, 0x3d62: 0x000a, 0x3d63: 0x000a, + 0x3d64: 0x000a, 0x3d65: 0x000a, 0x3d66: 0x000a, 0x3d67: 0x000a, 0x3d68: 0x000a, 0x3d69: 0x000a, + 0x3d6a: 0x000a, 0x3d6b: 0x000a, 0x3d6c: 0x000a, + 0x3d70: 0x000a, 0x3d71: 0x000a, 0x3d72: 0x000a, 0x3d73: 0x000a, 0x3d74: 0x000a, 0x3d75: 0x000a, + 0x3d76: 0x000a, 0x3d77: 0x000a, 0x3d78: 0x000a, 0x3d79: 0x000a, 0x3d7a: 0x000a, 0x3d7b: 0x000a, + 0x3d7c: 0x000a, + // Block 0xf6, offset 0x3d80 + 0x3d80: 0x000a, 0x3d81: 0x000a, 0x3d82: 0x000a, 0x3d83: 0x000a, 0x3d84: 0x000a, 0x3d85: 0x000a, + 0x3d86: 0x000a, 0x3d87: 0x000a, 0x3d88: 0x000a, 0x3d89: 0x000a, 0x3d8a: 0x000a, 0x3d8b: 0x000a, + 0x3d8c: 0x000a, 0x3d8d: 0x000a, 0x3d8e: 0x000a, 0x3d8f: 0x000a, 0x3d90: 0x000a, 0x3d91: 0x000a, + 0x3d92: 0x000a, 0x3d93: 0x000a, 0x3d94: 0x000a, 0x3d95: 0x000a, 0x3d96: 0x000a, 0x3d97: 0x000a, + 0x3d98: 0x000a, 0x3d99: 0x000a, 0x3d9a: 0x000a, 0x3d9b: 0x000a, 0x3d9c: 0x000a, 0x3d9d: 0x000a, + 0x3d9e: 0x000a, 0x3d9f: 0x000a, 0x3da0: 0x000a, 0x3da1: 0x000a, 0x3da2: 0x000a, 0x3da3: 0x000a, + 0x3da4: 0x000a, 0x3da5: 0x000a, 0x3da6: 0x000a, 0x3da7: 0x000a, 0x3da8: 0x000a, 0x3da9: 0x000a, + 0x3daa: 0x000a, 0x3dab: 0x000a, 0x3dac: 0x000a, 0x3dad: 0x000a, 0x3dae: 0x000a, 0x3daf: 0x000a, + 0x3db0: 0x000a, 0x3db1: 0x000a, 0x3db2: 0x000a, 0x3db3: 0x000a, 0x3db4: 0x000a, 0x3db5: 0x000a, + 0x3db6: 0x000a, 0x3dbb: 0x000a, + 0x3dbc: 0x000a, 0x3dbd: 0x000a, 0x3dbe: 0x000a, 0x3dbf: 0x000a, + // Block 0xf7, offset 0x3dc0 + 0x3dc0: 0x000a, 0x3dc1: 0x000a, 0x3dc2: 0x000a, 0x3dc3: 0x000a, 0x3dc4: 0x000a, 0x3dc5: 0x000a, + 0x3dc6: 0x000a, 0x3dc7: 0x000a, 0x3dc8: 0x000a, 0x3dc9: 0x000a, 0x3dca: 0x000a, 0x3dcb: 0x000a, + 0x3dcc: 0x000a, 0x3dcd: 0x000a, 0x3dce: 0x000a, 0x3dcf: 0x000a, 0x3dd0: 0x000a, 0x3dd1: 0x000a, + 0x3dd2: 0x000a, 0x3dd3: 0x000a, 0x3dd4: 0x000a, 0x3dd5: 0x000a, 0x3dd6: 0x000a, 0x3dd7: 0x000a, + 0x3dd8: 0x000a, 0x3dd9: 0x000a, + 0x3de0: 0x000a, 0x3de1: 0x000a, 0x3de2: 0x000a, 0x3de3: 0x000a, + 0x3de4: 0x000a, 0x3de5: 0x000a, 0x3de6: 0x000a, 0x3de7: 0x000a, 0x3de8: 0x000a, 0x3de9: 0x000a, + 0x3dea: 0x000a, 0x3deb: 0x000a, + 0x3df0: 0x000a, + // Block 0xf8, offset 0x3e00 + 0x3e00: 0x000a, 0x3e01: 0x000a, 0x3e02: 0x000a, 0x3e03: 0x000a, 0x3e04: 0x000a, 0x3e05: 0x000a, + 0x3e06: 0x000a, 0x3e07: 0x000a, 0x3e08: 0x000a, 0x3e09: 0x000a, 0x3e0a: 0x000a, 0x3e0b: 0x000a, + 0x3e10: 0x000a, 0x3e11: 0x000a, + 0x3e12: 0x000a, 0x3e13: 0x000a, 0x3e14: 0x000a, 0x3e15: 0x000a, 0x3e16: 0x000a, 0x3e17: 0x000a, + 0x3e18: 0x000a, 0x3e19: 0x000a, 0x3e1a: 0x000a, 0x3e1b: 0x000a, 0x3e1c: 0x000a, 0x3e1d: 0x000a, + 0x3e1e: 0x000a, 0x3e1f: 0x000a, 0x3e20: 0x000a, 0x3e21: 0x000a, 0x3e22: 0x000a, 0x3e23: 0x000a, + 0x3e24: 0x000a, 0x3e25: 0x000a, 0x3e26: 0x000a, 0x3e27: 0x000a, 0x3e28: 0x000a, 0x3e29: 0x000a, + 0x3e2a: 0x000a, 0x3e2b: 0x000a, 0x3e2c: 0x000a, 0x3e2d: 0x000a, 0x3e2e: 0x000a, 0x3e2f: 0x000a, + 0x3e30: 0x000a, 0x3e31: 0x000a, 0x3e32: 0x000a, 0x3e33: 0x000a, 0x3e34: 0x000a, 0x3e35: 0x000a, + 0x3e36: 0x000a, 0x3e37: 0x000a, 0x3e38: 0x000a, 0x3e39: 0x000a, 0x3e3a: 0x000a, 0x3e3b: 0x000a, + 0x3e3c: 0x000a, 0x3e3d: 0x000a, 0x3e3e: 0x000a, 0x3e3f: 0x000a, + // Block 0xf9, offset 0x3e40 + 0x3e40: 0x000a, 0x3e41: 0x000a, 0x3e42: 0x000a, 0x3e43: 0x000a, 0x3e44: 0x000a, 0x3e45: 0x000a, + 0x3e46: 0x000a, 0x3e47: 0x000a, + 0x3e50: 0x000a, 0x3e51: 0x000a, + 0x3e52: 0x000a, 0x3e53: 0x000a, 0x3e54: 0x000a, 0x3e55: 0x000a, 0x3e56: 0x000a, 0x3e57: 0x000a, + 0x3e58: 0x000a, 0x3e59: 0x000a, + 0x3e60: 0x000a, 0x3e61: 0x000a, 0x3e62: 0x000a, 0x3e63: 0x000a, + 0x3e64: 0x000a, 0x3e65: 0x000a, 0x3e66: 0x000a, 0x3e67: 0x000a, 0x3e68: 0x000a, 0x3e69: 0x000a, + 0x3e6a: 0x000a, 0x3e6b: 0x000a, 0x3e6c: 0x000a, 0x3e6d: 0x000a, 0x3e6e: 0x000a, 0x3e6f: 0x000a, + 0x3e70: 0x000a, 0x3e71: 0x000a, 0x3e72: 0x000a, 0x3e73: 0x000a, 0x3e74: 0x000a, 0x3e75: 0x000a, + 0x3e76: 0x000a, 0x3e77: 0x000a, 0x3e78: 0x000a, 0x3e79: 0x000a, 0x3e7a: 0x000a, 0x3e7b: 0x000a, + 0x3e7c: 0x000a, 0x3e7d: 0x000a, 0x3e7e: 0x000a, 0x3e7f: 0x000a, + // Block 0xfa, offset 0x3e80 + 0x3e80: 0x000a, 0x3e81: 0x000a, 0x3e82: 0x000a, 0x3e83: 0x000a, 0x3e84: 0x000a, 0x3e85: 0x000a, + 0x3e86: 0x000a, 0x3e87: 0x000a, + 0x3e90: 0x000a, 0x3e91: 0x000a, + 0x3e92: 0x000a, 0x3e93: 0x000a, 0x3e94: 0x000a, 0x3e95: 0x000a, 0x3e96: 0x000a, 0x3e97: 0x000a, + 0x3e98: 0x000a, 0x3e99: 0x000a, 0x3e9a: 0x000a, 0x3e9b: 0x000a, 0x3e9c: 0x000a, 0x3e9d: 0x000a, + 0x3e9e: 0x000a, 0x3e9f: 0x000a, 0x3ea0: 0x000a, 0x3ea1: 0x000a, 0x3ea2: 0x000a, 0x3ea3: 0x000a, + 0x3ea4: 0x000a, 0x3ea5: 0x000a, 0x3ea6: 0x000a, 0x3ea7: 0x000a, 0x3ea8: 0x000a, 0x3ea9: 0x000a, + 0x3eaa: 0x000a, 0x3eab: 0x000a, 0x3eac: 0x000a, 0x3ead: 0x000a, + 0x3eb0: 0x000a, 0x3eb1: 0x000a, + // Block 0xfb, offset 0x3ec0 + 0x3ec0: 0x000a, 0x3ec1: 0x000a, 0x3ec2: 0x000a, 0x3ec3: 0x000a, 0x3ec4: 0x000a, 0x3ec5: 0x000a, + 0x3ec6: 0x000a, 0x3ec7: 0x000a, 0x3ec8: 0x000a, 0x3ec9: 0x000a, 0x3eca: 0x000a, 0x3ecb: 0x000a, + 0x3ecc: 0x000a, 0x3ecd: 0x000a, 0x3ece: 0x000a, 0x3ecf: 0x000a, 0x3ed0: 0x000a, 0x3ed1: 0x000a, + 0x3ed2: 0x000a, 0x3ed3: 0x000a, + 0x3ee0: 0x000a, 0x3ee1: 0x000a, 0x3ee2: 0x000a, 0x3ee3: 0x000a, + 0x3ee4: 0x000a, 0x3ee5: 0x000a, 0x3ee6: 0x000a, 0x3ee7: 0x000a, 0x3ee8: 0x000a, 0x3ee9: 0x000a, + 0x3eea: 0x000a, 0x3eeb: 0x000a, 0x3eec: 0x000a, 0x3eed: 0x000a, + 0x3ef0: 0x000a, 0x3ef1: 0x000a, 0x3ef2: 0x000a, 0x3ef3: 0x000a, 0x3ef4: 0x000a, 0x3ef5: 0x000a, + 0x3ef6: 0x000a, 0x3ef7: 0x000a, 0x3ef8: 0x000a, 0x3ef9: 0x000a, 0x3efa: 0x000a, 0x3efb: 0x000a, + 0x3efc: 0x000a, + // Block 0xfc, offset 0x3f00 + 0x3f00: 0x000a, 0x3f01: 0x000a, 0x3f02: 0x000a, 0x3f03: 0x000a, 0x3f04: 0x000a, 0x3f05: 0x000a, + 0x3f06: 0x000a, 0x3f07: 0x000a, 0x3f08: 0x000a, + 0x3f10: 0x000a, 0x3f11: 0x000a, + 0x3f12: 0x000a, 0x3f13: 0x000a, 0x3f14: 0x000a, 0x3f15: 0x000a, 0x3f16: 0x000a, 0x3f17: 0x000a, + 0x3f18: 0x000a, 0x3f19: 0x000a, 0x3f1a: 0x000a, 0x3f1b: 0x000a, 0x3f1c: 0x000a, 0x3f1d: 0x000a, + 0x3f1e: 0x000a, 0x3f1f: 0x000a, 0x3f20: 0x000a, 0x3f21: 0x000a, 0x3f22: 0x000a, 0x3f23: 0x000a, + 0x3f24: 0x000a, 0x3f25: 0x000a, 0x3f26: 0x000a, 0x3f27: 0x000a, 0x3f28: 0x000a, 0x3f29: 0x000a, + 0x3f2a: 0x000a, 0x3f2b: 0x000a, 0x3f2c: 0x000a, 0x3f2d: 0x000a, 0x3f2e: 0x000a, 0x3f2f: 0x000a, + 0x3f30: 0x000a, 0x3f31: 0x000a, 0x3f32: 0x000a, 0x3f33: 0x000a, 0x3f34: 0x000a, 0x3f35: 0x000a, + 0x3f36: 0x000a, 0x3f37: 0x000a, 0x3f38: 0x000a, 0x3f39: 0x000a, 0x3f3a: 0x000a, 0x3f3b: 0x000a, + 0x3f3c: 0x000a, 0x3f3d: 0x000a, 0x3f3f: 0x000a, + // Block 0xfd, offset 0x3f40 + 0x3f40: 0x000a, 0x3f41: 0x000a, 0x3f42: 0x000a, 0x3f43: 0x000a, 0x3f44: 0x000a, 0x3f45: 0x000a, + 0x3f4e: 0x000a, 0x3f4f: 0x000a, 0x3f50: 0x000a, 0x3f51: 0x000a, + 0x3f52: 0x000a, 0x3f53: 0x000a, 0x3f54: 0x000a, 0x3f55: 0x000a, 0x3f56: 0x000a, 0x3f57: 0x000a, + 0x3f58: 0x000a, 0x3f59: 0x000a, 0x3f5a: 0x000a, 0x3f5b: 0x000a, + 0x3f60: 0x000a, 0x3f61: 0x000a, 0x3f62: 0x000a, 0x3f63: 0x000a, + 0x3f64: 0x000a, 0x3f65: 0x000a, 0x3f66: 0x000a, 0x3f67: 0x000a, 0x3f68: 0x000a, + 0x3f70: 0x000a, 0x3f71: 0x000a, 0x3f72: 0x000a, 0x3f73: 0x000a, 0x3f74: 0x000a, 0x3f75: 0x000a, + 0x3f76: 0x000a, 0x3f77: 0x000a, 0x3f78: 0x000a, + // Block 0xfe, offset 0x3f80 + 0x3f80: 0x000a, 0x3f81: 0x000a, 0x3f82: 0x000a, 0x3f83: 0x000a, 0x3f84: 0x000a, 0x3f85: 0x000a, + 0x3f86: 0x000a, 0x3f87: 0x000a, 0x3f88: 0x000a, 0x3f89: 0x000a, 0x3f8a: 0x000a, 0x3f8b: 0x000a, + 0x3f8c: 0x000a, 0x3f8d: 0x000a, 0x3f8e: 0x000a, 0x3f8f: 0x000a, 0x3f90: 0x000a, 0x3f91: 0x000a, + 0x3f92: 0x000a, 0x3f94: 0x000a, 0x3f95: 0x000a, 0x3f96: 0x000a, 0x3f97: 0x000a, + 0x3f98: 0x000a, 0x3f99: 0x000a, 0x3f9a: 0x000a, 0x3f9b: 0x000a, 0x3f9c: 0x000a, 0x3f9d: 0x000a, + 0x3f9e: 0x000a, 0x3f9f: 0x000a, 0x3fa0: 0x000a, 0x3fa1: 0x000a, 0x3fa2: 0x000a, 0x3fa3: 0x000a, + 0x3fa4: 0x000a, 0x3fa5: 0x000a, 0x3fa6: 0x000a, 0x3fa7: 0x000a, 0x3fa8: 0x000a, 0x3fa9: 0x000a, + 0x3faa: 0x000a, 0x3fab: 0x000a, 0x3fac: 0x000a, 0x3fad: 0x000a, 0x3fae: 0x000a, 0x3faf: 0x000a, + 0x3fb0: 0x000a, 0x3fb1: 0x000a, 0x3fb2: 0x000a, 0x3fb3: 0x000a, 0x3fb4: 0x000a, 0x3fb5: 0x000a, + 0x3fb6: 0x000a, 0x3fb7: 0x000a, 0x3fb8: 0x000a, 0x3fb9: 0x000a, 0x3fba: 0x000a, 0x3fbb: 0x000a, + 0x3fbc: 0x000a, 0x3fbd: 0x000a, 0x3fbe: 0x000a, 0x3fbf: 0x000a, + // Block 0xff, offset 0x3fc0 + 0x3fc0: 0x000a, 0x3fc1: 0x000a, 0x3fc2: 0x000a, 0x3fc3: 0x000a, 0x3fc4: 0x000a, 0x3fc5: 0x000a, + 0x3fc6: 0x000a, 0x3fc7: 0x000a, 0x3fc8: 0x000a, 0x3fc9: 0x000a, 0x3fca: 0x000a, + 0x3ff0: 0x0002, 0x3ff1: 0x0002, 0x3ff2: 0x0002, 0x3ff3: 0x0002, 0x3ff4: 0x0002, 0x3ff5: 0x0002, + 0x3ff6: 0x0002, 0x3ff7: 0x0002, 0x3ff8: 0x0002, 0x3ff9: 0x0002, + // Block 0x100, offset 0x4000 + 0x403e: 0x000b, 0x403f: 0x000b, + // Block 0x101, offset 0x4040 + 0x4040: 0x000b, 0x4041: 0x000b, 0x4042: 0x000b, 0x4043: 0x000b, 0x4044: 0x000b, 0x4045: 0x000b, + 0x4046: 0x000b, 0x4047: 0x000b, 0x4048: 0x000b, 0x4049: 0x000b, 0x404a: 0x000b, 0x404b: 0x000b, + 0x404c: 0x000b, 0x404d: 0x000b, 0x404e: 0x000b, 0x404f: 0x000b, 0x4050: 0x000b, 0x4051: 0x000b, + 0x4052: 0x000b, 0x4053: 0x000b, 0x4054: 0x000b, 0x4055: 0x000b, 0x4056: 0x000b, 0x4057: 0x000b, + 0x4058: 0x000b, 0x4059: 0x000b, 0x405a: 0x000b, 0x405b: 0x000b, 0x405c: 0x000b, 0x405d: 0x000b, + 0x405e: 0x000b, 0x405f: 0x000b, 0x4060: 0x000b, 0x4061: 0x000b, 0x4062: 0x000b, 0x4063: 0x000b, + 0x4064: 0x000b, 0x4065: 0x000b, 0x4066: 0x000b, 0x4067: 0x000b, 0x4068: 0x000b, 0x4069: 0x000b, + 0x406a: 0x000b, 0x406b: 0x000b, 0x406c: 0x000b, 0x406d: 0x000b, 0x406e: 0x000b, 0x406f: 0x000b, + 0x4070: 0x000b, 0x4071: 0x000b, 0x4072: 0x000b, 0x4073: 0x000b, 0x4074: 0x000b, 0x4075: 0x000b, + 0x4076: 0x000b, 0x4077: 0x000b, 0x4078: 0x000b, 0x4079: 0x000b, 0x407a: 0x000b, 0x407b: 0x000b, + 0x407c: 0x000b, 0x407d: 0x000b, 0x407e: 0x000b, 0x407f: 0x000b, + // Block 0x102, offset 0x4080 + 0x4080: 0x000c, 0x4081: 0x000c, 0x4082: 0x000c, 0x4083: 0x000c, 0x4084: 0x000c, 0x4085: 0x000c, + 0x4086: 0x000c, 0x4087: 0x000c, 0x4088: 0x000c, 0x4089: 0x000c, 0x408a: 0x000c, 0x408b: 0x000c, + 0x408c: 0x000c, 0x408d: 0x000c, 0x408e: 0x000c, 0x408f: 0x000c, 0x4090: 0x000c, 0x4091: 0x000c, + 0x4092: 0x000c, 0x4093: 0x000c, 0x4094: 0x000c, 0x4095: 0x000c, 0x4096: 0x000c, 0x4097: 0x000c, + 0x4098: 0x000c, 0x4099: 0x000c, 0x409a: 0x000c, 0x409b: 0x000c, 0x409c: 0x000c, 0x409d: 0x000c, + 0x409e: 0x000c, 0x409f: 0x000c, 0x40a0: 0x000c, 0x40a1: 0x000c, 0x40a2: 0x000c, 0x40a3: 0x000c, + 0x40a4: 0x000c, 0x40a5: 0x000c, 0x40a6: 0x000c, 0x40a7: 0x000c, 0x40a8: 0x000c, 0x40a9: 0x000c, + 0x40aa: 0x000c, 0x40ab: 0x000c, 0x40ac: 0x000c, 0x40ad: 0x000c, 0x40ae: 0x000c, 0x40af: 0x000c, + 0x40b0: 0x000b, 0x40b1: 0x000b, 0x40b2: 0x000b, 0x40b3: 0x000b, 0x40b4: 0x000b, 0x40b5: 0x000b, + 0x40b6: 0x000b, 0x40b7: 0x000b, 0x40b8: 0x000b, 0x40b9: 0x000b, 0x40ba: 0x000b, 0x40bb: 0x000b, + 0x40bc: 0x000b, 0x40bd: 0x000b, 0x40be: 0x000b, 0x40bf: 0x000b, +} + +// bidiIndex: 26 blocks, 1664 entries, 3328 bytes +// Block 0 is the zero block. +var bidiIndex = [1664]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x02, + 0xca: 0x03, 0xcb: 0x04, 0xcc: 0x05, 0xcd: 0x06, 0xce: 0x07, 0xcf: 0x08, + 0xd2: 0x09, 0xd6: 0x0a, 0xd7: 0x0b, + 0xd8: 0x0c, 0xd9: 0x0d, 0xda: 0x0e, 0xdb: 0x0f, 0xdc: 0x10, 0xdd: 0x11, 0xde: 0x12, 0xdf: 0x13, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06, + 0xea: 0x07, 0xef: 0x08, + 0xf0: 0x13, 0xf1: 0x14, 0xf2: 0x14, 0xf3: 0x16, 0xf4: 0x17, + // Block 0x4, offset 0x100 + 0x120: 0x14, 0x121: 0x15, 0x122: 0x16, 0x123: 0x17, 0x124: 0x18, 0x125: 0x19, 0x126: 0x1a, 0x127: 0x1b, + 0x128: 0x1c, 0x129: 0x1d, 0x12a: 0x1c, 0x12b: 0x1e, 0x12c: 0x1f, 0x12d: 0x20, 0x12e: 0x21, 0x12f: 0x22, + 0x130: 0x23, 0x131: 0x24, 0x132: 0x1a, 0x133: 0x25, 0x134: 0x26, 0x135: 0x27, 0x136: 0x28, 0x137: 0x29, + 0x138: 0x2a, 0x139: 0x2b, 0x13a: 0x2c, 0x13b: 0x2d, 0x13c: 0x2e, 0x13d: 0x2f, 0x13e: 0x30, 0x13f: 0x31, + // Block 0x5, offset 0x140 + 0x140: 0x32, 0x141: 0x33, 0x142: 0x34, + 0x14d: 0x35, 0x14e: 0x36, + 0x150: 0x37, + 0x15a: 0x38, 0x15c: 0x39, 0x15d: 0x3a, 0x15e: 0x3b, 0x15f: 0x3c, + 0x160: 0x3d, 0x162: 0x3e, 0x164: 0x3f, 0x165: 0x40, 0x167: 0x41, + 0x168: 0x42, 0x169: 0x43, 0x16a: 0x44, 0x16b: 0x45, 0x16c: 0x46, 0x16d: 0x47, 0x16e: 0x48, 0x16f: 0x49, + 0x170: 0x4a, 0x173: 0x4b, 0x177: 0x05, + 0x17e: 0x4c, 0x17f: 0x4d, + // Block 0x6, offset 0x180 + 0x180: 0x4e, 0x181: 0x4f, 0x182: 0x50, 0x183: 0x51, 0x184: 0x52, 0x185: 0x53, 0x186: 0x54, 0x187: 0x55, + 0x188: 0x56, 0x189: 0x55, 0x18a: 0x55, 0x18b: 0x55, 0x18c: 0x57, 0x18d: 0x58, 0x18e: 0x59, 0x18f: 0x55, + 0x190: 0x5a, 0x191: 0x5b, 0x192: 0x5c, 0x193: 0x5d, 0x194: 0x55, 0x195: 0x55, 0x196: 0x55, 0x197: 0x55, + 0x198: 0x55, 0x199: 0x55, 0x19a: 0x5e, 0x19b: 0x55, 0x19c: 0x55, 0x19d: 0x5f, 0x19e: 0x55, 0x19f: 0x60, + 0x1a4: 0x55, 0x1a5: 0x55, 0x1a6: 0x61, 0x1a7: 0x62, + 0x1a8: 0x55, 0x1a9: 0x55, 0x1aa: 0x55, 0x1ab: 0x55, 0x1ac: 0x55, 0x1ad: 0x63, 0x1ae: 0x64, 0x1af: 0x55, + 0x1b3: 0x65, 0x1b5: 0x66, 0x1b7: 0x67, + 0x1b8: 0x68, 0x1b9: 0x69, 0x1ba: 0x6a, 0x1bb: 0x6b, 0x1bc: 0x55, 0x1bd: 0x55, 0x1be: 0x55, 0x1bf: 0x6c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x6d, 0x1c2: 0x6e, 0x1c3: 0x6f, 0x1c7: 0x70, + 0x1c8: 0x71, 0x1c9: 0x72, 0x1ca: 0x73, 0x1cb: 0x74, 0x1cd: 0x75, 0x1cf: 0x76, + // Block 0x8, offset 0x200 + 0x237: 0x55, + // Block 0x9, offset 0x240 + 0x252: 0x77, 0x253: 0x78, + 0x258: 0x79, 0x259: 0x7a, 0x25a: 0x7b, 0x25b: 0x7c, 0x25c: 0x7d, 0x25e: 0x7e, + 0x260: 0x7f, 0x261: 0x80, 0x263: 0x81, 0x264: 0x82, 0x265: 0x83, 0x266: 0x84, 0x267: 0x85, + 0x268: 0x86, 0x269: 0x87, 0x26a: 0x88, 0x26b: 0x89, 0x26d: 0x8a, 0x26f: 0x8b, + // Block 0xa, offset 0x280 + 0x2ac: 0x8c, 0x2ad: 0x8d, 0x2ae: 0x0e, 0x2af: 0x0e, + 0x2b0: 0x0e, 0x2b1: 0x0e, 0x2b2: 0x0e, 0x2b3: 0x0e, 0x2b4: 0x8e, 0x2b5: 0x8f, 0x2b6: 0x0e, 0x2b7: 0x90, + 0x2b8: 0x91, 0x2b9: 0x92, 0x2ba: 0x0e, 0x2bb: 0x93, 0x2bc: 0x94, 0x2bd: 0x95, 0x2bf: 0x96, + // Block 0xb, offset 0x2c0 + 0x2c4: 0x97, 0x2c5: 0x55, 0x2c6: 0x98, 0x2c7: 0x99, + 0x2cb: 0x9a, 0x2cd: 0x9b, + 0x2e0: 0x9c, 0x2e1: 0x9c, 0x2e2: 0x9c, 0x2e3: 0x9c, 0x2e4: 0x9d, 0x2e5: 0x9c, 0x2e6: 0x9c, 0x2e7: 0x9c, + 0x2e8: 0x9e, 0x2e9: 0x9c, 0x2ea: 0x9c, 0x2eb: 0x9f, 0x2ec: 0xa0, 0x2ed: 0x9c, 0x2ee: 0x9c, 0x2ef: 0x9c, + 0x2f0: 0x9c, 0x2f1: 0x9c, 0x2f2: 0x9c, 0x2f3: 0x9c, 0x2f4: 0xa1, 0x2f5: 0x9c, 0x2f6: 0x9c, 0x2f7: 0x9c, + 0x2f8: 0x9c, 0x2f9: 0xa2, 0x2fa: 0xa3, 0x2fb: 0xa4, 0x2fc: 0xa5, 0x2fd: 0xa6, 0x2fe: 0xa7, 0x2ff: 0x9c, + // Block 0xc, offset 0x300 + 0x300: 0xa8, 0x301: 0xa9, 0x302: 0xaa, 0x303: 0x21, 0x304: 0xab, 0x305: 0xac, 0x306: 0xad, 0x307: 0xae, + 0x308: 0xaf, 0x309: 0x28, 0x30b: 0xb0, 0x30c: 0x26, 0x30d: 0xb1, + 0x310: 0xb2, 0x311: 0xb3, 0x312: 0xb4, 0x313: 0xb5, 0x316: 0xb6, 0x317: 0xb7, + 0x318: 0xb8, 0x319: 0xb9, 0x31a: 0xba, 0x31c: 0xbb, + 0x320: 0xbc, 0x324: 0xbd, 0x325: 0xbe, 0x327: 0xbf, + 0x328: 0xc0, 0x329: 0xc1, 0x32a: 0xc2, + 0x330: 0xc3, 0x332: 0xc4, 0x334: 0xc5, 0x335: 0xc6, 0x336: 0xc7, + 0x33b: 0xc8, 0x33c: 0xc9, 0x33d: 0xca, 0x33f: 0xcb, + // Block 0xd, offset 0x340 + 0x351: 0xcc, + // Block 0xe, offset 0x380 + 0x3ab: 0xcd, 0x3ac: 0xce, + 0x3bd: 0xcf, 0x3be: 0xd0, 0x3bf: 0xd1, + // Block 0xf, offset 0x3c0 + 0x3f2: 0xd2, + // Block 0x10, offset 0x400 + 0x43c: 0xd3, 0x43d: 0xd4, + // Block 0x11, offset 0x440 + 0x445: 0xd5, 0x446: 0xd6, 0x447: 0xd7, + 0x448: 0x55, 0x449: 0xd8, 0x44c: 0x55, 0x44d: 0xd9, + 0x45b: 0xda, 0x45c: 0xdb, 0x45d: 0xdc, 0x45e: 0xdd, 0x45f: 0xde, + 0x468: 0xdf, 0x469: 0xe0, 0x46a: 0xe1, + // Block 0x12, offset 0x480 + 0x480: 0xe2, 0x482: 0xcf, 0x484: 0xce, + 0x48a: 0xe3, 0x48b: 0xe4, + 0x493: 0xe5, + 0x4a0: 0x9c, 0x4a1: 0x9c, 0x4a2: 0x9c, 0x4a3: 0xe6, 0x4a4: 0x9c, 0x4a5: 0xe7, 0x4a6: 0x9c, 0x4a7: 0x9c, + 0x4a8: 0x9c, 0x4a9: 0x9c, 0x4aa: 0x9c, 0x4ab: 0x9c, 0x4ac: 0x9c, 0x4ad: 0x9c, 0x4ae: 0x9c, 0x4af: 0x9c, + 0x4b0: 0x9c, 0x4b1: 0xe8, 0x4b2: 0xe9, 0x4b3: 0x9c, 0x4b4: 0xea, 0x4b5: 0x9c, 0x4b6: 0x9c, 0x4b7: 0x9c, + 0x4b8: 0x0e, 0x4b9: 0x0e, 0x4ba: 0x0e, 0x4bb: 0xeb, 0x4bc: 0x9c, 0x4bd: 0x9c, 0x4be: 0x9c, 0x4bf: 0x9c, + // Block 0x13, offset 0x4c0 + 0x4c0: 0xec, 0x4c1: 0x55, 0x4c2: 0xed, 0x4c3: 0xee, 0x4c4: 0xef, 0x4c5: 0xf0, 0x4c6: 0xf1, + 0x4c9: 0xf2, 0x4cc: 0x55, 0x4cd: 0x55, 0x4ce: 0x55, 0x4cf: 0x55, + 0x4d0: 0x55, 0x4d1: 0x55, 0x4d2: 0x55, 0x4d3: 0x55, 0x4d4: 0x55, 0x4d5: 0x55, 0x4d6: 0x55, 0x4d7: 0x55, + 0x4d8: 0x55, 0x4d9: 0x55, 0x4da: 0x55, 0x4db: 0xf3, 0x4dc: 0x55, 0x4dd: 0xf4, 0x4de: 0x55, 0x4df: 0xf5, + 0x4e0: 0xf6, 0x4e1: 0xf7, 0x4e2: 0xf8, 0x4e4: 0x55, 0x4e5: 0x55, 0x4e6: 0x55, 0x4e7: 0x55, + 0x4e8: 0x55, 0x4e9: 0xf9, 0x4ea: 0xfa, 0x4eb: 0xfb, 0x4ec: 0x55, 0x4ed: 0x55, 0x4ee: 0xfc, 0x4ef: 0xfd, + 0x4ff: 0xfe, + // Block 0x14, offset 0x500 + 0x53f: 0xfe, + // Block 0x15, offset 0x540 + 0x550: 0x09, 0x551: 0x0a, 0x553: 0x0b, 0x556: 0x0c, + 0x55b: 0x0d, 0x55c: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, + 0x57f: 0x12, + // Block 0x16, offset 0x580 + 0x58f: 0x12, + 0x59f: 0x12, + 0x5af: 0x12, + 0x5bf: 0x12, + // Block 0x17, offset 0x5c0 + 0x5c0: 0xff, 0x5c1: 0xff, 0x5c2: 0xff, 0x5c3: 0xff, 0x5c4: 0x05, 0x5c5: 0x05, 0x5c6: 0x05, 0x5c7: 0x100, + 0x5c8: 0xff, 0x5c9: 0xff, 0x5ca: 0xff, 0x5cb: 0xff, 0x5cc: 0xff, 0x5cd: 0xff, 0x5ce: 0xff, 0x5cf: 0xff, + 0x5d0: 0xff, 0x5d1: 0xff, 0x5d2: 0xff, 0x5d3: 0xff, 0x5d4: 0xff, 0x5d5: 0xff, 0x5d6: 0xff, 0x5d7: 0xff, + 0x5d8: 0xff, 0x5d9: 0xff, 0x5da: 0xff, 0x5db: 0xff, 0x5dc: 0xff, 0x5dd: 0xff, 0x5de: 0xff, 0x5df: 0xff, + 0x5e0: 0xff, 0x5e1: 0xff, 0x5e2: 0xff, 0x5e3: 0xff, 0x5e4: 0xff, 0x5e5: 0xff, 0x5e6: 0xff, 0x5e7: 0xff, + 0x5e8: 0xff, 0x5e9: 0xff, 0x5ea: 0xff, 0x5eb: 0xff, 0x5ec: 0xff, 0x5ed: 0xff, 0x5ee: 0xff, 0x5ef: 0xff, + 0x5f0: 0xff, 0x5f1: 0xff, 0x5f2: 0xff, 0x5f3: 0xff, 0x5f4: 0xff, 0x5f5: 0xff, 0x5f6: 0xff, 0x5f7: 0xff, + 0x5f8: 0xff, 0x5f9: 0xff, 0x5fa: 0xff, 0x5fb: 0xff, 0x5fc: 0xff, 0x5fd: 0xff, 0x5fe: 0xff, 0x5ff: 0xff, + // Block 0x18, offset 0x600 + 0x60f: 0x12, + 0x61f: 0x12, + 0x620: 0x15, + 0x62f: 0x12, + 0x63f: 0x12, + // Block 0x19, offset 0x640 + 0x64f: 0x12, +} + +// Total table size 19960 bytes (19KiB); checksum: F50EF68C diff --git a/vendor/golang.org/x/text/unicode/bidi/tables9.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables9.0.0.go index f517fdb2..c164d379 100644 --- a/vendor/golang.org/x/text/unicode/bidi/tables9.0.0.go +++ b/vendor/golang.org/x/text/unicode/bidi/tables9.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. //go:build !go1.10 -// +build !go1.10 package bidi diff --git a/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go index f5a07882..1af161c7 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. //go:build go1.10 && !go1.13 -// +build go1.10,!go1.13 package norm diff --git a/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go index cb7239c4..eb73ecc3 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. //go:build go1.13 && !go1.14 -// +build go1.13,!go1.14 package norm diff --git a/vendor/golang.org/x/text/unicode/norm/tables12.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables12.0.0.go index 11b27330..276cb8d8 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables12.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables12.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. //go:build go1.14 && !go1.16 -// +build go1.14,!go1.16 package norm diff --git a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go index 9115ef25..0cceffd7 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 package norm diff --git a/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go new file mode 100644 index 00000000..b0819e42 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go @@ -0,0 +1,7907 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 + +package norm + +import "sync" + +const ( + // Version is the Unicode edition from which the tables are derived. + Version = "15.0.0" + + // MaxTransformChunkSize indicates the maximum number of bytes that Transform + // may need to write atomically for any Form. Making a destination buffer at + // least this size ensures that Transform can always make progress and that + // the user does not need to grow the buffer on an ErrShortDst. + MaxTransformChunkSize = 35 + maxNonStarters*4 +) + +var ccc = [56]uint8{ + 0, 1, 6, 7, 8, 9, 10, 11, + 12, 13, 14, 15, 16, 17, 18, 19, + 20, 21, 22, 23, 24, 25, 26, 27, + 28, 29, 30, 31, 32, 33, 34, 35, + 36, 84, 91, 103, 107, 118, 122, 129, + 130, 132, 202, 214, 216, 218, 220, 222, + 224, 226, 228, 230, 232, 233, 234, 240, +} + +const ( + firstMulti = 0x199A + firstCCC = 0x2DD5 + endMulti = 0x30A1 + firstLeadingCCC = 0x4AEF + firstCCCZeroExcept = 0x4BB9 + firstStarterWithNLead = 0x4BE0 + lastDecomp = 0x4BE2 + maxDecomp = 0x8000 +) + +// decomps: 19426 bytes +var decomps = [...]byte{ + // Bytes 0 - 3f + 0x00, 0x41, 0x20, 0x41, 0x21, 0x41, 0x22, 0x41, + 0x23, 0x41, 0x24, 0x41, 0x25, 0x41, 0x26, 0x41, + 0x27, 0x41, 0x28, 0x41, 0x29, 0x41, 0x2A, 0x41, + 0x2B, 0x41, 0x2C, 0x41, 0x2D, 0x41, 0x2E, 0x41, + 0x2F, 0x41, 0x30, 0x41, 0x31, 0x41, 0x32, 0x41, + 0x33, 0x41, 0x34, 0x41, 0x35, 0x41, 0x36, 0x41, + 0x37, 0x41, 0x38, 0x41, 0x39, 0x41, 0x3A, 0x41, + 0x3B, 0x41, 0x3C, 0x41, 0x3D, 0x41, 0x3E, 0x41, + // Bytes 40 - 7f + 0x3F, 0x41, 0x40, 0x41, 0x41, 0x41, 0x42, 0x41, + 0x43, 0x41, 0x44, 0x41, 0x45, 0x41, 0x46, 0x41, + 0x47, 0x41, 0x48, 0x41, 0x49, 0x41, 0x4A, 0x41, + 0x4B, 0x41, 0x4C, 0x41, 0x4D, 0x41, 0x4E, 0x41, + 0x4F, 0x41, 0x50, 0x41, 0x51, 0x41, 0x52, 0x41, + 0x53, 0x41, 0x54, 0x41, 0x55, 0x41, 0x56, 0x41, + 0x57, 0x41, 0x58, 0x41, 0x59, 0x41, 0x5A, 0x41, + 0x5B, 0x41, 0x5C, 0x41, 0x5D, 0x41, 0x5E, 0x41, + // Bytes 80 - bf + 0x5F, 0x41, 0x60, 0x41, 0x61, 0x41, 0x62, 0x41, + 0x63, 0x41, 0x64, 0x41, 0x65, 0x41, 0x66, 0x41, + 0x67, 0x41, 0x68, 0x41, 0x69, 0x41, 0x6A, 0x41, + 0x6B, 0x41, 0x6C, 0x41, 0x6D, 0x41, 0x6E, 0x41, + 0x6F, 0x41, 0x70, 0x41, 0x71, 0x41, 0x72, 0x41, + 0x73, 0x41, 0x74, 0x41, 0x75, 0x41, 0x76, 0x41, + 0x77, 0x41, 0x78, 0x41, 0x79, 0x41, 0x7A, 0x41, + 0x7B, 0x41, 0x7C, 0x41, 0x7D, 0x41, 0x7E, 0x42, + // Bytes c0 - ff + 0xC2, 0xA2, 0x42, 0xC2, 0xA3, 0x42, 0xC2, 0xA5, + 0x42, 0xC2, 0xA6, 0x42, 0xC2, 0xAC, 0x42, 0xC2, + 0xB7, 0x42, 0xC3, 0x86, 0x42, 0xC3, 0xA6, 0x42, + 0xC3, 0xB0, 0x42, 0xC3, 0xB8, 0x42, 0xC4, 0xA6, + 0x42, 0xC4, 0xA7, 0x42, 0xC4, 0xB1, 0x42, 0xC5, + 0x8B, 0x42, 0xC5, 0x93, 0x42, 0xC6, 0x8E, 0x42, + 0xC6, 0x90, 0x42, 0xC6, 0xAB, 0x42, 0xC7, 0x80, + 0x42, 0xC7, 0x81, 0x42, 0xC7, 0x82, 0x42, 0xC8, + // Bytes 100 - 13f + 0xA2, 0x42, 0xC8, 0xB7, 0x42, 0xC9, 0x90, 0x42, + 0xC9, 0x91, 0x42, 0xC9, 0x92, 0x42, 0xC9, 0x93, + 0x42, 0xC9, 0x94, 0x42, 0xC9, 0x95, 0x42, 0xC9, + 0x96, 0x42, 0xC9, 0x97, 0x42, 0xC9, 0x98, 0x42, + 0xC9, 0x99, 0x42, 0xC9, 0x9B, 0x42, 0xC9, 0x9C, + 0x42, 0xC9, 0x9E, 0x42, 0xC9, 0x9F, 0x42, 0xC9, + 0xA0, 0x42, 0xC9, 0xA1, 0x42, 0xC9, 0xA2, 0x42, + 0xC9, 0xA3, 0x42, 0xC9, 0xA4, 0x42, 0xC9, 0xA5, + // Bytes 140 - 17f + 0x42, 0xC9, 0xA6, 0x42, 0xC9, 0xA7, 0x42, 0xC9, + 0xA8, 0x42, 0xC9, 0xA9, 0x42, 0xC9, 0xAA, 0x42, + 0xC9, 0xAB, 0x42, 0xC9, 0xAC, 0x42, 0xC9, 0xAD, + 0x42, 0xC9, 0xAE, 0x42, 0xC9, 0xAF, 0x42, 0xC9, + 0xB0, 0x42, 0xC9, 0xB1, 0x42, 0xC9, 0xB2, 0x42, + 0xC9, 0xB3, 0x42, 0xC9, 0xB4, 0x42, 0xC9, 0xB5, + 0x42, 0xC9, 0xB6, 0x42, 0xC9, 0xB7, 0x42, 0xC9, + 0xB8, 0x42, 0xC9, 0xB9, 0x42, 0xC9, 0xBA, 0x42, + // Bytes 180 - 1bf + 0xC9, 0xBB, 0x42, 0xC9, 0xBD, 0x42, 0xC9, 0xBE, + 0x42, 0xCA, 0x80, 0x42, 0xCA, 0x81, 0x42, 0xCA, + 0x82, 0x42, 0xCA, 0x83, 0x42, 0xCA, 0x84, 0x42, + 0xCA, 0x88, 0x42, 0xCA, 0x89, 0x42, 0xCA, 0x8A, + 0x42, 0xCA, 0x8B, 0x42, 0xCA, 0x8C, 0x42, 0xCA, + 0x8D, 0x42, 0xCA, 0x8E, 0x42, 0xCA, 0x8F, 0x42, + 0xCA, 0x90, 0x42, 0xCA, 0x91, 0x42, 0xCA, 0x92, + 0x42, 0xCA, 0x95, 0x42, 0xCA, 0x98, 0x42, 0xCA, + // Bytes 1c0 - 1ff + 0x99, 0x42, 0xCA, 0x9B, 0x42, 0xCA, 0x9C, 0x42, + 0xCA, 0x9D, 0x42, 0xCA, 0x9F, 0x42, 0xCA, 0xA1, + 0x42, 0xCA, 0xA2, 0x42, 0xCA, 0xA3, 0x42, 0xCA, + 0xA4, 0x42, 0xCA, 0xA5, 0x42, 0xCA, 0xA6, 0x42, + 0xCA, 0xA7, 0x42, 0xCA, 0xA8, 0x42, 0xCA, 0xA9, + 0x42, 0xCA, 0xAA, 0x42, 0xCA, 0xAB, 0x42, 0xCA, + 0xB9, 0x42, 0xCB, 0x90, 0x42, 0xCB, 0x91, 0x42, + 0xCE, 0x91, 0x42, 0xCE, 0x92, 0x42, 0xCE, 0x93, + // Bytes 200 - 23f + 0x42, 0xCE, 0x94, 0x42, 0xCE, 0x95, 0x42, 0xCE, + 0x96, 0x42, 0xCE, 0x97, 0x42, 0xCE, 0x98, 0x42, + 0xCE, 0x99, 0x42, 0xCE, 0x9A, 0x42, 0xCE, 0x9B, + 0x42, 0xCE, 0x9C, 0x42, 0xCE, 0x9D, 0x42, 0xCE, + 0x9E, 0x42, 0xCE, 0x9F, 0x42, 0xCE, 0xA0, 0x42, + 0xCE, 0xA1, 0x42, 0xCE, 0xA3, 0x42, 0xCE, 0xA4, + 0x42, 0xCE, 0xA5, 0x42, 0xCE, 0xA6, 0x42, 0xCE, + 0xA7, 0x42, 0xCE, 0xA8, 0x42, 0xCE, 0xA9, 0x42, + // Bytes 240 - 27f + 0xCE, 0xB1, 0x42, 0xCE, 0xB2, 0x42, 0xCE, 0xB3, + 0x42, 0xCE, 0xB4, 0x42, 0xCE, 0xB5, 0x42, 0xCE, + 0xB6, 0x42, 0xCE, 0xB7, 0x42, 0xCE, 0xB8, 0x42, + 0xCE, 0xB9, 0x42, 0xCE, 0xBA, 0x42, 0xCE, 0xBB, + 0x42, 0xCE, 0xBC, 0x42, 0xCE, 0xBD, 0x42, 0xCE, + 0xBE, 0x42, 0xCE, 0xBF, 0x42, 0xCF, 0x80, 0x42, + 0xCF, 0x81, 0x42, 0xCF, 0x82, 0x42, 0xCF, 0x83, + 0x42, 0xCF, 0x84, 0x42, 0xCF, 0x85, 0x42, 0xCF, + // Bytes 280 - 2bf + 0x86, 0x42, 0xCF, 0x87, 0x42, 0xCF, 0x88, 0x42, + 0xCF, 0x89, 0x42, 0xCF, 0x9C, 0x42, 0xCF, 0x9D, + 0x42, 0xD0, 0xB0, 0x42, 0xD0, 0xB1, 0x42, 0xD0, + 0xB2, 0x42, 0xD0, 0xB3, 0x42, 0xD0, 0xB4, 0x42, + 0xD0, 0xB5, 0x42, 0xD0, 0xB6, 0x42, 0xD0, 0xB7, + 0x42, 0xD0, 0xB8, 0x42, 0xD0, 0xBA, 0x42, 0xD0, + 0xBB, 0x42, 0xD0, 0xBC, 0x42, 0xD0, 0xBD, 0x42, + 0xD0, 0xBE, 0x42, 0xD0, 0xBF, 0x42, 0xD1, 0x80, + // Bytes 2c0 - 2ff + 0x42, 0xD1, 0x81, 0x42, 0xD1, 0x82, 0x42, 0xD1, + 0x83, 0x42, 0xD1, 0x84, 0x42, 0xD1, 0x85, 0x42, + 0xD1, 0x86, 0x42, 0xD1, 0x87, 0x42, 0xD1, 0x88, + 0x42, 0xD1, 0x8A, 0x42, 0xD1, 0x8B, 0x42, 0xD1, + 0x8C, 0x42, 0xD1, 0x8D, 0x42, 0xD1, 0x8E, 0x42, + 0xD1, 0x95, 0x42, 0xD1, 0x96, 0x42, 0xD1, 0x98, + 0x42, 0xD1, 0x9F, 0x42, 0xD2, 0x91, 0x42, 0xD2, + 0xAB, 0x42, 0xD2, 0xAF, 0x42, 0xD2, 0xB1, 0x42, + // Bytes 300 - 33f + 0xD3, 0x8F, 0x42, 0xD3, 0x99, 0x42, 0xD3, 0xA9, + 0x42, 0xD7, 0x90, 0x42, 0xD7, 0x91, 0x42, 0xD7, + 0x92, 0x42, 0xD7, 0x93, 0x42, 0xD7, 0x94, 0x42, + 0xD7, 0x9B, 0x42, 0xD7, 0x9C, 0x42, 0xD7, 0x9D, + 0x42, 0xD7, 0xA2, 0x42, 0xD7, 0xA8, 0x42, 0xD7, + 0xAA, 0x42, 0xD8, 0xA1, 0x42, 0xD8, 0xA7, 0x42, + 0xD8, 0xA8, 0x42, 0xD8, 0xA9, 0x42, 0xD8, 0xAA, + 0x42, 0xD8, 0xAB, 0x42, 0xD8, 0xAC, 0x42, 0xD8, + // Bytes 340 - 37f + 0xAD, 0x42, 0xD8, 0xAE, 0x42, 0xD8, 0xAF, 0x42, + 0xD8, 0xB0, 0x42, 0xD8, 0xB1, 0x42, 0xD8, 0xB2, + 0x42, 0xD8, 0xB3, 0x42, 0xD8, 0xB4, 0x42, 0xD8, + 0xB5, 0x42, 0xD8, 0xB6, 0x42, 0xD8, 0xB7, 0x42, + 0xD8, 0xB8, 0x42, 0xD8, 0xB9, 0x42, 0xD8, 0xBA, + 0x42, 0xD9, 0x81, 0x42, 0xD9, 0x82, 0x42, 0xD9, + 0x83, 0x42, 0xD9, 0x84, 0x42, 0xD9, 0x85, 0x42, + 0xD9, 0x86, 0x42, 0xD9, 0x87, 0x42, 0xD9, 0x88, + // Bytes 380 - 3bf + 0x42, 0xD9, 0x89, 0x42, 0xD9, 0x8A, 0x42, 0xD9, + 0xAE, 0x42, 0xD9, 0xAF, 0x42, 0xD9, 0xB1, 0x42, + 0xD9, 0xB9, 0x42, 0xD9, 0xBA, 0x42, 0xD9, 0xBB, + 0x42, 0xD9, 0xBE, 0x42, 0xD9, 0xBF, 0x42, 0xDA, + 0x80, 0x42, 0xDA, 0x83, 0x42, 0xDA, 0x84, 0x42, + 0xDA, 0x86, 0x42, 0xDA, 0x87, 0x42, 0xDA, 0x88, + 0x42, 0xDA, 0x8C, 0x42, 0xDA, 0x8D, 0x42, 0xDA, + 0x8E, 0x42, 0xDA, 0x91, 0x42, 0xDA, 0x98, 0x42, + // Bytes 3c0 - 3ff + 0xDA, 0xA1, 0x42, 0xDA, 0xA4, 0x42, 0xDA, 0xA6, + 0x42, 0xDA, 0xA9, 0x42, 0xDA, 0xAD, 0x42, 0xDA, + 0xAF, 0x42, 0xDA, 0xB1, 0x42, 0xDA, 0xB3, 0x42, + 0xDA, 0xBA, 0x42, 0xDA, 0xBB, 0x42, 0xDA, 0xBE, + 0x42, 0xDB, 0x81, 0x42, 0xDB, 0x85, 0x42, 0xDB, + 0x86, 0x42, 0xDB, 0x87, 0x42, 0xDB, 0x88, 0x42, + 0xDB, 0x89, 0x42, 0xDB, 0x8B, 0x42, 0xDB, 0x8C, + 0x42, 0xDB, 0x90, 0x42, 0xDB, 0x92, 0x43, 0xE0, + // Bytes 400 - 43f + 0xBC, 0x8B, 0x43, 0xE1, 0x83, 0x9C, 0x43, 0xE1, + 0x84, 0x80, 0x43, 0xE1, 0x84, 0x81, 0x43, 0xE1, + 0x84, 0x82, 0x43, 0xE1, 0x84, 0x83, 0x43, 0xE1, + 0x84, 0x84, 0x43, 0xE1, 0x84, 0x85, 0x43, 0xE1, + 0x84, 0x86, 0x43, 0xE1, 0x84, 0x87, 0x43, 0xE1, + 0x84, 0x88, 0x43, 0xE1, 0x84, 0x89, 0x43, 0xE1, + 0x84, 0x8A, 0x43, 0xE1, 0x84, 0x8B, 0x43, 0xE1, + 0x84, 0x8C, 0x43, 0xE1, 0x84, 0x8D, 0x43, 0xE1, + // Bytes 440 - 47f + 0x84, 0x8E, 0x43, 0xE1, 0x84, 0x8F, 0x43, 0xE1, + 0x84, 0x90, 0x43, 0xE1, 0x84, 0x91, 0x43, 0xE1, + 0x84, 0x92, 0x43, 0xE1, 0x84, 0x94, 0x43, 0xE1, + 0x84, 0x95, 0x43, 0xE1, 0x84, 0x9A, 0x43, 0xE1, + 0x84, 0x9C, 0x43, 0xE1, 0x84, 0x9D, 0x43, 0xE1, + 0x84, 0x9E, 0x43, 0xE1, 0x84, 0xA0, 0x43, 0xE1, + 0x84, 0xA1, 0x43, 0xE1, 0x84, 0xA2, 0x43, 0xE1, + 0x84, 0xA3, 0x43, 0xE1, 0x84, 0xA7, 0x43, 0xE1, + // Bytes 480 - 4bf + 0x84, 0xA9, 0x43, 0xE1, 0x84, 0xAB, 0x43, 0xE1, + 0x84, 0xAC, 0x43, 0xE1, 0x84, 0xAD, 0x43, 0xE1, + 0x84, 0xAE, 0x43, 0xE1, 0x84, 0xAF, 0x43, 0xE1, + 0x84, 0xB2, 0x43, 0xE1, 0x84, 0xB6, 0x43, 0xE1, + 0x85, 0x80, 0x43, 0xE1, 0x85, 0x87, 0x43, 0xE1, + 0x85, 0x8C, 0x43, 0xE1, 0x85, 0x97, 0x43, 0xE1, + 0x85, 0x98, 0x43, 0xE1, 0x85, 0x99, 0x43, 0xE1, + 0x85, 0xA0, 0x43, 0xE1, 0x86, 0x84, 0x43, 0xE1, + // Bytes 4c0 - 4ff + 0x86, 0x85, 0x43, 0xE1, 0x86, 0x88, 0x43, 0xE1, + 0x86, 0x91, 0x43, 0xE1, 0x86, 0x92, 0x43, 0xE1, + 0x86, 0x94, 0x43, 0xE1, 0x86, 0x9E, 0x43, 0xE1, + 0x86, 0xA1, 0x43, 0xE1, 0x87, 0x87, 0x43, 0xE1, + 0x87, 0x88, 0x43, 0xE1, 0x87, 0x8C, 0x43, 0xE1, + 0x87, 0x8E, 0x43, 0xE1, 0x87, 0x93, 0x43, 0xE1, + 0x87, 0x97, 0x43, 0xE1, 0x87, 0x99, 0x43, 0xE1, + 0x87, 0x9D, 0x43, 0xE1, 0x87, 0x9F, 0x43, 0xE1, + // Bytes 500 - 53f + 0x87, 0xB1, 0x43, 0xE1, 0x87, 0xB2, 0x43, 0xE1, + 0xB4, 0x82, 0x43, 0xE1, 0xB4, 0x96, 0x43, 0xE1, + 0xB4, 0x97, 0x43, 0xE1, 0xB4, 0x9C, 0x43, 0xE1, + 0xB4, 0x9D, 0x43, 0xE1, 0xB4, 0xA5, 0x43, 0xE1, + 0xB5, 0xBB, 0x43, 0xE1, 0xB6, 0x85, 0x43, 0xE1, + 0xB6, 0x91, 0x43, 0xE2, 0x80, 0x82, 0x43, 0xE2, + 0x80, 0x83, 0x43, 0xE2, 0x80, 0x90, 0x43, 0xE2, + 0x80, 0x93, 0x43, 0xE2, 0x80, 0x94, 0x43, 0xE2, + // Bytes 540 - 57f + 0x82, 0xA9, 0x43, 0xE2, 0x86, 0x90, 0x43, 0xE2, + 0x86, 0x91, 0x43, 0xE2, 0x86, 0x92, 0x43, 0xE2, + 0x86, 0x93, 0x43, 0xE2, 0x88, 0x82, 0x43, 0xE2, + 0x88, 0x87, 0x43, 0xE2, 0x88, 0x91, 0x43, 0xE2, + 0x88, 0x92, 0x43, 0xE2, 0x94, 0x82, 0x43, 0xE2, + 0x96, 0xA0, 0x43, 0xE2, 0x97, 0x8B, 0x43, 0xE2, + 0xA6, 0x85, 0x43, 0xE2, 0xA6, 0x86, 0x43, 0xE2, + 0xB1, 0xB1, 0x43, 0xE2, 0xB5, 0xA1, 0x43, 0xE3, + // Bytes 580 - 5bf + 0x80, 0x81, 0x43, 0xE3, 0x80, 0x82, 0x43, 0xE3, + 0x80, 0x88, 0x43, 0xE3, 0x80, 0x89, 0x43, 0xE3, + 0x80, 0x8A, 0x43, 0xE3, 0x80, 0x8B, 0x43, 0xE3, + 0x80, 0x8C, 0x43, 0xE3, 0x80, 0x8D, 0x43, 0xE3, + 0x80, 0x8E, 0x43, 0xE3, 0x80, 0x8F, 0x43, 0xE3, + 0x80, 0x90, 0x43, 0xE3, 0x80, 0x91, 0x43, 0xE3, + 0x80, 0x92, 0x43, 0xE3, 0x80, 0x94, 0x43, 0xE3, + 0x80, 0x95, 0x43, 0xE3, 0x80, 0x96, 0x43, 0xE3, + // Bytes 5c0 - 5ff + 0x80, 0x97, 0x43, 0xE3, 0x82, 0xA1, 0x43, 0xE3, + 0x82, 0xA2, 0x43, 0xE3, 0x82, 0xA3, 0x43, 0xE3, + 0x82, 0xA4, 0x43, 0xE3, 0x82, 0xA5, 0x43, 0xE3, + 0x82, 0xA6, 0x43, 0xE3, 0x82, 0xA7, 0x43, 0xE3, + 0x82, 0xA8, 0x43, 0xE3, 0x82, 0xA9, 0x43, 0xE3, + 0x82, 0xAA, 0x43, 0xE3, 0x82, 0xAB, 0x43, 0xE3, + 0x82, 0xAD, 0x43, 0xE3, 0x82, 0xAF, 0x43, 0xE3, + 0x82, 0xB1, 0x43, 0xE3, 0x82, 0xB3, 0x43, 0xE3, + // Bytes 600 - 63f + 0x82, 0xB5, 0x43, 0xE3, 0x82, 0xB7, 0x43, 0xE3, + 0x82, 0xB9, 0x43, 0xE3, 0x82, 0xBB, 0x43, 0xE3, + 0x82, 0xBD, 0x43, 0xE3, 0x82, 0xBF, 0x43, 0xE3, + 0x83, 0x81, 0x43, 0xE3, 0x83, 0x83, 0x43, 0xE3, + 0x83, 0x84, 0x43, 0xE3, 0x83, 0x86, 0x43, 0xE3, + 0x83, 0x88, 0x43, 0xE3, 0x83, 0x8A, 0x43, 0xE3, + 0x83, 0x8B, 0x43, 0xE3, 0x83, 0x8C, 0x43, 0xE3, + 0x83, 0x8D, 0x43, 0xE3, 0x83, 0x8E, 0x43, 0xE3, + // Bytes 640 - 67f + 0x83, 0x8F, 0x43, 0xE3, 0x83, 0x92, 0x43, 0xE3, + 0x83, 0x95, 0x43, 0xE3, 0x83, 0x98, 0x43, 0xE3, + 0x83, 0x9B, 0x43, 0xE3, 0x83, 0x9E, 0x43, 0xE3, + 0x83, 0x9F, 0x43, 0xE3, 0x83, 0xA0, 0x43, 0xE3, + 0x83, 0xA1, 0x43, 0xE3, 0x83, 0xA2, 0x43, 0xE3, + 0x83, 0xA3, 0x43, 0xE3, 0x83, 0xA4, 0x43, 0xE3, + 0x83, 0xA5, 0x43, 0xE3, 0x83, 0xA6, 0x43, 0xE3, + 0x83, 0xA7, 0x43, 0xE3, 0x83, 0xA8, 0x43, 0xE3, + // Bytes 680 - 6bf + 0x83, 0xA9, 0x43, 0xE3, 0x83, 0xAA, 0x43, 0xE3, + 0x83, 0xAB, 0x43, 0xE3, 0x83, 0xAC, 0x43, 0xE3, + 0x83, 0xAD, 0x43, 0xE3, 0x83, 0xAF, 0x43, 0xE3, + 0x83, 0xB0, 0x43, 0xE3, 0x83, 0xB1, 0x43, 0xE3, + 0x83, 0xB2, 0x43, 0xE3, 0x83, 0xB3, 0x43, 0xE3, + 0x83, 0xBB, 0x43, 0xE3, 0x83, 0xBC, 0x43, 0xE3, + 0x92, 0x9E, 0x43, 0xE3, 0x92, 0xB9, 0x43, 0xE3, + 0x92, 0xBB, 0x43, 0xE3, 0x93, 0x9F, 0x43, 0xE3, + // Bytes 6c0 - 6ff + 0x94, 0x95, 0x43, 0xE3, 0x9B, 0xAE, 0x43, 0xE3, + 0x9B, 0xBC, 0x43, 0xE3, 0x9E, 0x81, 0x43, 0xE3, + 0xA0, 0xAF, 0x43, 0xE3, 0xA1, 0xA2, 0x43, 0xE3, + 0xA1, 0xBC, 0x43, 0xE3, 0xA3, 0x87, 0x43, 0xE3, + 0xA3, 0xA3, 0x43, 0xE3, 0xA4, 0x9C, 0x43, 0xE3, + 0xA4, 0xBA, 0x43, 0xE3, 0xA8, 0xAE, 0x43, 0xE3, + 0xA9, 0xAC, 0x43, 0xE3, 0xAB, 0xA4, 0x43, 0xE3, + 0xAC, 0x88, 0x43, 0xE3, 0xAC, 0x99, 0x43, 0xE3, + // Bytes 700 - 73f + 0xAD, 0x89, 0x43, 0xE3, 0xAE, 0x9D, 0x43, 0xE3, + 0xB0, 0x98, 0x43, 0xE3, 0xB1, 0x8E, 0x43, 0xE3, + 0xB4, 0xB3, 0x43, 0xE3, 0xB6, 0x96, 0x43, 0xE3, + 0xBA, 0xAC, 0x43, 0xE3, 0xBA, 0xB8, 0x43, 0xE3, + 0xBC, 0x9B, 0x43, 0xE3, 0xBF, 0xBC, 0x43, 0xE4, + 0x80, 0x88, 0x43, 0xE4, 0x80, 0x98, 0x43, 0xE4, + 0x80, 0xB9, 0x43, 0xE4, 0x81, 0x86, 0x43, 0xE4, + 0x82, 0x96, 0x43, 0xE4, 0x83, 0xA3, 0x43, 0xE4, + // Bytes 740 - 77f + 0x84, 0xAF, 0x43, 0xE4, 0x88, 0x82, 0x43, 0xE4, + 0x88, 0xA7, 0x43, 0xE4, 0x8A, 0xA0, 0x43, 0xE4, + 0x8C, 0x81, 0x43, 0xE4, 0x8C, 0xB4, 0x43, 0xE4, + 0x8D, 0x99, 0x43, 0xE4, 0x8F, 0x95, 0x43, 0xE4, + 0x8F, 0x99, 0x43, 0xE4, 0x90, 0x8B, 0x43, 0xE4, + 0x91, 0xAB, 0x43, 0xE4, 0x94, 0xAB, 0x43, 0xE4, + 0x95, 0x9D, 0x43, 0xE4, 0x95, 0xA1, 0x43, 0xE4, + 0x95, 0xAB, 0x43, 0xE4, 0x97, 0x97, 0x43, 0xE4, + // Bytes 780 - 7bf + 0x97, 0xB9, 0x43, 0xE4, 0x98, 0xB5, 0x43, 0xE4, + 0x9A, 0xBE, 0x43, 0xE4, 0x9B, 0x87, 0x43, 0xE4, + 0xA6, 0x95, 0x43, 0xE4, 0xA7, 0xA6, 0x43, 0xE4, + 0xA9, 0xAE, 0x43, 0xE4, 0xA9, 0xB6, 0x43, 0xE4, + 0xAA, 0xB2, 0x43, 0xE4, 0xAC, 0xB3, 0x43, 0xE4, + 0xAF, 0x8E, 0x43, 0xE4, 0xB3, 0x8E, 0x43, 0xE4, + 0xB3, 0xAD, 0x43, 0xE4, 0xB3, 0xB8, 0x43, 0xE4, + 0xB5, 0x96, 0x43, 0xE4, 0xB8, 0x80, 0x43, 0xE4, + // Bytes 7c0 - 7ff + 0xB8, 0x81, 0x43, 0xE4, 0xB8, 0x83, 0x43, 0xE4, + 0xB8, 0x89, 0x43, 0xE4, 0xB8, 0x8A, 0x43, 0xE4, + 0xB8, 0x8B, 0x43, 0xE4, 0xB8, 0x8D, 0x43, 0xE4, + 0xB8, 0x99, 0x43, 0xE4, 0xB8, 0xA6, 0x43, 0xE4, + 0xB8, 0xA8, 0x43, 0xE4, 0xB8, 0xAD, 0x43, 0xE4, + 0xB8, 0xB2, 0x43, 0xE4, 0xB8, 0xB6, 0x43, 0xE4, + 0xB8, 0xB8, 0x43, 0xE4, 0xB8, 0xB9, 0x43, 0xE4, + 0xB8, 0xBD, 0x43, 0xE4, 0xB8, 0xBF, 0x43, 0xE4, + // Bytes 800 - 83f + 0xB9, 0x81, 0x43, 0xE4, 0xB9, 0x99, 0x43, 0xE4, + 0xB9, 0x9D, 0x43, 0xE4, 0xBA, 0x82, 0x43, 0xE4, + 0xBA, 0x85, 0x43, 0xE4, 0xBA, 0x86, 0x43, 0xE4, + 0xBA, 0x8C, 0x43, 0xE4, 0xBA, 0x94, 0x43, 0xE4, + 0xBA, 0xA0, 0x43, 0xE4, 0xBA, 0xA4, 0x43, 0xE4, + 0xBA, 0xAE, 0x43, 0xE4, 0xBA, 0xBA, 0x43, 0xE4, + 0xBB, 0x80, 0x43, 0xE4, 0xBB, 0x8C, 0x43, 0xE4, + 0xBB, 0xA4, 0x43, 0xE4, 0xBC, 0x81, 0x43, 0xE4, + // Bytes 840 - 87f + 0xBC, 0x91, 0x43, 0xE4, 0xBD, 0xA0, 0x43, 0xE4, + 0xBE, 0x80, 0x43, 0xE4, 0xBE, 0x86, 0x43, 0xE4, + 0xBE, 0x8B, 0x43, 0xE4, 0xBE, 0xAE, 0x43, 0xE4, + 0xBE, 0xBB, 0x43, 0xE4, 0xBE, 0xBF, 0x43, 0xE5, + 0x80, 0x82, 0x43, 0xE5, 0x80, 0xAB, 0x43, 0xE5, + 0x81, 0xBA, 0x43, 0xE5, 0x82, 0x99, 0x43, 0xE5, + 0x83, 0x8F, 0x43, 0xE5, 0x83, 0x9A, 0x43, 0xE5, + 0x83, 0xA7, 0x43, 0xE5, 0x84, 0xAA, 0x43, 0xE5, + // Bytes 880 - 8bf + 0x84, 0xBF, 0x43, 0xE5, 0x85, 0x80, 0x43, 0xE5, + 0x85, 0x85, 0x43, 0xE5, 0x85, 0x8D, 0x43, 0xE5, + 0x85, 0x94, 0x43, 0xE5, 0x85, 0xA4, 0x43, 0xE5, + 0x85, 0xA5, 0x43, 0xE5, 0x85, 0xA7, 0x43, 0xE5, + 0x85, 0xA8, 0x43, 0xE5, 0x85, 0xA9, 0x43, 0xE5, + 0x85, 0xAB, 0x43, 0xE5, 0x85, 0xAD, 0x43, 0xE5, + 0x85, 0xB7, 0x43, 0xE5, 0x86, 0x80, 0x43, 0xE5, + 0x86, 0x82, 0x43, 0xE5, 0x86, 0x8D, 0x43, 0xE5, + // Bytes 8c0 - 8ff + 0x86, 0x92, 0x43, 0xE5, 0x86, 0x95, 0x43, 0xE5, + 0x86, 0x96, 0x43, 0xE5, 0x86, 0x97, 0x43, 0xE5, + 0x86, 0x99, 0x43, 0xE5, 0x86, 0xA4, 0x43, 0xE5, + 0x86, 0xAB, 0x43, 0xE5, 0x86, 0xAC, 0x43, 0xE5, + 0x86, 0xB5, 0x43, 0xE5, 0x86, 0xB7, 0x43, 0xE5, + 0x87, 0x89, 0x43, 0xE5, 0x87, 0x8C, 0x43, 0xE5, + 0x87, 0x9C, 0x43, 0xE5, 0x87, 0x9E, 0x43, 0xE5, + 0x87, 0xA0, 0x43, 0xE5, 0x87, 0xB5, 0x43, 0xE5, + // Bytes 900 - 93f + 0x88, 0x80, 0x43, 0xE5, 0x88, 0x83, 0x43, 0xE5, + 0x88, 0x87, 0x43, 0xE5, 0x88, 0x97, 0x43, 0xE5, + 0x88, 0x9D, 0x43, 0xE5, 0x88, 0xA9, 0x43, 0xE5, + 0x88, 0xBA, 0x43, 0xE5, 0x88, 0xBB, 0x43, 0xE5, + 0x89, 0x86, 0x43, 0xE5, 0x89, 0x8D, 0x43, 0xE5, + 0x89, 0xB2, 0x43, 0xE5, 0x89, 0xB7, 0x43, 0xE5, + 0x8A, 0x89, 0x43, 0xE5, 0x8A, 0x9B, 0x43, 0xE5, + 0x8A, 0xA3, 0x43, 0xE5, 0x8A, 0xB3, 0x43, 0xE5, + // Bytes 940 - 97f + 0x8A, 0xB4, 0x43, 0xE5, 0x8B, 0x87, 0x43, 0xE5, + 0x8B, 0x89, 0x43, 0xE5, 0x8B, 0x92, 0x43, 0xE5, + 0x8B, 0x9E, 0x43, 0xE5, 0x8B, 0xA4, 0x43, 0xE5, + 0x8B, 0xB5, 0x43, 0xE5, 0x8B, 0xB9, 0x43, 0xE5, + 0x8B, 0xBA, 0x43, 0xE5, 0x8C, 0x85, 0x43, 0xE5, + 0x8C, 0x86, 0x43, 0xE5, 0x8C, 0x95, 0x43, 0xE5, + 0x8C, 0x97, 0x43, 0xE5, 0x8C, 0x9A, 0x43, 0xE5, + 0x8C, 0xB8, 0x43, 0xE5, 0x8C, 0xBB, 0x43, 0xE5, + // Bytes 980 - 9bf + 0x8C, 0xBF, 0x43, 0xE5, 0x8D, 0x81, 0x43, 0xE5, + 0x8D, 0x84, 0x43, 0xE5, 0x8D, 0x85, 0x43, 0xE5, + 0x8D, 0x89, 0x43, 0xE5, 0x8D, 0x91, 0x43, 0xE5, + 0x8D, 0x94, 0x43, 0xE5, 0x8D, 0x9A, 0x43, 0xE5, + 0x8D, 0x9C, 0x43, 0xE5, 0x8D, 0xA9, 0x43, 0xE5, + 0x8D, 0xB0, 0x43, 0xE5, 0x8D, 0xB3, 0x43, 0xE5, + 0x8D, 0xB5, 0x43, 0xE5, 0x8D, 0xBD, 0x43, 0xE5, + 0x8D, 0xBF, 0x43, 0xE5, 0x8E, 0x82, 0x43, 0xE5, + // Bytes 9c0 - 9ff + 0x8E, 0xB6, 0x43, 0xE5, 0x8F, 0x83, 0x43, 0xE5, + 0x8F, 0x88, 0x43, 0xE5, 0x8F, 0x8A, 0x43, 0xE5, + 0x8F, 0x8C, 0x43, 0xE5, 0x8F, 0x9F, 0x43, 0xE5, + 0x8F, 0xA3, 0x43, 0xE5, 0x8F, 0xA5, 0x43, 0xE5, + 0x8F, 0xAB, 0x43, 0xE5, 0x8F, 0xAF, 0x43, 0xE5, + 0x8F, 0xB1, 0x43, 0xE5, 0x8F, 0xB3, 0x43, 0xE5, + 0x90, 0x86, 0x43, 0xE5, 0x90, 0x88, 0x43, 0xE5, + 0x90, 0x8D, 0x43, 0xE5, 0x90, 0x8F, 0x43, 0xE5, + // Bytes a00 - a3f + 0x90, 0x9D, 0x43, 0xE5, 0x90, 0xB8, 0x43, 0xE5, + 0x90, 0xB9, 0x43, 0xE5, 0x91, 0x82, 0x43, 0xE5, + 0x91, 0x88, 0x43, 0xE5, 0x91, 0xA8, 0x43, 0xE5, + 0x92, 0x9E, 0x43, 0xE5, 0x92, 0xA2, 0x43, 0xE5, + 0x92, 0xBD, 0x43, 0xE5, 0x93, 0xB6, 0x43, 0xE5, + 0x94, 0x90, 0x43, 0xE5, 0x95, 0x8F, 0x43, 0xE5, + 0x95, 0x93, 0x43, 0xE5, 0x95, 0x95, 0x43, 0xE5, + 0x95, 0xA3, 0x43, 0xE5, 0x96, 0x84, 0x43, 0xE5, + // Bytes a40 - a7f + 0x96, 0x87, 0x43, 0xE5, 0x96, 0x99, 0x43, 0xE5, + 0x96, 0x9D, 0x43, 0xE5, 0x96, 0xAB, 0x43, 0xE5, + 0x96, 0xB3, 0x43, 0xE5, 0x96, 0xB6, 0x43, 0xE5, + 0x97, 0x80, 0x43, 0xE5, 0x97, 0x82, 0x43, 0xE5, + 0x97, 0xA2, 0x43, 0xE5, 0x98, 0x86, 0x43, 0xE5, + 0x99, 0x91, 0x43, 0xE5, 0x99, 0xA8, 0x43, 0xE5, + 0x99, 0xB4, 0x43, 0xE5, 0x9B, 0x97, 0x43, 0xE5, + 0x9B, 0x9B, 0x43, 0xE5, 0x9B, 0xB9, 0x43, 0xE5, + // Bytes a80 - abf + 0x9C, 0x96, 0x43, 0xE5, 0x9C, 0x97, 0x43, 0xE5, + 0x9C, 0x9F, 0x43, 0xE5, 0x9C, 0xB0, 0x43, 0xE5, + 0x9E, 0x8B, 0x43, 0xE5, 0x9F, 0x8E, 0x43, 0xE5, + 0x9F, 0xB4, 0x43, 0xE5, 0xA0, 0x8D, 0x43, 0xE5, + 0xA0, 0xB1, 0x43, 0xE5, 0xA0, 0xB2, 0x43, 0xE5, + 0xA1, 0x80, 0x43, 0xE5, 0xA1, 0x9A, 0x43, 0xE5, + 0xA1, 0x9E, 0x43, 0xE5, 0xA2, 0xA8, 0x43, 0xE5, + 0xA2, 0xAC, 0x43, 0xE5, 0xA2, 0xB3, 0x43, 0xE5, + // Bytes ac0 - aff + 0xA3, 0x98, 0x43, 0xE5, 0xA3, 0x9F, 0x43, 0xE5, + 0xA3, 0xAB, 0x43, 0xE5, 0xA3, 0xAE, 0x43, 0xE5, + 0xA3, 0xB0, 0x43, 0xE5, 0xA3, 0xB2, 0x43, 0xE5, + 0xA3, 0xB7, 0x43, 0xE5, 0xA4, 0x82, 0x43, 0xE5, + 0xA4, 0x86, 0x43, 0xE5, 0xA4, 0x8A, 0x43, 0xE5, + 0xA4, 0x95, 0x43, 0xE5, 0xA4, 0x9A, 0x43, 0xE5, + 0xA4, 0x9C, 0x43, 0xE5, 0xA4, 0xA2, 0x43, 0xE5, + 0xA4, 0xA7, 0x43, 0xE5, 0xA4, 0xA9, 0x43, 0xE5, + // Bytes b00 - b3f + 0xA5, 0x84, 0x43, 0xE5, 0xA5, 0x88, 0x43, 0xE5, + 0xA5, 0x91, 0x43, 0xE5, 0xA5, 0x94, 0x43, 0xE5, + 0xA5, 0xA2, 0x43, 0xE5, 0xA5, 0xB3, 0x43, 0xE5, + 0xA7, 0x98, 0x43, 0xE5, 0xA7, 0xAC, 0x43, 0xE5, + 0xA8, 0x9B, 0x43, 0xE5, 0xA8, 0xA7, 0x43, 0xE5, + 0xA9, 0xA2, 0x43, 0xE5, 0xA9, 0xA6, 0x43, 0xE5, + 0xAA, 0xB5, 0x43, 0xE5, 0xAC, 0x88, 0x43, 0xE5, + 0xAC, 0xA8, 0x43, 0xE5, 0xAC, 0xBE, 0x43, 0xE5, + // Bytes b40 - b7f + 0xAD, 0x90, 0x43, 0xE5, 0xAD, 0x97, 0x43, 0xE5, + 0xAD, 0xA6, 0x43, 0xE5, 0xAE, 0x80, 0x43, 0xE5, + 0xAE, 0x85, 0x43, 0xE5, 0xAE, 0x97, 0x43, 0xE5, + 0xAF, 0x83, 0x43, 0xE5, 0xAF, 0x98, 0x43, 0xE5, + 0xAF, 0xA7, 0x43, 0xE5, 0xAF, 0xAE, 0x43, 0xE5, + 0xAF, 0xB3, 0x43, 0xE5, 0xAF, 0xB8, 0x43, 0xE5, + 0xAF, 0xBF, 0x43, 0xE5, 0xB0, 0x86, 0x43, 0xE5, + 0xB0, 0x8F, 0x43, 0xE5, 0xB0, 0xA2, 0x43, 0xE5, + // Bytes b80 - bbf + 0xB0, 0xB8, 0x43, 0xE5, 0xB0, 0xBF, 0x43, 0xE5, + 0xB1, 0xA0, 0x43, 0xE5, 0xB1, 0xA2, 0x43, 0xE5, + 0xB1, 0xA4, 0x43, 0xE5, 0xB1, 0xA5, 0x43, 0xE5, + 0xB1, 0xAE, 0x43, 0xE5, 0xB1, 0xB1, 0x43, 0xE5, + 0xB2, 0x8D, 0x43, 0xE5, 0xB3, 0x80, 0x43, 0xE5, + 0xB4, 0x99, 0x43, 0xE5, 0xB5, 0x83, 0x43, 0xE5, + 0xB5, 0x90, 0x43, 0xE5, 0xB5, 0xAB, 0x43, 0xE5, + 0xB5, 0xAE, 0x43, 0xE5, 0xB5, 0xBC, 0x43, 0xE5, + // Bytes bc0 - bff + 0xB6, 0xB2, 0x43, 0xE5, 0xB6, 0xBA, 0x43, 0xE5, + 0xB7, 0x9B, 0x43, 0xE5, 0xB7, 0xA1, 0x43, 0xE5, + 0xB7, 0xA2, 0x43, 0xE5, 0xB7, 0xA5, 0x43, 0xE5, + 0xB7, 0xA6, 0x43, 0xE5, 0xB7, 0xB1, 0x43, 0xE5, + 0xB7, 0xBD, 0x43, 0xE5, 0xB7, 0xBE, 0x43, 0xE5, + 0xB8, 0xA8, 0x43, 0xE5, 0xB8, 0xBD, 0x43, 0xE5, + 0xB9, 0xA9, 0x43, 0xE5, 0xB9, 0xB2, 0x43, 0xE5, + 0xB9, 0xB4, 0x43, 0xE5, 0xB9, 0xBA, 0x43, 0xE5, + // Bytes c00 - c3f + 0xB9, 0xBC, 0x43, 0xE5, 0xB9, 0xBF, 0x43, 0xE5, + 0xBA, 0xA6, 0x43, 0xE5, 0xBA, 0xB0, 0x43, 0xE5, + 0xBA, 0xB3, 0x43, 0xE5, 0xBA, 0xB6, 0x43, 0xE5, + 0xBB, 0x89, 0x43, 0xE5, 0xBB, 0x8A, 0x43, 0xE5, + 0xBB, 0x92, 0x43, 0xE5, 0xBB, 0x93, 0x43, 0xE5, + 0xBB, 0x99, 0x43, 0xE5, 0xBB, 0xAC, 0x43, 0xE5, + 0xBB, 0xB4, 0x43, 0xE5, 0xBB, 0xBE, 0x43, 0xE5, + 0xBC, 0x84, 0x43, 0xE5, 0xBC, 0x8B, 0x43, 0xE5, + // Bytes c40 - c7f + 0xBC, 0x93, 0x43, 0xE5, 0xBC, 0xA2, 0x43, 0xE5, + 0xBD, 0x90, 0x43, 0xE5, 0xBD, 0x93, 0x43, 0xE5, + 0xBD, 0xA1, 0x43, 0xE5, 0xBD, 0xA2, 0x43, 0xE5, + 0xBD, 0xA9, 0x43, 0xE5, 0xBD, 0xAB, 0x43, 0xE5, + 0xBD, 0xB3, 0x43, 0xE5, 0xBE, 0x8B, 0x43, 0xE5, + 0xBE, 0x8C, 0x43, 0xE5, 0xBE, 0x97, 0x43, 0xE5, + 0xBE, 0x9A, 0x43, 0xE5, 0xBE, 0xA9, 0x43, 0xE5, + 0xBE, 0xAD, 0x43, 0xE5, 0xBF, 0x83, 0x43, 0xE5, + // Bytes c80 - cbf + 0xBF, 0x8D, 0x43, 0xE5, 0xBF, 0x97, 0x43, 0xE5, + 0xBF, 0xB5, 0x43, 0xE5, 0xBF, 0xB9, 0x43, 0xE6, + 0x80, 0x92, 0x43, 0xE6, 0x80, 0x9C, 0x43, 0xE6, + 0x81, 0xB5, 0x43, 0xE6, 0x82, 0x81, 0x43, 0xE6, + 0x82, 0x94, 0x43, 0xE6, 0x83, 0x87, 0x43, 0xE6, + 0x83, 0x98, 0x43, 0xE6, 0x83, 0xA1, 0x43, 0xE6, + 0x84, 0x88, 0x43, 0xE6, 0x85, 0x84, 0x43, 0xE6, + 0x85, 0x88, 0x43, 0xE6, 0x85, 0x8C, 0x43, 0xE6, + // Bytes cc0 - cff + 0x85, 0x8E, 0x43, 0xE6, 0x85, 0xA0, 0x43, 0xE6, + 0x85, 0xA8, 0x43, 0xE6, 0x85, 0xBA, 0x43, 0xE6, + 0x86, 0x8E, 0x43, 0xE6, 0x86, 0x90, 0x43, 0xE6, + 0x86, 0xA4, 0x43, 0xE6, 0x86, 0xAF, 0x43, 0xE6, + 0x86, 0xB2, 0x43, 0xE6, 0x87, 0x9E, 0x43, 0xE6, + 0x87, 0xB2, 0x43, 0xE6, 0x87, 0xB6, 0x43, 0xE6, + 0x88, 0x80, 0x43, 0xE6, 0x88, 0x88, 0x43, 0xE6, + 0x88, 0x90, 0x43, 0xE6, 0x88, 0x9B, 0x43, 0xE6, + // Bytes d00 - d3f + 0x88, 0xAE, 0x43, 0xE6, 0x88, 0xB4, 0x43, 0xE6, + 0x88, 0xB6, 0x43, 0xE6, 0x89, 0x8B, 0x43, 0xE6, + 0x89, 0x93, 0x43, 0xE6, 0x89, 0x9D, 0x43, 0xE6, + 0x8A, 0x95, 0x43, 0xE6, 0x8A, 0xB1, 0x43, 0xE6, + 0x8B, 0x89, 0x43, 0xE6, 0x8B, 0x8F, 0x43, 0xE6, + 0x8B, 0x93, 0x43, 0xE6, 0x8B, 0x94, 0x43, 0xE6, + 0x8B, 0xBC, 0x43, 0xE6, 0x8B, 0xBE, 0x43, 0xE6, + 0x8C, 0x87, 0x43, 0xE6, 0x8C, 0xBD, 0x43, 0xE6, + // Bytes d40 - d7f + 0x8D, 0x90, 0x43, 0xE6, 0x8D, 0x95, 0x43, 0xE6, + 0x8D, 0xA8, 0x43, 0xE6, 0x8D, 0xBB, 0x43, 0xE6, + 0x8E, 0x83, 0x43, 0xE6, 0x8E, 0xA0, 0x43, 0xE6, + 0x8E, 0xA9, 0x43, 0xE6, 0x8F, 0x84, 0x43, 0xE6, + 0x8F, 0x85, 0x43, 0xE6, 0x8F, 0xA4, 0x43, 0xE6, + 0x90, 0x9C, 0x43, 0xE6, 0x90, 0xA2, 0x43, 0xE6, + 0x91, 0x92, 0x43, 0xE6, 0x91, 0xA9, 0x43, 0xE6, + 0x91, 0xB7, 0x43, 0xE6, 0x91, 0xBE, 0x43, 0xE6, + // Bytes d80 - dbf + 0x92, 0x9A, 0x43, 0xE6, 0x92, 0x9D, 0x43, 0xE6, + 0x93, 0x84, 0x43, 0xE6, 0x94, 0xAF, 0x43, 0xE6, + 0x94, 0xB4, 0x43, 0xE6, 0x95, 0x8F, 0x43, 0xE6, + 0x95, 0x96, 0x43, 0xE6, 0x95, 0xAC, 0x43, 0xE6, + 0x95, 0xB8, 0x43, 0xE6, 0x96, 0x87, 0x43, 0xE6, + 0x96, 0x97, 0x43, 0xE6, 0x96, 0x99, 0x43, 0xE6, + 0x96, 0xA4, 0x43, 0xE6, 0x96, 0xB0, 0x43, 0xE6, + 0x96, 0xB9, 0x43, 0xE6, 0x97, 0x85, 0x43, 0xE6, + // Bytes dc0 - dff + 0x97, 0xA0, 0x43, 0xE6, 0x97, 0xA2, 0x43, 0xE6, + 0x97, 0xA3, 0x43, 0xE6, 0x97, 0xA5, 0x43, 0xE6, + 0x98, 0x93, 0x43, 0xE6, 0x98, 0xA0, 0x43, 0xE6, + 0x99, 0x89, 0x43, 0xE6, 0x99, 0xB4, 0x43, 0xE6, + 0x9A, 0x88, 0x43, 0xE6, 0x9A, 0x91, 0x43, 0xE6, + 0x9A, 0x9C, 0x43, 0xE6, 0x9A, 0xB4, 0x43, 0xE6, + 0x9B, 0x86, 0x43, 0xE6, 0x9B, 0xB0, 0x43, 0xE6, + 0x9B, 0xB4, 0x43, 0xE6, 0x9B, 0xB8, 0x43, 0xE6, + // Bytes e00 - e3f + 0x9C, 0x80, 0x43, 0xE6, 0x9C, 0x88, 0x43, 0xE6, + 0x9C, 0x89, 0x43, 0xE6, 0x9C, 0x97, 0x43, 0xE6, + 0x9C, 0x9B, 0x43, 0xE6, 0x9C, 0xA1, 0x43, 0xE6, + 0x9C, 0xA8, 0x43, 0xE6, 0x9D, 0x8E, 0x43, 0xE6, + 0x9D, 0x93, 0x43, 0xE6, 0x9D, 0x96, 0x43, 0xE6, + 0x9D, 0x9E, 0x43, 0xE6, 0x9D, 0xBB, 0x43, 0xE6, + 0x9E, 0x85, 0x43, 0xE6, 0x9E, 0x97, 0x43, 0xE6, + 0x9F, 0xB3, 0x43, 0xE6, 0x9F, 0xBA, 0x43, 0xE6, + // Bytes e40 - e7f + 0xA0, 0x97, 0x43, 0xE6, 0xA0, 0x9F, 0x43, 0xE6, + 0xA0, 0xAA, 0x43, 0xE6, 0xA1, 0x92, 0x43, 0xE6, + 0xA2, 0x81, 0x43, 0xE6, 0xA2, 0x85, 0x43, 0xE6, + 0xA2, 0x8E, 0x43, 0xE6, 0xA2, 0xA8, 0x43, 0xE6, + 0xA4, 0x94, 0x43, 0xE6, 0xA5, 0x82, 0x43, 0xE6, + 0xA6, 0xA3, 0x43, 0xE6, 0xA7, 0xAA, 0x43, 0xE6, + 0xA8, 0x82, 0x43, 0xE6, 0xA8, 0x93, 0x43, 0xE6, + 0xAA, 0xA8, 0x43, 0xE6, 0xAB, 0x93, 0x43, 0xE6, + // Bytes e80 - ebf + 0xAB, 0x9B, 0x43, 0xE6, 0xAC, 0x84, 0x43, 0xE6, + 0xAC, 0xA0, 0x43, 0xE6, 0xAC, 0xA1, 0x43, 0xE6, + 0xAD, 0x94, 0x43, 0xE6, 0xAD, 0xA2, 0x43, 0xE6, + 0xAD, 0xA3, 0x43, 0xE6, 0xAD, 0xB2, 0x43, 0xE6, + 0xAD, 0xB7, 0x43, 0xE6, 0xAD, 0xB9, 0x43, 0xE6, + 0xAE, 0x9F, 0x43, 0xE6, 0xAE, 0xAE, 0x43, 0xE6, + 0xAE, 0xB3, 0x43, 0xE6, 0xAE, 0xBA, 0x43, 0xE6, + 0xAE, 0xBB, 0x43, 0xE6, 0xAF, 0x8B, 0x43, 0xE6, + // Bytes ec0 - eff + 0xAF, 0x8D, 0x43, 0xE6, 0xAF, 0x94, 0x43, 0xE6, + 0xAF, 0x9B, 0x43, 0xE6, 0xB0, 0x8F, 0x43, 0xE6, + 0xB0, 0x94, 0x43, 0xE6, 0xB0, 0xB4, 0x43, 0xE6, + 0xB1, 0x8E, 0x43, 0xE6, 0xB1, 0xA7, 0x43, 0xE6, + 0xB2, 0x88, 0x43, 0xE6, 0xB2, 0xBF, 0x43, 0xE6, + 0xB3, 0x8C, 0x43, 0xE6, 0xB3, 0x8D, 0x43, 0xE6, + 0xB3, 0xA5, 0x43, 0xE6, 0xB3, 0xA8, 0x43, 0xE6, + 0xB4, 0x96, 0x43, 0xE6, 0xB4, 0x9B, 0x43, 0xE6, + // Bytes f00 - f3f + 0xB4, 0x9E, 0x43, 0xE6, 0xB4, 0xB4, 0x43, 0xE6, + 0xB4, 0xBE, 0x43, 0xE6, 0xB5, 0x81, 0x43, 0xE6, + 0xB5, 0xA9, 0x43, 0xE6, 0xB5, 0xAA, 0x43, 0xE6, + 0xB5, 0xB7, 0x43, 0xE6, 0xB5, 0xB8, 0x43, 0xE6, + 0xB6, 0x85, 0x43, 0xE6, 0xB7, 0x8B, 0x43, 0xE6, + 0xB7, 0x9A, 0x43, 0xE6, 0xB7, 0xAA, 0x43, 0xE6, + 0xB7, 0xB9, 0x43, 0xE6, 0xB8, 0x9A, 0x43, 0xE6, + 0xB8, 0xAF, 0x43, 0xE6, 0xB9, 0xAE, 0x43, 0xE6, + // Bytes f40 - f7f + 0xBA, 0x80, 0x43, 0xE6, 0xBA, 0x9C, 0x43, 0xE6, + 0xBA, 0xBA, 0x43, 0xE6, 0xBB, 0x87, 0x43, 0xE6, + 0xBB, 0x8B, 0x43, 0xE6, 0xBB, 0x91, 0x43, 0xE6, + 0xBB, 0x9B, 0x43, 0xE6, 0xBC, 0x8F, 0x43, 0xE6, + 0xBC, 0x94, 0x43, 0xE6, 0xBC, 0xA2, 0x43, 0xE6, + 0xBC, 0xA3, 0x43, 0xE6, 0xBD, 0xAE, 0x43, 0xE6, + 0xBF, 0x86, 0x43, 0xE6, 0xBF, 0xAB, 0x43, 0xE6, + 0xBF, 0xBE, 0x43, 0xE7, 0x80, 0x9B, 0x43, 0xE7, + // Bytes f80 - fbf + 0x80, 0x9E, 0x43, 0xE7, 0x80, 0xB9, 0x43, 0xE7, + 0x81, 0x8A, 0x43, 0xE7, 0x81, 0xAB, 0x43, 0xE7, + 0x81, 0xB0, 0x43, 0xE7, 0x81, 0xB7, 0x43, 0xE7, + 0x81, 0xBD, 0x43, 0xE7, 0x82, 0x99, 0x43, 0xE7, + 0x82, 0xAD, 0x43, 0xE7, 0x83, 0x88, 0x43, 0xE7, + 0x83, 0x99, 0x43, 0xE7, 0x84, 0xA1, 0x43, 0xE7, + 0x85, 0x85, 0x43, 0xE7, 0x85, 0x89, 0x43, 0xE7, + 0x85, 0xAE, 0x43, 0xE7, 0x86, 0x9C, 0x43, 0xE7, + // Bytes fc0 - fff + 0x87, 0x8E, 0x43, 0xE7, 0x87, 0x90, 0x43, 0xE7, + 0x88, 0x90, 0x43, 0xE7, 0x88, 0x9B, 0x43, 0xE7, + 0x88, 0xA8, 0x43, 0xE7, 0x88, 0xAA, 0x43, 0xE7, + 0x88, 0xAB, 0x43, 0xE7, 0x88, 0xB5, 0x43, 0xE7, + 0x88, 0xB6, 0x43, 0xE7, 0x88, 0xBB, 0x43, 0xE7, + 0x88, 0xBF, 0x43, 0xE7, 0x89, 0x87, 0x43, 0xE7, + 0x89, 0x90, 0x43, 0xE7, 0x89, 0x99, 0x43, 0xE7, + 0x89, 0x9B, 0x43, 0xE7, 0x89, 0xA2, 0x43, 0xE7, + // Bytes 1000 - 103f + 0x89, 0xB9, 0x43, 0xE7, 0x8A, 0x80, 0x43, 0xE7, + 0x8A, 0x95, 0x43, 0xE7, 0x8A, 0xAC, 0x43, 0xE7, + 0x8A, 0xAF, 0x43, 0xE7, 0x8B, 0x80, 0x43, 0xE7, + 0x8B, 0xBC, 0x43, 0xE7, 0x8C, 0xAA, 0x43, 0xE7, + 0x8D, 0xB5, 0x43, 0xE7, 0x8D, 0xBA, 0x43, 0xE7, + 0x8E, 0x84, 0x43, 0xE7, 0x8E, 0x87, 0x43, 0xE7, + 0x8E, 0x89, 0x43, 0xE7, 0x8E, 0x8B, 0x43, 0xE7, + 0x8E, 0xA5, 0x43, 0xE7, 0x8E, 0xB2, 0x43, 0xE7, + // Bytes 1040 - 107f + 0x8F, 0x9E, 0x43, 0xE7, 0x90, 0x86, 0x43, 0xE7, + 0x90, 0x89, 0x43, 0xE7, 0x90, 0xA2, 0x43, 0xE7, + 0x91, 0x87, 0x43, 0xE7, 0x91, 0x9C, 0x43, 0xE7, + 0x91, 0xA9, 0x43, 0xE7, 0x91, 0xB1, 0x43, 0xE7, + 0x92, 0x85, 0x43, 0xE7, 0x92, 0x89, 0x43, 0xE7, + 0x92, 0x98, 0x43, 0xE7, 0x93, 0x8A, 0x43, 0xE7, + 0x93, 0x9C, 0x43, 0xE7, 0x93, 0xA6, 0x43, 0xE7, + 0x94, 0x86, 0x43, 0xE7, 0x94, 0x98, 0x43, 0xE7, + // Bytes 1080 - 10bf + 0x94, 0x9F, 0x43, 0xE7, 0x94, 0xA4, 0x43, 0xE7, + 0x94, 0xA8, 0x43, 0xE7, 0x94, 0xB0, 0x43, 0xE7, + 0x94, 0xB2, 0x43, 0xE7, 0x94, 0xB3, 0x43, 0xE7, + 0x94, 0xB7, 0x43, 0xE7, 0x94, 0xBB, 0x43, 0xE7, + 0x94, 0xBE, 0x43, 0xE7, 0x95, 0x99, 0x43, 0xE7, + 0x95, 0xA5, 0x43, 0xE7, 0x95, 0xB0, 0x43, 0xE7, + 0x96, 0x8B, 0x43, 0xE7, 0x96, 0x92, 0x43, 0xE7, + 0x97, 0xA2, 0x43, 0xE7, 0x98, 0x90, 0x43, 0xE7, + // Bytes 10c0 - 10ff + 0x98, 0x9D, 0x43, 0xE7, 0x98, 0x9F, 0x43, 0xE7, + 0x99, 0x82, 0x43, 0xE7, 0x99, 0xA9, 0x43, 0xE7, + 0x99, 0xB6, 0x43, 0xE7, 0x99, 0xBD, 0x43, 0xE7, + 0x9A, 0xAE, 0x43, 0xE7, 0x9A, 0xBF, 0x43, 0xE7, + 0x9B, 0x8A, 0x43, 0xE7, 0x9B, 0x9B, 0x43, 0xE7, + 0x9B, 0xA3, 0x43, 0xE7, 0x9B, 0xA7, 0x43, 0xE7, + 0x9B, 0xAE, 0x43, 0xE7, 0x9B, 0xB4, 0x43, 0xE7, + 0x9C, 0x81, 0x43, 0xE7, 0x9C, 0x9E, 0x43, 0xE7, + // Bytes 1100 - 113f + 0x9C, 0x9F, 0x43, 0xE7, 0x9D, 0x80, 0x43, 0xE7, + 0x9D, 0x8A, 0x43, 0xE7, 0x9E, 0x8B, 0x43, 0xE7, + 0x9E, 0xA7, 0x43, 0xE7, 0x9F, 0x9B, 0x43, 0xE7, + 0x9F, 0xA2, 0x43, 0xE7, 0x9F, 0xB3, 0x43, 0xE7, + 0xA1, 0x8E, 0x43, 0xE7, 0xA1, 0xAB, 0x43, 0xE7, + 0xA2, 0x8C, 0x43, 0xE7, 0xA2, 0x91, 0x43, 0xE7, + 0xA3, 0x8A, 0x43, 0xE7, 0xA3, 0x8C, 0x43, 0xE7, + 0xA3, 0xBB, 0x43, 0xE7, 0xA4, 0xAA, 0x43, 0xE7, + // Bytes 1140 - 117f + 0xA4, 0xBA, 0x43, 0xE7, 0xA4, 0xBC, 0x43, 0xE7, + 0xA4, 0xBE, 0x43, 0xE7, 0xA5, 0x88, 0x43, 0xE7, + 0xA5, 0x89, 0x43, 0xE7, 0xA5, 0x90, 0x43, 0xE7, + 0xA5, 0x96, 0x43, 0xE7, 0xA5, 0x9D, 0x43, 0xE7, + 0xA5, 0x9E, 0x43, 0xE7, 0xA5, 0xA5, 0x43, 0xE7, + 0xA5, 0xBF, 0x43, 0xE7, 0xA6, 0x81, 0x43, 0xE7, + 0xA6, 0x8D, 0x43, 0xE7, 0xA6, 0x8E, 0x43, 0xE7, + 0xA6, 0x8F, 0x43, 0xE7, 0xA6, 0xAE, 0x43, 0xE7, + // Bytes 1180 - 11bf + 0xA6, 0xB8, 0x43, 0xE7, 0xA6, 0xBE, 0x43, 0xE7, + 0xA7, 0x8A, 0x43, 0xE7, 0xA7, 0x98, 0x43, 0xE7, + 0xA7, 0xAB, 0x43, 0xE7, 0xA8, 0x9C, 0x43, 0xE7, + 0xA9, 0x80, 0x43, 0xE7, 0xA9, 0x8A, 0x43, 0xE7, + 0xA9, 0x8F, 0x43, 0xE7, 0xA9, 0xB4, 0x43, 0xE7, + 0xA9, 0xBA, 0x43, 0xE7, 0xAA, 0x81, 0x43, 0xE7, + 0xAA, 0xB1, 0x43, 0xE7, 0xAB, 0x8B, 0x43, 0xE7, + 0xAB, 0xAE, 0x43, 0xE7, 0xAB, 0xB9, 0x43, 0xE7, + // Bytes 11c0 - 11ff + 0xAC, 0xA0, 0x43, 0xE7, 0xAE, 0x8F, 0x43, 0xE7, + 0xAF, 0x80, 0x43, 0xE7, 0xAF, 0x86, 0x43, 0xE7, + 0xAF, 0x89, 0x43, 0xE7, 0xB0, 0xBE, 0x43, 0xE7, + 0xB1, 0xA0, 0x43, 0xE7, 0xB1, 0xB3, 0x43, 0xE7, + 0xB1, 0xBB, 0x43, 0xE7, 0xB2, 0x92, 0x43, 0xE7, + 0xB2, 0xBE, 0x43, 0xE7, 0xB3, 0x92, 0x43, 0xE7, + 0xB3, 0x96, 0x43, 0xE7, 0xB3, 0xA3, 0x43, 0xE7, + 0xB3, 0xA7, 0x43, 0xE7, 0xB3, 0xA8, 0x43, 0xE7, + // Bytes 1200 - 123f + 0xB3, 0xB8, 0x43, 0xE7, 0xB4, 0x80, 0x43, 0xE7, + 0xB4, 0x90, 0x43, 0xE7, 0xB4, 0xA2, 0x43, 0xE7, + 0xB4, 0xAF, 0x43, 0xE7, 0xB5, 0x82, 0x43, 0xE7, + 0xB5, 0x9B, 0x43, 0xE7, 0xB5, 0xA3, 0x43, 0xE7, + 0xB6, 0xA0, 0x43, 0xE7, 0xB6, 0xBE, 0x43, 0xE7, + 0xB7, 0x87, 0x43, 0xE7, 0xB7, 0xB4, 0x43, 0xE7, + 0xB8, 0x82, 0x43, 0xE7, 0xB8, 0x89, 0x43, 0xE7, + 0xB8, 0xB7, 0x43, 0xE7, 0xB9, 0x81, 0x43, 0xE7, + // Bytes 1240 - 127f + 0xB9, 0x85, 0x43, 0xE7, 0xBC, 0xB6, 0x43, 0xE7, + 0xBC, 0xBE, 0x43, 0xE7, 0xBD, 0x91, 0x43, 0xE7, + 0xBD, 0xB2, 0x43, 0xE7, 0xBD, 0xB9, 0x43, 0xE7, + 0xBD, 0xBA, 0x43, 0xE7, 0xBE, 0x85, 0x43, 0xE7, + 0xBE, 0x8A, 0x43, 0xE7, 0xBE, 0x95, 0x43, 0xE7, + 0xBE, 0x9A, 0x43, 0xE7, 0xBE, 0xBD, 0x43, 0xE7, + 0xBF, 0xBA, 0x43, 0xE8, 0x80, 0x81, 0x43, 0xE8, + 0x80, 0x85, 0x43, 0xE8, 0x80, 0x8C, 0x43, 0xE8, + // Bytes 1280 - 12bf + 0x80, 0x92, 0x43, 0xE8, 0x80, 0xB3, 0x43, 0xE8, + 0x81, 0x86, 0x43, 0xE8, 0x81, 0xA0, 0x43, 0xE8, + 0x81, 0xAF, 0x43, 0xE8, 0x81, 0xB0, 0x43, 0xE8, + 0x81, 0xBE, 0x43, 0xE8, 0x81, 0xBF, 0x43, 0xE8, + 0x82, 0x89, 0x43, 0xE8, 0x82, 0x8B, 0x43, 0xE8, + 0x82, 0xAD, 0x43, 0xE8, 0x82, 0xB2, 0x43, 0xE8, + 0x84, 0x83, 0x43, 0xE8, 0x84, 0xBE, 0x43, 0xE8, + 0x87, 0x98, 0x43, 0xE8, 0x87, 0xA3, 0x43, 0xE8, + // Bytes 12c0 - 12ff + 0x87, 0xA8, 0x43, 0xE8, 0x87, 0xAA, 0x43, 0xE8, + 0x87, 0xAD, 0x43, 0xE8, 0x87, 0xB3, 0x43, 0xE8, + 0x87, 0xBC, 0x43, 0xE8, 0x88, 0x81, 0x43, 0xE8, + 0x88, 0x84, 0x43, 0xE8, 0x88, 0x8C, 0x43, 0xE8, + 0x88, 0x98, 0x43, 0xE8, 0x88, 0x9B, 0x43, 0xE8, + 0x88, 0x9F, 0x43, 0xE8, 0x89, 0xAE, 0x43, 0xE8, + 0x89, 0xAF, 0x43, 0xE8, 0x89, 0xB2, 0x43, 0xE8, + 0x89, 0xB8, 0x43, 0xE8, 0x89, 0xB9, 0x43, 0xE8, + // Bytes 1300 - 133f + 0x8A, 0x8B, 0x43, 0xE8, 0x8A, 0x91, 0x43, 0xE8, + 0x8A, 0x9D, 0x43, 0xE8, 0x8A, 0xB1, 0x43, 0xE8, + 0x8A, 0xB3, 0x43, 0xE8, 0x8A, 0xBD, 0x43, 0xE8, + 0x8B, 0xA5, 0x43, 0xE8, 0x8B, 0xA6, 0x43, 0xE8, + 0x8C, 0x9D, 0x43, 0xE8, 0x8C, 0xA3, 0x43, 0xE8, + 0x8C, 0xB6, 0x43, 0xE8, 0x8D, 0x92, 0x43, 0xE8, + 0x8D, 0x93, 0x43, 0xE8, 0x8D, 0xA3, 0x43, 0xE8, + 0x8E, 0xAD, 0x43, 0xE8, 0x8E, 0xBD, 0x43, 0xE8, + // Bytes 1340 - 137f + 0x8F, 0x89, 0x43, 0xE8, 0x8F, 0x8A, 0x43, 0xE8, + 0x8F, 0x8C, 0x43, 0xE8, 0x8F, 0x9C, 0x43, 0xE8, + 0x8F, 0xA7, 0x43, 0xE8, 0x8F, 0xAF, 0x43, 0xE8, + 0x8F, 0xB1, 0x43, 0xE8, 0x90, 0xBD, 0x43, 0xE8, + 0x91, 0x89, 0x43, 0xE8, 0x91, 0x97, 0x43, 0xE8, + 0x93, 0xAE, 0x43, 0xE8, 0x93, 0xB1, 0x43, 0xE8, + 0x93, 0xB3, 0x43, 0xE8, 0x93, 0xBC, 0x43, 0xE8, + 0x94, 0x96, 0x43, 0xE8, 0x95, 0xA4, 0x43, 0xE8, + // Bytes 1380 - 13bf + 0x97, 0x8D, 0x43, 0xE8, 0x97, 0xBA, 0x43, 0xE8, + 0x98, 0x86, 0x43, 0xE8, 0x98, 0x92, 0x43, 0xE8, + 0x98, 0xAD, 0x43, 0xE8, 0x98, 0xBF, 0x43, 0xE8, + 0x99, 0x8D, 0x43, 0xE8, 0x99, 0x90, 0x43, 0xE8, + 0x99, 0x9C, 0x43, 0xE8, 0x99, 0xA7, 0x43, 0xE8, + 0x99, 0xA9, 0x43, 0xE8, 0x99, 0xAB, 0x43, 0xE8, + 0x9A, 0x88, 0x43, 0xE8, 0x9A, 0xA9, 0x43, 0xE8, + 0x9B, 0xA2, 0x43, 0xE8, 0x9C, 0x8E, 0x43, 0xE8, + // Bytes 13c0 - 13ff + 0x9C, 0xA8, 0x43, 0xE8, 0x9D, 0xAB, 0x43, 0xE8, + 0x9D, 0xB9, 0x43, 0xE8, 0x9E, 0x86, 0x43, 0xE8, + 0x9E, 0xBA, 0x43, 0xE8, 0x9F, 0xA1, 0x43, 0xE8, + 0xA0, 0x81, 0x43, 0xE8, 0xA0, 0x9F, 0x43, 0xE8, + 0xA1, 0x80, 0x43, 0xE8, 0xA1, 0x8C, 0x43, 0xE8, + 0xA1, 0xA0, 0x43, 0xE8, 0xA1, 0xA3, 0x43, 0xE8, + 0xA3, 0x82, 0x43, 0xE8, 0xA3, 0x8F, 0x43, 0xE8, + 0xA3, 0x97, 0x43, 0xE8, 0xA3, 0x9E, 0x43, 0xE8, + // Bytes 1400 - 143f + 0xA3, 0xA1, 0x43, 0xE8, 0xA3, 0xB8, 0x43, 0xE8, + 0xA3, 0xBA, 0x43, 0xE8, 0xA4, 0x90, 0x43, 0xE8, + 0xA5, 0x81, 0x43, 0xE8, 0xA5, 0xA4, 0x43, 0xE8, + 0xA5, 0xBE, 0x43, 0xE8, 0xA6, 0x86, 0x43, 0xE8, + 0xA6, 0x8B, 0x43, 0xE8, 0xA6, 0x96, 0x43, 0xE8, + 0xA7, 0x92, 0x43, 0xE8, 0xA7, 0xA3, 0x43, 0xE8, + 0xA8, 0x80, 0x43, 0xE8, 0xAA, 0xA0, 0x43, 0xE8, + 0xAA, 0xAA, 0x43, 0xE8, 0xAA, 0xBF, 0x43, 0xE8, + // Bytes 1440 - 147f + 0xAB, 0x8B, 0x43, 0xE8, 0xAB, 0x92, 0x43, 0xE8, + 0xAB, 0x96, 0x43, 0xE8, 0xAB, 0xAD, 0x43, 0xE8, + 0xAB, 0xB8, 0x43, 0xE8, 0xAB, 0xBE, 0x43, 0xE8, + 0xAC, 0x81, 0x43, 0xE8, 0xAC, 0xB9, 0x43, 0xE8, + 0xAD, 0x98, 0x43, 0xE8, 0xAE, 0x80, 0x43, 0xE8, + 0xAE, 0x8A, 0x43, 0xE8, 0xB0, 0xB7, 0x43, 0xE8, + 0xB1, 0x86, 0x43, 0xE8, 0xB1, 0x88, 0x43, 0xE8, + 0xB1, 0x95, 0x43, 0xE8, 0xB1, 0xB8, 0x43, 0xE8, + // Bytes 1480 - 14bf + 0xB2, 0x9D, 0x43, 0xE8, 0xB2, 0xA1, 0x43, 0xE8, + 0xB2, 0xA9, 0x43, 0xE8, 0xB2, 0xAB, 0x43, 0xE8, + 0xB3, 0x81, 0x43, 0xE8, 0xB3, 0x82, 0x43, 0xE8, + 0xB3, 0x87, 0x43, 0xE8, 0xB3, 0x88, 0x43, 0xE8, + 0xB3, 0x93, 0x43, 0xE8, 0xB4, 0x88, 0x43, 0xE8, + 0xB4, 0x9B, 0x43, 0xE8, 0xB5, 0xA4, 0x43, 0xE8, + 0xB5, 0xB0, 0x43, 0xE8, 0xB5, 0xB7, 0x43, 0xE8, + 0xB6, 0xB3, 0x43, 0xE8, 0xB6, 0xBC, 0x43, 0xE8, + // Bytes 14c0 - 14ff + 0xB7, 0x8B, 0x43, 0xE8, 0xB7, 0xAF, 0x43, 0xE8, + 0xB7, 0xB0, 0x43, 0xE8, 0xBA, 0xAB, 0x43, 0xE8, + 0xBB, 0x8A, 0x43, 0xE8, 0xBB, 0x94, 0x43, 0xE8, + 0xBC, 0xA6, 0x43, 0xE8, 0xBC, 0xAA, 0x43, 0xE8, + 0xBC, 0xB8, 0x43, 0xE8, 0xBC, 0xBB, 0x43, 0xE8, + 0xBD, 0xA2, 0x43, 0xE8, 0xBE, 0x9B, 0x43, 0xE8, + 0xBE, 0x9E, 0x43, 0xE8, 0xBE, 0xB0, 0x43, 0xE8, + 0xBE, 0xB5, 0x43, 0xE8, 0xBE, 0xB6, 0x43, 0xE9, + // Bytes 1500 - 153f + 0x80, 0xA3, 0x43, 0xE9, 0x80, 0xB8, 0x43, 0xE9, + 0x81, 0x8A, 0x43, 0xE9, 0x81, 0xA9, 0x43, 0xE9, + 0x81, 0xB2, 0x43, 0xE9, 0x81, 0xBC, 0x43, 0xE9, + 0x82, 0x8F, 0x43, 0xE9, 0x82, 0x91, 0x43, 0xE9, + 0x82, 0x94, 0x43, 0xE9, 0x83, 0x8E, 0x43, 0xE9, + 0x83, 0x9E, 0x43, 0xE9, 0x83, 0xB1, 0x43, 0xE9, + 0x83, 0xBD, 0x43, 0xE9, 0x84, 0x91, 0x43, 0xE9, + 0x84, 0x9B, 0x43, 0xE9, 0x85, 0x89, 0x43, 0xE9, + // Bytes 1540 - 157f + 0x85, 0x8D, 0x43, 0xE9, 0x85, 0xAA, 0x43, 0xE9, + 0x86, 0x99, 0x43, 0xE9, 0x86, 0xB4, 0x43, 0xE9, + 0x87, 0x86, 0x43, 0xE9, 0x87, 0x8C, 0x43, 0xE9, + 0x87, 0x8F, 0x43, 0xE9, 0x87, 0x91, 0x43, 0xE9, + 0x88, 0xB4, 0x43, 0xE9, 0x88, 0xB8, 0x43, 0xE9, + 0x89, 0xB6, 0x43, 0xE9, 0x89, 0xBC, 0x43, 0xE9, + 0x8B, 0x97, 0x43, 0xE9, 0x8B, 0x98, 0x43, 0xE9, + 0x8C, 0x84, 0x43, 0xE9, 0x8D, 0x8A, 0x43, 0xE9, + // Bytes 1580 - 15bf + 0x8F, 0xB9, 0x43, 0xE9, 0x90, 0x95, 0x43, 0xE9, + 0x95, 0xB7, 0x43, 0xE9, 0x96, 0x80, 0x43, 0xE9, + 0x96, 0x8B, 0x43, 0xE9, 0x96, 0xAD, 0x43, 0xE9, + 0x96, 0xB7, 0x43, 0xE9, 0x98, 0x9C, 0x43, 0xE9, + 0x98, 0xAE, 0x43, 0xE9, 0x99, 0x8B, 0x43, 0xE9, + 0x99, 0x8D, 0x43, 0xE9, 0x99, 0xB5, 0x43, 0xE9, + 0x99, 0xB8, 0x43, 0xE9, 0x99, 0xBC, 0x43, 0xE9, + 0x9A, 0x86, 0x43, 0xE9, 0x9A, 0xA3, 0x43, 0xE9, + // Bytes 15c0 - 15ff + 0x9A, 0xB6, 0x43, 0xE9, 0x9A, 0xB7, 0x43, 0xE9, + 0x9A, 0xB8, 0x43, 0xE9, 0x9A, 0xB9, 0x43, 0xE9, + 0x9B, 0x83, 0x43, 0xE9, 0x9B, 0xA2, 0x43, 0xE9, + 0x9B, 0xA3, 0x43, 0xE9, 0x9B, 0xA8, 0x43, 0xE9, + 0x9B, 0xB6, 0x43, 0xE9, 0x9B, 0xB7, 0x43, 0xE9, + 0x9C, 0xA3, 0x43, 0xE9, 0x9C, 0xB2, 0x43, 0xE9, + 0x9D, 0x88, 0x43, 0xE9, 0x9D, 0x91, 0x43, 0xE9, + 0x9D, 0x96, 0x43, 0xE9, 0x9D, 0x9E, 0x43, 0xE9, + // Bytes 1600 - 163f + 0x9D, 0xA2, 0x43, 0xE9, 0x9D, 0xA9, 0x43, 0xE9, + 0x9F, 0x8B, 0x43, 0xE9, 0x9F, 0x9B, 0x43, 0xE9, + 0x9F, 0xA0, 0x43, 0xE9, 0x9F, 0xAD, 0x43, 0xE9, + 0x9F, 0xB3, 0x43, 0xE9, 0x9F, 0xBF, 0x43, 0xE9, + 0xA0, 0x81, 0x43, 0xE9, 0xA0, 0x85, 0x43, 0xE9, + 0xA0, 0x8B, 0x43, 0xE9, 0xA0, 0x98, 0x43, 0xE9, + 0xA0, 0xA9, 0x43, 0xE9, 0xA0, 0xBB, 0x43, 0xE9, + 0xA1, 0x9E, 0x43, 0xE9, 0xA2, 0xA8, 0x43, 0xE9, + // Bytes 1640 - 167f + 0xA3, 0x9B, 0x43, 0xE9, 0xA3, 0x9F, 0x43, 0xE9, + 0xA3, 0xA2, 0x43, 0xE9, 0xA3, 0xAF, 0x43, 0xE9, + 0xA3, 0xBC, 0x43, 0xE9, 0xA4, 0xA8, 0x43, 0xE9, + 0xA4, 0xA9, 0x43, 0xE9, 0xA6, 0x96, 0x43, 0xE9, + 0xA6, 0x99, 0x43, 0xE9, 0xA6, 0xA7, 0x43, 0xE9, + 0xA6, 0xAC, 0x43, 0xE9, 0xA7, 0x82, 0x43, 0xE9, + 0xA7, 0xB1, 0x43, 0xE9, 0xA7, 0xBE, 0x43, 0xE9, + 0xA9, 0xAA, 0x43, 0xE9, 0xAA, 0xA8, 0x43, 0xE9, + // Bytes 1680 - 16bf + 0xAB, 0x98, 0x43, 0xE9, 0xAB, 0x9F, 0x43, 0xE9, + 0xAC, 0x92, 0x43, 0xE9, 0xAC, 0xA5, 0x43, 0xE9, + 0xAC, 0xAF, 0x43, 0xE9, 0xAC, 0xB2, 0x43, 0xE9, + 0xAC, 0xBC, 0x43, 0xE9, 0xAD, 0x9A, 0x43, 0xE9, + 0xAD, 0xAF, 0x43, 0xE9, 0xB1, 0x80, 0x43, 0xE9, + 0xB1, 0x97, 0x43, 0xE9, 0xB3, 0xA5, 0x43, 0xE9, + 0xB3, 0xBD, 0x43, 0xE9, 0xB5, 0xA7, 0x43, 0xE9, + 0xB6, 0xB4, 0x43, 0xE9, 0xB7, 0xBA, 0x43, 0xE9, + // Bytes 16c0 - 16ff + 0xB8, 0x9E, 0x43, 0xE9, 0xB9, 0xB5, 0x43, 0xE9, + 0xB9, 0xBF, 0x43, 0xE9, 0xBA, 0x97, 0x43, 0xE9, + 0xBA, 0x9F, 0x43, 0xE9, 0xBA, 0xA5, 0x43, 0xE9, + 0xBA, 0xBB, 0x43, 0xE9, 0xBB, 0x83, 0x43, 0xE9, + 0xBB, 0x8D, 0x43, 0xE9, 0xBB, 0x8E, 0x43, 0xE9, + 0xBB, 0x91, 0x43, 0xE9, 0xBB, 0xB9, 0x43, 0xE9, + 0xBB, 0xBD, 0x43, 0xE9, 0xBB, 0xBE, 0x43, 0xE9, + 0xBC, 0x85, 0x43, 0xE9, 0xBC, 0x8E, 0x43, 0xE9, + // Bytes 1700 - 173f + 0xBC, 0x8F, 0x43, 0xE9, 0xBC, 0x93, 0x43, 0xE9, + 0xBC, 0x96, 0x43, 0xE9, 0xBC, 0xA0, 0x43, 0xE9, + 0xBC, 0xBB, 0x43, 0xE9, 0xBD, 0x83, 0x43, 0xE9, + 0xBD, 0x8A, 0x43, 0xE9, 0xBD, 0x92, 0x43, 0xE9, + 0xBE, 0x8D, 0x43, 0xE9, 0xBE, 0x8E, 0x43, 0xE9, + 0xBE, 0x9C, 0x43, 0xE9, 0xBE, 0x9F, 0x43, 0xE9, + 0xBE, 0xA0, 0x43, 0xEA, 0x99, 0x91, 0x43, 0xEA, + 0x9A, 0x89, 0x43, 0xEA, 0x9C, 0xA7, 0x43, 0xEA, + // Bytes 1740 - 177f + 0x9D, 0xAF, 0x43, 0xEA, 0x9E, 0x8E, 0x43, 0xEA, + 0xAC, 0xB7, 0x43, 0xEA, 0xAD, 0x92, 0x43, 0xEA, + 0xAD, 0xA6, 0x43, 0xEA, 0xAD, 0xA7, 0x44, 0xF0, + 0x9D, 0xBC, 0x84, 0x44, 0xF0, 0x9D, 0xBC, 0x85, + 0x44, 0xF0, 0x9D, 0xBC, 0x86, 0x44, 0xF0, 0x9D, + 0xBC, 0x88, 0x44, 0xF0, 0x9D, 0xBC, 0x8A, 0x44, + 0xF0, 0x9D, 0xBC, 0x9E, 0x44, 0xF0, 0xA0, 0x84, + 0xA2, 0x44, 0xF0, 0xA0, 0x94, 0x9C, 0x44, 0xF0, + // Bytes 1780 - 17bf + 0xA0, 0x94, 0xA5, 0x44, 0xF0, 0xA0, 0x95, 0x8B, + 0x44, 0xF0, 0xA0, 0x98, 0xBA, 0x44, 0xF0, 0xA0, + 0xA0, 0x84, 0x44, 0xF0, 0xA0, 0xA3, 0x9E, 0x44, + 0xF0, 0xA0, 0xA8, 0xAC, 0x44, 0xF0, 0xA0, 0xAD, + 0xA3, 0x44, 0xF0, 0xA1, 0x93, 0xA4, 0x44, 0xF0, + 0xA1, 0x9A, 0xA8, 0x44, 0xF0, 0xA1, 0x9B, 0xAA, + 0x44, 0xF0, 0xA1, 0xA7, 0x88, 0x44, 0xF0, 0xA1, + 0xAC, 0x98, 0x44, 0xF0, 0xA1, 0xB4, 0x8B, 0x44, + // Bytes 17c0 - 17ff + 0xF0, 0xA1, 0xB7, 0xA4, 0x44, 0xF0, 0xA1, 0xB7, + 0xA6, 0x44, 0xF0, 0xA2, 0x86, 0x83, 0x44, 0xF0, + 0xA2, 0x86, 0x9F, 0x44, 0xF0, 0xA2, 0x8C, 0xB1, + 0x44, 0xF0, 0xA2, 0x9B, 0x94, 0x44, 0xF0, 0xA2, + 0xA1, 0x84, 0x44, 0xF0, 0xA2, 0xA1, 0x8A, 0x44, + 0xF0, 0xA2, 0xAC, 0x8C, 0x44, 0xF0, 0xA2, 0xAF, + 0xB1, 0x44, 0xF0, 0xA3, 0x80, 0x8A, 0x44, 0xF0, + 0xA3, 0x8A, 0xB8, 0x44, 0xF0, 0xA3, 0x8D, 0x9F, + // Bytes 1800 - 183f + 0x44, 0xF0, 0xA3, 0x8E, 0x93, 0x44, 0xF0, 0xA3, + 0x8E, 0x9C, 0x44, 0xF0, 0xA3, 0x8F, 0x83, 0x44, + 0xF0, 0xA3, 0x8F, 0x95, 0x44, 0xF0, 0xA3, 0x91, + 0xAD, 0x44, 0xF0, 0xA3, 0x9A, 0xA3, 0x44, 0xF0, + 0xA3, 0xA2, 0xA7, 0x44, 0xF0, 0xA3, 0xAA, 0x8D, + 0x44, 0xF0, 0xA3, 0xAB, 0xBA, 0x44, 0xF0, 0xA3, + 0xB2, 0xBC, 0x44, 0xF0, 0xA3, 0xB4, 0x9E, 0x44, + 0xF0, 0xA3, 0xBB, 0x91, 0x44, 0xF0, 0xA3, 0xBD, + // Bytes 1840 - 187f + 0x9E, 0x44, 0xF0, 0xA3, 0xBE, 0x8E, 0x44, 0xF0, + 0xA4, 0x89, 0xA3, 0x44, 0xF0, 0xA4, 0x8B, 0xAE, + 0x44, 0xF0, 0xA4, 0x8E, 0xAB, 0x44, 0xF0, 0xA4, + 0x98, 0x88, 0x44, 0xF0, 0xA4, 0x9C, 0xB5, 0x44, + 0xF0, 0xA4, 0xA0, 0x94, 0x44, 0xF0, 0xA4, 0xB0, + 0xB6, 0x44, 0xF0, 0xA4, 0xB2, 0x92, 0x44, 0xF0, + 0xA4, 0xBE, 0xA1, 0x44, 0xF0, 0xA4, 0xBE, 0xB8, + 0x44, 0xF0, 0xA5, 0x81, 0x84, 0x44, 0xF0, 0xA5, + // Bytes 1880 - 18bf + 0x83, 0xB2, 0x44, 0xF0, 0xA5, 0x83, 0xB3, 0x44, + 0xF0, 0xA5, 0x84, 0x99, 0x44, 0xF0, 0xA5, 0x84, + 0xB3, 0x44, 0xF0, 0xA5, 0x89, 0x89, 0x44, 0xF0, + 0xA5, 0x90, 0x9D, 0x44, 0xF0, 0xA5, 0x98, 0xA6, + 0x44, 0xF0, 0xA5, 0x9A, 0x9A, 0x44, 0xF0, 0xA5, + 0x9B, 0x85, 0x44, 0xF0, 0xA5, 0xA5, 0xBC, 0x44, + 0xF0, 0xA5, 0xAA, 0xA7, 0x44, 0xF0, 0xA5, 0xAE, + 0xAB, 0x44, 0xF0, 0xA5, 0xB2, 0x80, 0x44, 0xF0, + // Bytes 18c0 - 18ff + 0xA5, 0xB3, 0x90, 0x44, 0xF0, 0xA5, 0xBE, 0x86, + 0x44, 0xF0, 0xA6, 0x87, 0x9A, 0x44, 0xF0, 0xA6, + 0x88, 0xA8, 0x44, 0xF0, 0xA6, 0x89, 0x87, 0x44, + 0xF0, 0xA6, 0x8B, 0x99, 0x44, 0xF0, 0xA6, 0x8C, + 0xBE, 0x44, 0xF0, 0xA6, 0x93, 0x9A, 0x44, 0xF0, + 0xA6, 0x94, 0xA3, 0x44, 0xF0, 0xA6, 0x96, 0xA8, + 0x44, 0xF0, 0xA6, 0x9E, 0xA7, 0x44, 0xF0, 0xA6, + 0x9E, 0xB5, 0x44, 0xF0, 0xA6, 0xAC, 0xBC, 0x44, + // Bytes 1900 - 193f + 0xF0, 0xA6, 0xB0, 0xB6, 0x44, 0xF0, 0xA6, 0xB3, + 0x95, 0x44, 0xF0, 0xA6, 0xB5, 0xAB, 0x44, 0xF0, + 0xA6, 0xBC, 0xAC, 0x44, 0xF0, 0xA6, 0xBE, 0xB1, + 0x44, 0xF0, 0xA7, 0x83, 0x92, 0x44, 0xF0, 0xA7, + 0x8F, 0x8A, 0x44, 0xF0, 0xA7, 0x99, 0xA7, 0x44, + 0xF0, 0xA7, 0xA2, 0xAE, 0x44, 0xF0, 0xA7, 0xA5, + 0xA6, 0x44, 0xF0, 0xA7, 0xB2, 0xA8, 0x44, 0xF0, + 0xA7, 0xBB, 0x93, 0x44, 0xF0, 0xA7, 0xBC, 0xAF, + // Bytes 1940 - 197f + 0x44, 0xF0, 0xA8, 0x97, 0x92, 0x44, 0xF0, 0xA8, + 0x97, 0xAD, 0x44, 0xF0, 0xA8, 0x9C, 0xAE, 0x44, + 0xF0, 0xA8, 0xAF, 0xBA, 0x44, 0xF0, 0xA8, 0xB5, + 0xB7, 0x44, 0xF0, 0xA9, 0x85, 0x85, 0x44, 0xF0, + 0xA9, 0x87, 0x9F, 0x44, 0xF0, 0xA9, 0x88, 0x9A, + 0x44, 0xF0, 0xA9, 0x90, 0x8A, 0x44, 0xF0, 0xA9, + 0x92, 0x96, 0x44, 0xF0, 0xA9, 0x96, 0xB6, 0x44, + 0xF0, 0xA9, 0xAC, 0xB0, 0x44, 0xF0, 0xAA, 0x83, + // Bytes 1980 - 19bf + 0x8E, 0x44, 0xF0, 0xAA, 0x84, 0x85, 0x44, 0xF0, + 0xAA, 0x88, 0x8E, 0x44, 0xF0, 0xAA, 0x8A, 0x91, + 0x44, 0xF0, 0xAA, 0x8E, 0x92, 0x44, 0xF0, 0xAA, + 0x98, 0x80, 0x42, 0x21, 0x21, 0x42, 0x21, 0x3F, + 0x42, 0x2E, 0x2E, 0x42, 0x30, 0x2C, 0x42, 0x30, + 0x2E, 0x42, 0x31, 0x2C, 0x42, 0x31, 0x2E, 0x42, + 0x31, 0x30, 0x42, 0x31, 0x31, 0x42, 0x31, 0x32, + 0x42, 0x31, 0x33, 0x42, 0x31, 0x34, 0x42, 0x31, + // Bytes 19c0 - 19ff + 0x35, 0x42, 0x31, 0x36, 0x42, 0x31, 0x37, 0x42, + 0x31, 0x38, 0x42, 0x31, 0x39, 0x42, 0x32, 0x2C, + 0x42, 0x32, 0x2E, 0x42, 0x32, 0x30, 0x42, 0x32, + 0x31, 0x42, 0x32, 0x32, 0x42, 0x32, 0x33, 0x42, + 0x32, 0x34, 0x42, 0x32, 0x35, 0x42, 0x32, 0x36, + 0x42, 0x32, 0x37, 0x42, 0x32, 0x38, 0x42, 0x32, + 0x39, 0x42, 0x33, 0x2C, 0x42, 0x33, 0x2E, 0x42, + 0x33, 0x30, 0x42, 0x33, 0x31, 0x42, 0x33, 0x32, + // Bytes 1a00 - 1a3f + 0x42, 0x33, 0x33, 0x42, 0x33, 0x34, 0x42, 0x33, + 0x35, 0x42, 0x33, 0x36, 0x42, 0x33, 0x37, 0x42, + 0x33, 0x38, 0x42, 0x33, 0x39, 0x42, 0x34, 0x2C, + 0x42, 0x34, 0x2E, 0x42, 0x34, 0x30, 0x42, 0x34, + 0x31, 0x42, 0x34, 0x32, 0x42, 0x34, 0x33, 0x42, + 0x34, 0x34, 0x42, 0x34, 0x35, 0x42, 0x34, 0x36, + 0x42, 0x34, 0x37, 0x42, 0x34, 0x38, 0x42, 0x34, + 0x39, 0x42, 0x35, 0x2C, 0x42, 0x35, 0x2E, 0x42, + // Bytes 1a40 - 1a7f + 0x35, 0x30, 0x42, 0x36, 0x2C, 0x42, 0x36, 0x2E, + 0x42, 0x37, 0x2C, 0x42, 0x37, 0x2E, 0x42, 0x38, + 0x2C, 0x42, 0x38, 0x2E, 0x42, 0x39, 0x2C, 0x42, + 0x39, 0x2E, 0x42, 0x3D, 0x3D, 0x42, 0x3F, 0x21, + 0x42, 0x3F, 0x3F, 0x42, 0x41, 0x55, 0x42, 0x42, + 0x71, 0x42, 0x43, 0x44, 0x42, 0x44, 0x4A, 0x42, + 0x44, 0x5A, 0x42, 0x44, 0x7A, 0x42, 0x47, 0x42, + 0x42, 0x47, 0x79, 0x42, 0x48, 0x50, 0x42, 0x48, + // Bytes 1a80 - 1abf + 0x56, 0x42, 0x48, 0x67, 0x42, 0x48, 0x7A, 0x42, + 0x49, 0x49, 0x42, 0x49, 0x4A, 0x42, 0x49, 0x55, + 0x42, 0x49, 0x56, 0x42, 0x49, 0x58, 0x42, 0x4B, + 0x42, 0x42, 0x4B, 0x4B, 0x42, 0x4B, 0x4D, 0x42, + 0x4C, 0x4A, 0x42, 0x4C, 0x6A, 0x42, 0x4D, 0x42, + 0x42, 0x4D, 0x43, 0x42, 0x4D, 0x44, 0x42, 0x4D, + 0x52, 0x42, 0x4D, 0x56, 0x42, 0x4D, 0x57, 0x42, + 0x4E, 0x4A, 0x42, 0x4E, 0x6A, 0x42, 0x4E, 0x6F, + // Bytes 1ac0 - 1aff + 0x42, 0x50, 0x48, 0x42, 0x50, 0x52, 0x42, 0x50, + 0x61, 0x42, 0x52, 0x73, 0x42, 0x53, 0x44, 0x42, + 0x53, 0x4D, 0x42, 0x53, 0x53, 0x42, 0x53, 0x76, + 0x42, 0x54, 0x4D, 0x42, 0x56, 0x49, 0x42, 0x57, + 0x43, 0x42, 0x57, 0x5A, 0x42, 0x57, 0x62, 0x42, + 0x58, 0x49, 0x42, 0x63, 0x63, 0x42, 0x63, 0x64, + 0x42, 0x63, 0x6D, 0x42, 0x64, 0x42, 0x42, 0x64, + 0x61, 0x42, 0x64, 0x6C, 0x42, 0x64, 0x6D, 0x42, + // Bytes 1b00 - 1b3f + 0x64, 0x7A, 0x42, 0x65, 0x56, 0x42, 0x66, 0x66, + 0x42, 0x66, 0x69, 0x42, 0x66, 0x6C, 0x42, 0x66, + 0x6D, 0x42, 0x68, 0x61, 0x42, 0x69, 0x69, 0x42, + 0x69, 0x6A, 0x42, 0x69, 0x6E, 0x42, 0x69, 0x76, + 0x42, 0x69, 0x78, 0x42, 0x6B, 0x41, 0x42, 0x6B, + 0x56, 0x42, 0x6B, 0x57, 0x42, 0x6B, 0x67, 0x42, + 0x6B, 0x6C, 0x42, 0x6B, 0x6D, 0x42, 0x6B, 0x74, + 0x42, 0x6C, 0x6A, 0x42, 0x6C, 0x6D, 0x42, 0x6C, + // Bytes 1b40 - 1b7f + 0x6E, 0x42, 0x6C, 0x78, 0x42, 0x6D, 0x32, 0x42, + 0x6D, 0x33, 0x42, 0x6D, 0x41, 0x42, 0x6D, 0x56, + 0x42, 0x6D, 0x57, 0x42, 0x6D, 0x62, 0x42, 0x6D, + 0x67, 0x42, 0x6D, 0x6C, 0x42, 0x6D, 0x6D, 0x42, + 0x6D, 0x73, 0x42, 0x6E, 0x41, 0x42, 0x6E, 0x46, + 0x42, 0x6E, 0x56, 0x42, 0x6E, 0x57, 0x42, 0x6E, + 0x6A, 0x42, 0x6E, 0x6D, 0x42, 0x6E, 0x73, 0x42, + 0x6F, 0x56, 0x42, 0x70, 0x41, 0x42, 0x70, 0x46, + // Bytes 1b80 - 1bbf + 0x42, 0x70, 0x56, 0x42, 0x70, 0x57, 0x42, 0x70, + 0x63, 0x42, 0x70, 0x73, 0x42, 0x73, 0x72, 0x42, + 0x73, 0x74, 0x42, 0x76, 0x69, 0x42, 0x78, 0x69, + 0x43, 0x28, 0x31, 0x29, 0x43, 0x28, 0x32, 0x29, + 0x43, 0x28, 0x33, 0x29, 0x43, 0x28, 0x34, 0x29, + 0x43, 0x28, 0x35, 0x29, 0x43, 0x28, 0x36, 0x29, + 0x43, 0x28, 0x37, 0x29, 0x43, 0x28, 0x38, 0x29, + 0x43, 0x28, 0x39, 0x29, 0x43, 0x28, 0x41, 0x29, + // Bytes 1bc0 - 1bff + 0x43, 0x28, 0x42, 0x29, 0x43, 0x28, 0x43, 0x29, + 0x43, 0x28, 0x44, 0x29, 0x43, 0x28, 0x45, 0x29, + 0x43, 0x28, 0x46, 0x29, 0x43, 0x28, 0x47, 0x29, + 0x43, 0x28, 0x48, 0x29, 0x43, 0x28, 0x49, 0x29, + 0x43, 0x28, 0x4A, 0x29, 0x43, 0x28, 0x4B, 0x29, + 0x43, 0x28, 0x4C, 0x29, 0x43, 0x28, 0x4D, 0x29, + 0x43, 0x28, 0x4E, 0x29, 0x43, 0x28, 0x4F, 0x29, + 0x43, 0x28, 0x50, 0x29, 0x43, 0x28, 0x51, 0x29, + // Bytes 1c00 - 1c3f + 0x43, 0x28, 0x52, 0x29, 0x43, 0x28, 0x53, 0x29, + 0x43, 0x28, 0x54, 0x29, 0x43, 0x28, 0x55, 0x29, + 0x43, 0x28, 0x56, 0x29, 0x43, 0x28, 0x57, 0x29, + 0x43, 0x28, 0x58, 0x29, 0x43, 0x28, 0x59, 0x29, + 0x43, 0x28, 0x5A, 0x29, 0x43, 0x28, 0x61, 0x29, + 0x43, 0x28, 0x62, 0x29, 0x43, 0x28, 0x63, 0x29, + 0x43, 0x28, 0x64, 0x29, 0x43, 0x28, 0x65, 0x29, + 0x43, 0x28, 0x66, 0x29, 0x43, 0x28, 0x67, 0x29, + // Bytes 1c40 - 1c7f + 0x43, 0x28, 0x68, 0x29, 0x43, 0x28, 0x69, 0x29, + 0x43, 0x28, 0x6A, 0x29, 0x43, 0x28, 0x6B, 0x29, + 0x43, 0x28, 0x6C, 0x29, 0x43, 0x28, 0x6D, 0x29, + 0x43, 0x28, 0x6E, 0x29, 0x43, 0x28, 0x6F, 0x29, + 0x43, 0x28, 0x70, 0x29, 0x43, 0x28, 0x71, 0x29, + 0x43, 0x28, 0x72, 0x29, 0x43, 0x28, 0x73, 0x29, + 0x43, 0x28, 0x74, 0x29, 0x43, 0x28, 0x75, 0x29, + 0x43, 0x28, 0x76, 0x29, 0x43, 0x28, 0x77, 0x29, + // Bytes 1c80 - 1cbf + 0x43, 0x28, 0x78, 0x29, 0x43, 0x28, 0x79, 0x29, + 0x43, 0x28, 0x7A, 0x29, 0x43, 0x2E, 0x2E, 0x2E, + 0x43, 0x31, 0x30, 0x2E, 0x43, 0x31, 0x31, 0x2E, + 0x43, 0x31, 0x32, 0x2E, 0x43, 0x31, 0x33, 0x2E, + 0x43, 0x31, 0x34, 0x2E, 0x43, 0x31, 0x35, 0x2E, + 0x43, 0x31, 0x36, 0x2E, 0x43, 0x31, 0x37, 0x2E, + 0x43, 0x31, 0x38, 0x2E, 0x43, 0x31, 0x39, 0x2E, + 0x43, 0x32, 0x30, 0x2E, 0x43, 0x3A, 0x3A, 0x3D, + // Bytes 1cc0 - 1cff + 0x43, 0x3D, 0x3D, 0x3D, 0x43, 0x43, 0x6F, 0x2E, + 0x43, 0x46, 0x41, 0x58, 0x43, 0x47, 0x48, 0x7A, + 0x43, 0x47, 0x50, 0x61, 0x43, 0x49, 0x49, 0x49, + 0x43, 0x4C, 0x54, 0x44, 0x43, 0x4C, 0xC2, 0xB7, + 0x43, 0x4D, 0x48, 0x7A, 0x43, 0x4D, 0x50, 0x61, + 0x43, 0x4D, 0xCE, 0xA9, 0x43, 0x50, 0x50, 0x4D, + 0x43, 0x50, 0x50, 0x56, 0x43, 0x50, 0x54, 0x45, + 0x43, 0x54, 0x45, 0x4C, 0x43, 0x54, 0x48, 0x7A, + // Bytes 1d00 - 1d3f + 0x43, 0x56, 0x49, 0x49, 0x43, 0x58, 0x49, 0x49, + 0x43, 0x61, 0x2F, 0x63, 0x43, 0x61, 0x2F, 0x73, + 0x43, 0x61, 0xCA, 0xBE, 0x43, 0x62, 0x61, 0x72, + 0x43, 0x63, 0x2F, 0x6F, 0x43, 0x63, 0x2F, 0x75, + 0x43, 0x63, 0x61, 0x6C, 0x43, 0x63, 0x6D, 0x32, + 0x43, 0x63, 0x6D, 0x33, 0x43, 0x64, 0x6D, 0x32, + 0x43, 0x64, 0x6D, 0x33, 0x43, 0x65, 0x72, 0x67, + 0x43, 0x66, 0x66, 0x69, 0x43, 0x66, 0x66, 0x6C, + // Bytes 1d40 - 1d7f + 0x43, 0x67, 0x61, 0x6C, 0x43, 0x68, 0x50, 0x61, + 0x43, 0x69, 0x69, 0x69, 0x43, 0x6B, 0x48, 0x7A, + 0x43, 0x6B, 0x50, 0x61, 0x43, 0x6B, 0x6D, 0x32, + 0x43, 0x6B, 0x6D, 0x33, 0x43, 0x6B, 0xCE, 0xA9, + 0x43, 0x6C, 0x6F, 0x67, 0x43, 0x6C, 0xC2, 0xB7, + 0x43, 0x6D, 0x69, 0x6C, 0x43, 0x6D, 0x6D, 0x32, + 0x43, 0x6D, 0x6D, 0x33, 0x43, 0x6D, 0x6F, 0x6C, + 0x43, 0x72, 0x61, 0x64, 0x43, 0x76, 0x69, 0x69, + // Bytes 1d80 - 1dbf + 0x43, 0x78, 0x69, 0x69, 0x43, 0xC2, 0xB0, 0x43, + 0x43, 0xC2, 0xB0, 0x46, 0x43, 0xCA, 0xBC, 0x6E, + 0x43, 0xCE, 0xBC, 0x41, 0x43, 0xCE, 0xBC, 0x46, + 0x43, 0xCE, 0xBC, 0x56, 0x43, 0xCE, 0xBC, 0x57, + 0x43, 0xCE, 0xBC, 0x67, 0x43, 0xCE, 0xBC, 0x6C, + 0x43, 0xCE, 0xBC, 0x6D, 0x43, 0xCE, 0xBC, 0x73, + 0x44, 0x28, 0x31, 0x30, 0x29, 0x44, 0x28, 0x31, + 0x31, 0x29, 0x44, 0x28, 0x31, 0x32, 0x29, 0x44, + // Bytes 1dc0 - 1dff + 0x28, 0x31, 0x33, 0x29, 0x44, 0x28, 0x31, 0x34, + 0x29, 0x44, 0x28, 0x31, 0x35, 0x29, 0x44, 0x28, + 0x31, 0x36, 0x29, 0x44, 0x28, 0x31, 0x37, 0x29, + 0x44, 0x28, 0x31, 0x38, 0x29, 0x44, 0x28, 0x31, + 0x39, 0x29, 0x44, 0x28, 0x32, 0x30, 0x29, 0x44, + 0x30, 0xE7, 0x82, 0xB9, 0x44, 0x31, 0xE2, 0x81, + 0x84, 0x44, 0x31, 0xE6, 0x97, 0xA5, 0x44, 0x31, + 0xE6, 0x9C, 0x88, 0x44, 0x31, 0xE7, 0x82, 0xB9, + // Bytes 1e00 - 1e3f + 0x44, 0x32, 0xE6, 0x97, 0xA5, 0x44, 0x32, 0xE6, + 0x9C, 0x88, 0x44, 0x32, 0xE7, 0x82, 0xB9, 0x44, + 0x33, 0xE6, 0x97, 0xA5, 0x44, 0x33, 0xE6, 0x9C, + 0x88, 0x44, 0x33, 0xE7, 0x82, 0xB9, 0x44, 0x34, + 0xE6, 0x97, 0xA5, 0x44, 0x34, 0xE6, 0x9C, 0x88, + 0x44, 0x34, 0xE7, 0x82, 0xB9, 0x44, 0x35, 0xE6, + 0x97, 0xA5, 0x44, 0x35, 0xE6, 0x9C, 0x88, 0x44, + 0x35, 0xE7, 0x82, 0xB9, 0x44, 0x36, 0xE6, 0x97, + // Bytes 1e40 - 1e7f + 0xA5, 0x44, 0x36, 0xE6, 0x9C, 0x88, 0x44, 0x36, + 0xE7, 0x82, 0xB9, 0x44, 0x37, 0xE6, 0x97, 0xA5, + 0x44, 0x37, 0xE6, 0x9C, 0x88, 0x44, 0x37, 0xE7, + 0x82, 0xB9, 0x44, 0x38, 0xE6, 0x97, 0xA5, 0x44, + 0x38, 0xE6, 0x9C, 0x88, 0x44, 0x38, 0xE7, 0x82, + 0xB9, 0x44, 0x39, 0xE6, 0x97, 0xA5, 0x44, 0x39, + 0xE6, 0x9C, 0x88, 0x44, 0x39, 0xE7, 0x82, 0xB9, + 0x44, 0x56, 0x49, 0x49, 0x49, 0x44, 0x61, 0x2E, + // Bytes 1e80 - 1ebf + 0x6D, 0x2E, 0x44, 0x6B, 0x63, 0x61, 0x6C, 0x44, + 0x70, 0x2E, 0x6D, 0x2E, 0x44, 0x76, 0x69, 0x69, + 0x69, 0x44, 0xD5, 0xA5, 0xD6, 0x82, 0x44, 0xD5, + 0xB4, 0xD5, 0xA5, 0x44, 0xD5, 0xB4, 0xD5, 0xAB, + 0x44, 0xD5, 0xB4, 0xD5, 0xAD, 0x44, 0xD5, 0xB4, + 0xD5, 0xB6, 0x44, 0xD5, 0xBE, 0xD5, 0xB6, 0x44, + 0xD7, 0x90, 0xD7, 0x9C, 0x44, 0xD8, 0xA7, 0xD9, + 0xB4, 0x44, 0xD8, 0xA8, 0xD8, 0xAC, 0x44, 0xD8, + // Bytes 1ec0 - 1eff + 0xA8, 0xD8, 0xAD, 0x44, 0xD8, 0xA8, 0xD8, 0xAE, + 0x44, 0xD8, 0xA8, 0xD8, 0xB1, 0x44, 0xD8, 0xA8, + 0xD8, 0xB2, 0x44, 0xD8, 0xA8, 0xD9, 0x85, 0x44, + 0xD8, 0xA8, 0xD9, 0x86, 0x44, 0xD8, 0xA8, 0xD9, + 0x87, 0x44, 0xD8, 0xA8, 0xD9, 0x89, 0x44, 0xD8, + 0xA8, 0xD9, 0x8A, 0x44, 0xD8, 0xAA, 0xD8, 0xAC, + 0x44, 0xD8, 0xAA, 0xD8, 0xAD, 0x44, 0xD8, 0xAA, + 0xD8, 0xAE, 0x44, 0xD8, 0xAA, 0xD8, 0xB1, 0x44, + // Bytes 1f00 - 1f3f + 0xD8, 0xAA, 0xD8, 0xB2, 0x44, 0xD8, 0xAA, 0xD9, + 0x85, 0x44, 0xD8, 0xAA, 0xD9, 0x86, 0x44, 0xD8, + 0xAA, 0xD9, 0x87, 0x44, 0xD8, 0xAA, 0xD9, 0x89, + 0x44, 0xD8, 0xAA, 0xD9, 0x8A, 0x44, 0xD8, 0xAB, + 0xD8, 0xAC, 0x44, 0xD8, 0xAB, 0xD8, 0xB1, 0x44, + 0xD8, 0xAB, 0xD8, 0xB2, 0x44, 0xD8, 0xAB, 0xD9, + 0x85, 0x44, 0xD8, 0xAB, 0xD9, 0x86, 0x44, 0xD8, + 0xAB, 0xD9, 0x87, 0x44, 0xD8, 0xAB, 0xD9, 0x89, + // Bytes 1f40 - 1f7f + 0x44, 0xD8, 0xAB, 0xD9, 0x8A, 0x44, 0xD8, 0xAC, + 0xD8, 0xAD, 0x44, 0xD8, 0xAC, 0xD9, 0x85, 0x44, + 0xD8, 0xAC, 0xD9, 0x89, 0x44, 0xD8, 0xAC, 0xD9, + 0x8A, 0x44, 0xD8, 0xAD, 0xD8, 0xAC, 0x44, 0xD8, + 0xAD, 0xD9, 0x85, 0x44, 0xD8, 0xAD, 0xD9, 0x89, + 0x44, 0xD8, 0xAD, 0xD9, 0x8A, 0x44, 0xD8, 0xAE, + 0xD8, 0xAC, 0x44, 0xD8, 0xAE, 0xD8, 0xAD, 0x44, + 0xD8, 0xAE, 0xD9, 0x85, 0x44, 0xD8, 0xAE, 0xD9, + // Bytes 1f80 - 1fbf + 0x89, 0x44, 0xD8, 0xAE, 0xD9, 0x8A, 0x44, 0xD8, + 0xB3, 0xD8, 0xAC, 0x44, 0xD8, 0xB3, 0xD8, 0xAD, + 0x44, 0xD8, 0xB3, 0xD8, 0xAE, 0x44, 0xD8, 0xB3, + 0xD8, 0xB1, 0x44, 0xD8, 0xB3, 0xD9, 0x85, 0x44, + 0xD8, 0xB3, 0xD9, 0x87, 0x44, 0xD8, 0xB3, 0xD9, + 0x89, 0x44, 0xD8, 0xB3, 0xD9, 0x8A, 0x44, 0xD8, + 0xB4, 0xD8, 0xAC, 0x44, 0xD8, 0xB4, 0xD8, 0xAD, + 0x44, 0xD8, 0xB4, 0xD8, 0xAE, 0x44, 0xD8, 0xB4, + // Bytes 1fc0 - 1fff + 0xD8, 0xB1, 0x44, 0xD8, 0xB4, 0xD9, 0x85, 0x44, + 0xD8, 0xB4, 0xD9, 0x87, 0x44, 0xD8, 0xB4, 0xD9, + 0x89, 0x44, 0xD8, 0xB4, 0xD9, 0x8A, 0x44, 0xD8, + 0xB5, 0xD8, 0xAD, 0x44, 0xD8, 0xB5, 0xD8, 0xAE, + 0x44, 0xD8, 0xB5, 0xD8, 0xB1, 0x44, 0xD8, 0xB5, + 0xD9, 0x85, 0x44, 0xD8, 0xB5, 0xD9, 0x89, 0x44, + 0xD8, 0xB5, 0xD9, 0x8A, 0x44, 0xD8, 0xB6, 0xD8, + 0xAC, 0x44, 0xD8, 0xB6, 0xD8, 0xAD, 0x44, 0xD8, + // Bytes 2000 - 203f + 0xB6, 0xD8, 0xAE, 0x44, 0xD8, 0xB6, 0xD8, 0xB1, + 0x44, 0xD8, 0xB6, 0xD9, 0x85, 0x44, 0xD8, 0xB6, + 0xD9, 0x89, 0x44, 0xD8, 0xB6, 0xD9, 0x8A, 0x44, + 0xD8, 0xB7, 0xD8, 0xAD, 0x44, 0xD8, 0xB7, 0xD9, + 0x85, 0x44, 0xD8, 0xB7, 0xD9, 0x89, 0x44, 0xD8, + 0xB7, 0xD9, 0x8A, 0x44, 0xD8, 0xB8, 0xD9, 0x85, + 0x44, 0xD8, 0xB9, 0xD8, 0xAC, 0x44, 0xD8, 0xB9, + 0xD9, 0x85, 0x44, 0xD8, 0xB9, 0xD9, 0x89, 0x44, + // Bytes 2040 - 207f + 0xD8, 0xB9, 0xD9, 0x8A, 0x44, 0xD8, 0xBA, 0xD8, + 0xAC, 0x44, 0xD8, 0xBA, 0xD9, 0x85, 0x44, 0xD8, + 0xBA, 0xD9, 0x89, 0x44, 0xD8, 0xBA, 0xD9, 0x8A, + 0x44, 0xD9, 0x81, 0xD8, 0xAC, 0x44, 0xD9, 0x81, + 0xD8, 0xAD, 0x44, 0xD9, 0x81, 0xD8, 0xAE, 0x44, + 0xD9, 0x81, 0xD9, 0x85, 0x44, 0xD9, 0x81, 0xD9, + 0x89, 0x44, 0xD9, 0x81, 0xD9, 0x8A, 0x44, 0xD9, + 0x82, 0xD8, 0xAD, 0x44, 0xD9, 0x82, 0xD9, 0x85, + // Bytes 2080 - 20bf + 0x44, 0xD9, 0x82, 0xD9, 0x89, 0x44, 0xD9, 0x82, + 0xD9, 0x8A, 0x44, 0xD9, 0x83, 0xD8, 0xA7, 0x44, + 0xD9, 0x83, 0xD8, 0xAC, 0x44, 0xD9, 0x83, 0xD8, + 0xAD, 0x44, 0xD9, 0x83, 0xD8, 0xAE, 0x44, 0xD9, + 0x83, 0xD9, 0x84, 0x44, 0xD9, 0x83, 0xD9, 0x85, + 0x44, 0xD9, 0x83, 0xD9, 0x89, 0x44, 0xD9, 0x83, + 0xD9, 0x8A, 0x44, 0xD9, 0x84, 0xD8, 0xA7, 0x44, + 0xD9, 0x84, 0xD8, 0xAC, 0x44, 0xD9, 0x84, 0xD8, + // Bytes 20c0 - 20ff + 0xAD, 0x44, 0xD9, 0x84, 0xD8, 0xAE, 0x44, 0xD9, + 0x84, 0xD9, 0x85, 0x44, 0xD9, 0x84, 0xD9, 0x87, + 0x44, 0xD9, 0x84, 0xD9, 0x89, 0x44, 0xD9, 0x84, + 0xD9, 0x8A, 0x44, 0xD9, 0x85, 0xD8, 0xA7, 0x44, + 0xD9, 0x85, 0xD8, 0xAC, 0x44, 0xD9, 0x85, 0xD8, + 0xAD, 0x44, 0xD9, 0x85, 0xD8, 0xAE, 0x44, 0xD9, + 0x85, 0xD9, 0x85, 0x44, 0xD9, 0x85, 0xD9, 0x89, + 0x44, 0xD9, 0x85, 0xD9, 0x8A, 0x44, 0xD9, 0x86, + // Bytes 2100 - 213f + 0xD8, 0xAC, 0x44, 0xD9, 0x86, 0xD8, 0xAD, 0x44, + 0xD9, 0x86, 0xD8, 0xAE, 0x44, 0xD9, 0x86, 0xD8, + 0xB1, 0x44, 0xD9, 0x86, 0xD8, 0xB2, 0x44, 0xD9, + 0x86, 0xD9, 0x85, 0x44, 0xD9, 0x86, 0xD9, 0x86, + 0x44, 0xD9, 0x86, 0xD9, 0x87, 0x44, 0xD9, 0x86, + 0xD9, 0x89, 0x44, 0xD9, 0x86, 0xD9, 0x8A, 0x44, + 0xD9, 0x87, 0xD8, 0xAC, 0x44, 0xD9, 0x87, 0xD9, + 0x85, 0x44, 0xD9, 0x87, 0xD9, 0x89, 0x44, 0xD9, + // Bytes 2140 - 217f + 0x87, 0xD9, 0x8A, 0x44, 0xD9, 0x88, 0xD9, 0xB4, + 0x44, 0xD9, 0x8A, 0xD8, 0xAC, 0x44, 0xD9, 0x8A, + 0xD8, 0xAD, 0x44, 0xD9, 0x8A, 0xD8, 0xAE, 0x44, + 0xD9, 0x8A, 0xD8, 0xB1, 0x44, 0xD9, 0x8A, 0xD8, + 0xB2, 0x44, 0xD9, 0x8A, 0xD9, 0x85, 0x44, 0xD9, + 0x8A, 0xD9, 0x86, 0x44, 0xD9, 0x8A, 0xD9, 0x87, + 0x44, 0xD9, 0x8A, 0xD9, 0x89, 0x44, 0xD9, 0x8A, + 0xD9, 0x8A, 0x44, 0xD9, 0x8A, 0xD9, 0xB4, 0x44, + // Bytes 2180 - 21bf + 0xDB, 0x87, 0xD9, 0xB4, 0x45, 0x28, 0xE1, 0x84, + 0x80, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x82, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x83, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x85, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x86, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x87, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x89, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x8B, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x8C, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x8E, 0x29, + // Bytes 21c0 - 21ff + 0x45, 0x28, 0xE1, 0x84, 0x8F, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x90, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x91, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x92, 0x29, + 0x45, 0x28, 0xE4, 0xB8, 0x80, 0x29, 0x45, 0x28, + 0xE4, 0xB8, 0x83, 0x29, 0x45, 0x28, 0xE4, 0xB8, + 0x89, 0x29, 0x45, 0x28, 0xE4, 0xB9, 0x9D, 0x29, + 0x45, 0x28, 0xE4, 0xBA, 0x8C, 0x29, 0x45, 0x28, + 0xE4, 0xBA, 0x94, 0x29, 0x45, 0x28, 0xE4, 0xBB, + // Bytes 2200 - 223f + 0xA3, 0x29, 0x45, 0x28, 0xE4, 0xBC, 0x81, 0x29, + 0x45, 0x28, 0xE4, 0xBC, 0x91, 0x29, 0x45, 0x28, + 0xE5, 0x85, 0xAB, 0x29, 0x45, 0x28, 0xE5, 0x85, + 0xAD, 0x29, 0x45, 0x28, 0xE5, 0x8A, 0xB4, 0x29, + 0x45, 0x28, 0xE5, 0x8D, 0x81, 0x29, 0x45, 0x28, + 0xE5, 0x8D, 0x94, 0x29, 0x45, 0x28, 0xE5, 0x90, + 0x8D, 0x29, 0x45, 0x28, 0xE5, 0x91, 0xBC, 0x29, + 0x45, 0x28, 0xE5, 0x9B, 0x9B, 0x29, 0x45, 0x28, + // Bytes 2240 - 227f + 0xE5, 0x9C, 0x9F, 0x29, 0x45, 0x28, 0xE5, 0xAD, + 0xA6, 0x29, 0x45, 0x28, 0xE6, 0x97, 0xA5, 0x29, + 0x45, 0x28, 0xE6, 0x9C, 0x88, 0x29, 0x45, 0x28, + 0xE6, 0x9C, 0x89, 0x29, 0x45, 0x28, 0xE6, 0x9C, + 0xA8, 0x29, 0x45, 0x28, 0xE6, 0xA0, 0xAA, 0x29, + 0x45, 0x28, 0xE6, 0xB0, 0xB4, 0x29, 0x45, 0x28, + 0xE7, 0x81, 0xAB, 0x29, 0x45, 0x28, 0xE7, 0x89, + 0xB9, 0x29, 0x45, 0x28, 0xE7, 0x9B, 0xA3, 0x29, + // Bytes 2280 - 22bf + 0x45, 0x28, 0xE7, 0xA4, 0xBE, 0x29, 0x45, 0x28, + 0xE7, 0xA5, 0x9D, 0x29, 0x45, 0x28, 0xE7, 0xA5, + 0xAD, 0x29, 0x45, 0x28, 0xE8, 0x87, 0xAA, 0x29, + 0x45, 0x28, 0xE8, 0x87, 0xB3, 0x29, 0x45, 0x28, + 0xE8, 0xB2, 0xA1, 0x29, 0x45, 0x28, 0xE8, 0xB3, + 0x87, 0x29, 0x45, 0x28, 0xE9, 0x87, 0x91, 0x29, + 0x45, 0x30, 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, + 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x31, 0x30, 0xE6, + // Bytes 22c0 - 22ff + 0x9C, 0x88, 0x45, 0x31, 0x30, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x31, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x31, 0xE6, 0x9C, 0x88, 0x45, 0x31, 0x31, 0xE7, + 0x82, 0xB9, 0x45, 0x31, 0x32, 0xE6, 0x97, 0xA5, + 0x45, 0x31, 0x32, 0xE6, 0x9C, 0x88, 0x45, 0x31, + 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x33, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x33, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x31, + // Bytes 2300 - 233f + 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x35, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x35, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x36, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x36, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x37, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x37, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x38, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x39, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x39, 0xE7, 0x82, 0xB9, + // Bytes 2340 - 237f + 0x45, 0x31, 0xE2, 0x81, 0x84, 0x32, 0x45, 0x31, + 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, 0xE2, 0x81, + 0x84, 0x34, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x35, + 0x45, 0x31, 0xE2, 0x81, 0x84, 0x36, 0x45, 0x31, + 0xE2, 0x81, 0x84, 0x37, 0x45, 0x31, 0xE2, 0x81, + 0x84, 0x38, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x39, + 0x45, 0x32, 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x30, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x31, 0xE6, + // Bytes 2380 - 23bf + 0x97, 0xA5, 0x45, 0x32, 0x31, 0xE7, 0x82, 0xB9, + 0x45, 0x32, 0x32, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x33, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0x33, 0xE7, 0x82, 0xB9, + 0x45, 0x32, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x35, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0x36, 0xE6, 0x97, 0xA5, + 0x45, 0x32, 0x37, 0xE6, 0x97, 0xA5, 0x45, 0x32, + // Bytes 23c0 - 23ff + 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x32, 0x39, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0xE2, 0x81, 0x84, 0x33, + 0x45, 0x32, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, + 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x33, 0x31, 0xE6, + 0x97, 0xA5, 0x45, 0x33, 0xE2, 0x81, 0x84, 0x34, + 0x45, 0x33, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, + 0xE2, 0x81, 0x84, 0x38, 0x45, 0x34, 0xE2, 0x81, + 0x84, 0x35, 0x45, 0x35, 0xE2, 0x81, 0x84, 0x36, + // Bytes 2400 - 243f + 0x45, 0x35, 0xE2, 0x81, 0x84, 0x38, 0x45, 0x37, + 0xE2, 0x81, 0x84, 0x38, 0x45, 0x41, 0xE2, 0x88, + 0x95, 0x6D, 0x45, 0x56, 0xE2, 0x88, 0x95, 0x6D, + 0x45, 0x6D, 0xE2, 0x88, 0x95, 0x73, 0x46, 0x31, + 0xE2, 0x81, 0x84, 0x31, 0x30, 0x46, 0x43, 0xE2, + 0x88, 0x95, 0x6B, 0x67, 0x46, 0x6D, 0xE2, 0x88, + 0x95, 0x73, 0x32, 0x46, 0xD8, 0xA8, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD8, 0xA8, 0xD8, 0xAE, 0xD9, + // Bytes 2440 - 247f + 0x8A, 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x85, + 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x89, 0x46, + 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, + 0xAA, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, 0xD8, 0xAA, + 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, + 0xAE, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, + 0xD9, 0x89, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, 0xD9, + 0x8A, 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAC, + // Bytes 2480 - 24bf + 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAD, 0x46, + 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAE, 0x46, 0xD8, + 0xAA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAA, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD8, + 0xAD, 0xD9, 0x89, 0x46, 0xD8, 0xAC, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD8, + 0xAD, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x89, + 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x8A, 0x46, + // Bytes 24c0 - 24ff + 0xD8, 0xAD, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, + 0xAD, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAD, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB3, 0xD8, + 0xAC, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, 0xD8, 0xAC, + 0xD9, 0x89, 0x46, 0xD8, 0xB3, 0xD8, 0xAD, 0xD8, + 0xAC, 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x89, + 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x8A, 0x46, + 0xD8, 0xB3, 0xD9, 0x85, 0xD8, 0xAC, 0x46, 0xD8, + // Bytes 2500 - 253f + 0xB3, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, + 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, + 0xAC, 0xD9, 0x8A, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, + 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, 0xD9, + 0x8A, 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD8, 0xAE, + 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD9, 0x85, 0x46, + 0xD8, 0xB5, 0xD8, 0xAD, 0xD8, 0xAD, 0x46, 0xD8, + 0xB5, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD8, 0xB5, + // Bytes 2540 - 257f + 0xD9, 0x84, 0xD9, 0x89, 0x46, 0xD8, 0xB5, 0xD9, + 0x84, 0xDB, 0x92, 0x46, 0xD8, 0xB5, 0xD9, 0x85, + 0xD9, 0x85, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, + 0x89, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, 0x8A, + 0x46, 0xD8, 0xB6, 0xD8, 0xAE, 0xD9, 0x85, 0x46, + 0xD8, 0xB7, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, + 0xB7, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB7, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB9, 0xD8, + // Bytes 2580 - 25bf + 0xAC, 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, + 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, + 0x89, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, 0x8A, + 0x46, 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x85, 0x46, + 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, + 0xBA, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x81, + 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x81, 0xD9, + 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x82, 0xD9, 0x84, + // Bytes 25c0 - 25ff + 0xDB, 0x92, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD8, + 0xAD, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x85, + 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x8A, 0x46, + 0xD9, 0x83, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, + 0x83, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x84, + 0xD8, 0xAC, 0xD8, 0xAC, 0x46, 0xD9, 0x84, 0xD8, + 0xAC, 0xD9, 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAC, + 0xD9, 0x8A, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, + // Bytes 2600 - 263f + 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x89, + 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, + 0xD9, 0x84, 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, + 0x84, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD9, 0x84, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD8, + 0xAC, 0xD8, 0xAD, 0x46, 0xD9, 0x85, 0xD8, 0xAC, + 0xD8, 0xAE, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, + 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, 0x8A, + // Bytes 2640 - 267f + 0x46, 0xD9, 0x85, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, + 0xD9, 0x85, 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, + 0x85, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x85, + 0xD8, 0xAE, 0xD8, 0xAC, 0x46, 0xD9, 0x85, 0xD8, + 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAE, + 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD9, 0x85, 0xD9, + 0x8A, 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD8, 0xAD, + 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x85, 0x46, + // Bytes 2680 - 26bf + 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x89, 0x46, 0xD9, + 0x86, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x86, + 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, 0x86, 0xD8, + 0xAD, 0xD9, 0x89, 0x46, 0xD9, 0x86, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, + 0x89, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, 0x8A, + 0x46, 0xD9, 0x87, 0xD9, 0x85, 0xD8, 0xAC, 0x46, + 0xD9, 0x87, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, + // Bytes 26c0 - 26ff + 0x8A, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, + 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, + 0x85, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x85, + 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, + 0xA7, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAC, + 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAD, 0x46, + 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAE, 0x46, 0xD9, + 0x8A, 0xD9, 0x94, 0xD8, 0xB1, 0x46, 0xD9, 0x8A, + // Bytes 2700 - 273f + 0xD9, 0x94, 0xD8, 0xB2, 0x46, 0xD9, 0x8A, 0xD9, + 0x94, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x94, + 0xD9, 0x86, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, + 0x87, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x88, + 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x89, 0x46, + 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x8A, 0x46, 0xD9, + 0x8A, 0xD9, 0x94, 0xDB, 0x86, 0x46, 0xD9, 0x8A, + 0xD9, 0x94, 0xDB, 0x87, 0x46, 0xD9, 0x8A, 0xD9, + // Bytes 2740 - 277f + 0x94, 0xDB, 0x88, 0x46, 0xD9, 0x8A, 0xD9, 0x94, + 0xDB, 0x90, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xDB, + 0x95, 0x46, 0xE0, 0xB9, 0x8D, 0xE0, 0xB8, 0xB2, + 0x46, 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0x99, 0x46, + 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0xA1, 0x46, 0xE0, + 0xBB, 0x8D, 0xE0, 0xBA, 0xB2, 0x46, 0xE0, 0xBD, + 0x80, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, 0xBD, 0x82, + 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x8C, 0xE0, + // Bytes 2780 - 27bf + 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x91, 0xE0, 0xBE, + 0xB7, 0x46, 0xE0, 0xBD, 0x96, 0xE0, 0xBE, 0xB7, + 0x46, 0xE0, 0xBD, 0x9B, 0xE0, 0xBE, 0xB7, 0x46, + 0xE0, 0xBE, 0x90, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, + 0xBE, 0x92, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, + 0x9C, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA1, + 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA6, 0xE0, + 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xAB, 0xE0, 0xBE, + // Bytes 27c0 - 27ff + 0xB7, 0x46, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, + 0x46, 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0x46, + 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x46, 0xE2, + 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x46, 0xE3, 0x81, + 0xBB, 0xE3, 0x81, 0x8B, 0x46, 0xE3, 0x82, 0x88, + 0xE3, 0x82, 0x8A, 0x46, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x82, + 0xB3, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0x88, + // Bytes 2800 - 283f + 0x46, 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xB3, 0x46, + 0xE3, 0x83, 0x8A, 0xE3, 0x83, 0x8E, 0x46, 0xE3, + 0x83, 0x9B, 0xE3, 0x83, 0xB3, 0x46, 0xE3, 0x83, + 0x9F, 0xE3, 0x83, 0xAA, 0x46, 0xE3, 0x83, 0xAA, + 0xE3, 0x83, 0xA9, 0x46, 0xE3, 0x83, 0xAC, 0xE3, + 0x83, 0xA0, 0x46, 0xE4, 0xBB, 0xA4, 0xE5, 0x92, + 0x8C, 0x46, 0xE5, 0xA4, 0xA7, 0xE6, 0xAD, 0xA3, + 0x46, 0xE5, 0xB9, 0xB3, 0xE6, 0x88, 0x90, 0x46, + // Bytes 2840 - 287f + 0xE6, 0x98, 0x8E, 0xE6, 0xB2, 0xBB, 0x46, 0xE6, + 0x98, 0xAD, 0xE5, 0x92, 0x8C, 0x47, 0x72, 0x61, + 0x64, 0xE2, 0x88, 0x95, 0x73, 0x47, 0xE3, 0x80, + 0x94, 0x53, 0xE3, 0x80, 0x95, 0x48, 0x28, 0xE1, + 0x84, 0x80, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, + 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, 0x29, 0x48, + 0x28, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, 0x29, + 0x48, 0x28, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, + // Bytes 2880 - 28bf + 0x29, 0x48, 0x28, 0xE1, 0x84, 0x86, 0xE1, 0x85, + 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x87, 0xE1, + 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x89, + 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, + 0x8B, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, + 0x84, 0x8C, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, + 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xAE, 0x29, 0x48, + 0x28, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, 0x29, + // Bytes 28c0 - 28ff + 0x48, 0x28, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, + 0x29, 0x48, 0x28, 0xE1, 0x84, 0x90, 0xE1, 0x85, + 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x91, 0xE1, + 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x92, + 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x72, 0x61, 0x64, + 0xE2, 0x88, 0x95, 0x73, 0x32, 0x48, 0xD8, 0xA7, + 0xD9, 0x83, 0xD8, 0xA8, 0xD8, 0xB1, 0x48, 0xD8, + 0xA7, 0xD9, 0x84, 0xD9, 0x84, 0xD9, 0x87, 0x48, + // Bytes 2900 - 293f + 0xD8, 0xB1, 0xD8, 0xB3, 0xD9, 0x88, 0xD9, 0x84, + 0x48, 0xD8, 0xB1, 0xDB, 0x8C, 0xD8, 0xA7, 0xD9, + 0x84, 0x48, 0xD8, 0xB5, 0xD9, 0x84, 0xD8, 0xB9, + 0xD9, 0x85, 0x48, 0xD8, 0xB9, 0xD9, 0x84, 0xD9, + 0x8A, 0xD9, 0x87, 0x48, 0xD9, 0x85, 0xD8, 0xAD, + 0xD9, 0x85, 0xD8, 0xAF, 0x48, 0xD9, 0x88, 0xD8, + 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x49, 0xE2, 0x80, + 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0x49, + // Bytes 2940 - 297f + 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0xE2, 0x80, + 0xB5, 0x49, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, + 0xE2, 0x88, 0xAB, 0x49, 0xE2, 0x88, 0xAE, 0xE2, + 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x49, 0xE3, 0x80, + 0x94, 0xE4, 0xB8, 0x89, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x80, 0x94, 0xE4, 0xBA, 0x8C, 0xE3, 0x80, + 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, 0x8B, 0x9D, + 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, + // Bytes 2980 - 29bf + 0xAE, 0x89, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, + 0x94, 0xE6, 0x89, 0x93, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x80, 0x94, 0xE6, 0x95, 0x97, 0xE3, 0x80, + 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE6, 0x9C, 0xAC, + 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE7, + 0x82, 0xB9, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, + 0x94, 0xE7, 0x9B, 0x97, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + // Bytes 29c0 - 29ff + 0xAB, 0x49, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x81, 0x49, 0xE3, 0x82, 0xA6, 0xE3, + 0x82, 0xA9, 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x82, + 0xAA, 0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xB9, 0x49, + 0xE3, 0x82, 0xAA, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xA0, 0x49, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0xA4, + 0xE3, 0x83, 0xAA, 0x49, 0xE3, 0x82, 0xB1, 0xE3, + 0x83, 0xBC, 0xE3, 0x82, 0xB9, 0x49, 0xE3, 0x82, + // Bytes 2a00 - 2a3f + 0xB3, 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x8A, 0x49, + 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, + 0x81, 0x49, 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x88, 0x49, 0xE3, 0x83, 0x86, 0xE3, + 0x82, 0x99, 0xE3, 0x82, 0xB7, 0x49, 0xE3, 0x83, + 0x88, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, + 0xE3, 0x83, 0x8E, 0xE3, 0x83, 0x83, 0xE3, 0x83, + 0x88, 0x49, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0xA4, + // Bytes 2a40 - 2a7f + 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, 0x92, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, + 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, 0xB3, 0x49, + 0xE3, 0x83, 0x95, 0xE3, 0x83, 0xA9, 0xE3, 0x83, + 0xB3, 0x49, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0xE3, 0x82, 0xBD, 0x49, 0xE3, 0x83, 0x98, 0xE3, + 0x83, 0xAB, 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, + 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, 0x49, + // Bytes 2a80 - 2abf + 0xE3, 0x83, 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xB3, 0x49, 0xE3, 0x83, 0x9E, 0xE3, 0x82, 0xA4, + 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, 0x9E, 0xE3, + 0x83, 0x83, 0xE3, 0x83, 0x8F, 0x49, 0xE3, 0x83, + 0x9E, 0xE3, 0x83, 0xAB, 0xE3, 0x82, 0xAF, 0x49, + 0xE3, 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xAB, 0x49, 0xE3, 0x83, 0xA6, 0xE3, 0x82, 0xA2, + 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x83, 0xAF, 0xE3, + // Bytes 2ac0 - 2aff + 0x83, 0x83, 0xE3, 0x83, 0x88, 0x4C, 0xE2, 0x80, + 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0xE2, + 0x80, 0xB2, 0x4C, 0xE2, 0x88, 0xAB, 0xE2, 0x88, + 0xAB, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x4C, + 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xAB, 0xE3, 0x83, + 0x95, 0xE3, 0x82, 0xA1, 0x4C, 0xE3, 0x82, 0xA8, + 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xAB, 0xE3, 0x83, + 0xBC, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, + // Bytes 2b00 - 2b3f + 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, 0x4C, 0xE3, + 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x9E, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, + 0x83, 0xA9, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, + 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x83, 0xAD, 0xE3, + 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, 0xE3, 0x82, + 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x8B, 0xE3, + 0x83, 0xBC, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x83, + // Bytes 2b40 - 2b7f + 0xA5, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, + 0xA9, 0xE3, 0x83, 0xA0, 0x4C, 0xE3, 0x82, 0xAF, + 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0x8D, 0x4C, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0xA4, + 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, + 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, + 0xE3, 0x82, 0xB9, 0x4C, 0xE3, 0x83, 0x8F, 0xE3, + // Bytes 2b80 - 2bbf + 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x84, + 0x4C, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, + 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, + 0x95, 0xE3, 0x82, 0xA3, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0x88, 0x4C, 0xE3, 0x83, 0x98, 0xE3, 0x82, + 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xBF, 0x4C, + 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, + 0x8B, 0xE3, 0x83, 0x92, 0x4C, 0xE3, 0x83, 0x98, + // Bytes 2bc0 - 2bff + 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xB3, 0xE3, 0x82, + 0xB9, 0x4C, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x88, 0x4C, 0xE3, + 0x83, 0x9E, 0xE3, 0x82, 0xA4, 0xE3, 0x82, 0xAF, + 0xE3, 0x83, 0xAD, 0x4C, 0xE3, 0x83, 0x9F, 0xE3, + 0x82, 0xAF, 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, + 0x4C, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, + // Bytes 2c00 - 2c3f + 0xAA, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, 0xE3, + 0x83, 0xAB, 0x4C, 0xE3, 0x83, 0xAB, 0xE3, 0x83, + 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0x4C, + 0xE6, 0xA0, 0xAA, 0xE5, 0xBC, 0x8F, 0xE4, 0xBC, + 0x9A, 0xE7, 0xA4, 0xBE, 0x4E, 0x28, 0xE1, 0x84, + 0x8B, 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x92, 0xE1, + 0x85, 0xAE, 0x29, 0x4F, 0xD8, 0xAC, 0xD9, 0x84, + 0x20, 0xD8, 0xAC, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, + // Bytes 2c40 - 2c7f + 0x84, 0xD9, 0x87, 0x4F, 0xE3, 0x82, 0xA2, 0xE3, + 0x83, 0x8F, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xA2, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0xE3, 0x82, 0xA2, 0x4F, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0xE3, 0x83, 0xAF, 0xE3, 0x83, 0x83, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xB5, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x81, 0xE3, 0x83, 0xBC, + // Bytes 2c80 - 2cbf + 0xE3, 0x83, 0xA0, 0x4F, 0xE3, 0x83, 0x8F, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAC, + 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x98, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0xBF, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x9B, 0xE3, + 0x82, 0x9A, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x83, 0x9E, 0xE3, + 0x83, 0xB3, 0xE3, 0x82, 0xB7, 0xE3, 0x83, 0xA7, + // Bytes 2cc0 - 2cff + 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xA1, 0xE3, + 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x88, + 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xAB, 0xE3, + 0x83, 0xBC, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xAB, 0x51, 0x28, 0xE1, 0x84, 0x8B, + 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x8C, 0xE1, 0x85, + 0xA5, 0xE1, 0x86, 0xAB, 0x29, 0x52, 0xE3, 0x82, + 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0xE3, + // Bytes 2d00 - 2d3f + 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, + 0x52, 0xE3, 0x82, 0xAD, 0xE3, 0x83, 0xAD, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9, + 0xE3, 0x83, 0xA0, 0x52, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x52, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9, + 0xE3, 0x83, 0xA0, 0xE3, 0x83, 0x88, 0xE3, 0x83, + // Bytes 2d40 - 2d7f + 0xB3, 0x52, 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, + 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0xAD, 0x52, 0xE3, 0x83, 0x8F, + 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x82, + 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x88, 0x52, + 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, + 0xA2, 0xE3, 0x82, 0xB9, 0xE3, 0x83, 0x88, 0xE3, + 0x83, 0xAB, 0x52, 0xE3, 0x83, 0x95, 0xE3, 0x82, + // Bytes 2d80 - 2dbf + 0x99, 0xE3, 0x83, 0x83, 0xE3, 0x82, 0xB7, 0xE3, + 0x82, 0xA7, 0xE3, 0x83, 0xAB, 0x52, 0xE3, 0x83, + 0x9F, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0x8F, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, + 0x52, 0xE3, 0x83, 0xAC, 0xE3, 0x83, 0xB3, 0xE3, + 0x83, 0x88, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xB3, 0x61, 0xD8, 0xB5, 0xD9, 0x84, + 0xD9, 0x89, 0x20, 0xD8, 0xA7, 0xD9, 0x84, 0xD9, + // Bytes 2dc0 - 2dff + 0x84, 0xD9, 0x87, 0x20, 0xD8, 0xB9, 0xD9, 0x84, + 0xD9, 0x8A, 0xD9, 0x87, 0x20, 0xD9, 0x88, 0xD8, + 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x06, 0xE0, 0xA7, + 0x87, 0xE0, 0xA6, 0xBE, 0x01, 0x06, 0xE0, 0xA7, + 0x87, 0xE0, 0xA7, 0x97, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAC, 0xBE, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAD, 0x96, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAD, 0x97, 0x01, 0x06, 0xE0, 0xAE, + // Bytes 2e00 - 2e3f + 0x92, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, 0xAF, + 0x86, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, 0xAF, + 0x86, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, 0xAF, + 0x87, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, 0xB2, + 0xBF, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, 0xB3, + 0x86, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, 0xB3, + 0x86, 0xE0, 0xB3, 0x96, 0x01, 0x06, 0xE0, 0xB5, + 0x86, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, 0xB5, + // Bytes 2e40 - 2e7f + 0x86, 0xE0, 0xB5, 0x97, 0x01, 0x06, 0xE0, 0xB5, + 0x87, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, 0xB7, + 0x99, 0xE0, 0xB7, 0x9F, 0x01, 0x06, 0xE1, 0x80, + 0xA5, 0xE1, 0x80, 0xAE, 0x01, 0x06, 0xE1, 0xAC, + 0x85, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x87, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x89, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x8B, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + // Bytes 2e80 - 2ebf + 0x8D, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x91, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBA, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBC, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBE, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBF, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAD, + 0x82, 0xE1, 0xAC, 0xB5, 0x01, 0x08, 0xF0, 0x91, + 0x84, 0xB1, 0xF0, 0x91, 0x84, 0xA7, 0x01, 0x08, + // Bytes 2ec0 - 2eff + 0xF0, 0x91, 0x84, 0xB2, 0xF0, 0x91, 0x84, 0xA7, + 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, 0xF0, 0x91, + 0x8C, 0xBE, 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, + 0xF0, 0x91, 0x8D, 0x97, 0x01, 0x08, 0xF0, 0x91, + 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xB0, 0x01, 0x08, + 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xBA, + 0x01, 0x08, 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, + 0x92, 0xBD, 0x01, 0x08, 0xF0, 0x91, 0x96, 0xB8, + // Bytes 2f00 - 2f3f + 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, 0xF0, 0x91, + 0x96, 0xB9, 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, + 0xF0, 0x91, 0xA4, 0xB5, 0xF0, 0x91, 0xA4, 0xB0, + 0x01, 0x09, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, + 0xE0, 0xB3, 0x95, 0x02, 0x09, 0xE0, 0xB7, 0x99, + 0xE0, 0xB7, 0x8F, 0xE0, 0xB7, 0x8A, 0x16, 0x44, + 0x44, 0x5A, 0xCC, 0x8C, 0xCD, 0x44, 0x44, 0x7A, + 0xCC, 0x8C, 0xCD, 0x44, 0x64, 0x7A, 0xCC, 0x8C, + // Bytes 2f40 - 2f7f + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x93, + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x94, + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x95, + 0xB9, 0x46, 0xE1, 0x84, 0x80, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x86, 0xE1, 0x85, 0xA1, + // Bytes 2f80 - 2fbf + 0x01, 0x46, 0xE1, 0x84, 0x87, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x89, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xAE, + 0x01, 0x46, 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x90, 0xE1, 0x85, 0xA1, + // Bytes 2fc0 - 2fff + 0x01, 0x46, 0xE1, 0x84, 0x91, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x92, 0xE1, 0x85, 0xA1, + 0x01, 0x49, 0xE3, 0x83, 0xA1, 0xE3, 0x82, 0xAB, + 0xE3, 0x82, 0x99, 0x11, 0x4C, 0xE1, 0x84, 0x8C, + 0xE1, 0x85, 0xAE, 0xE1, 0x84, 0x8B, 0xE1, 0x85, + 0xB4, 0x01, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x82, + 0x99, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x11, + 0x4C, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0xBC, 0xE3, + // Bytes 3000 - 303f + 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0x11, 0x4C, 0xE3, + 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88, + 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE1, 0x84, 0x8E, + 0xE1, 0x85, 0xA1, 0xE1, 0x86, 0xB7, 0xE1, 0x84, + 0x80, 0xE1, 0x85, 0xA9, 0x01, 0x4F, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0x8B, 0xE3, 0x83, 0xB3, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE3, + 0x82, 0xB7, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xB3, + // Bytes 3040 - 307f + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x4F, + 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, + 0xBC, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x11, + 0x4F, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x52, 0xE3, 0x82, 0xA8, 0xE3, 0x82, 0xB9, + 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0x88, 0xE3, 0x82, 0x99, 0x11, 0x52, 0xE3, 0x83, + // Bytes 3080 - 30bf + 0x95, 0xE3, 0x82, 0xA1, 0xE3, 0x83, 0xA9, 0xE3, + 0x83, 0x83, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x86, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, + 0x01, 0x86, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8F, + 0x01, 0x03, 0x3C, 0xCC, 0xB8, 0x05, 0x03, 0x3D, + 0xCC, 0xB8, 0x05, 0x03, 0x3E, 0xCC, 0xB8, 0x05, + 0x03, 0x41, 0xCC, 0x80, 0xCD, 0x03, 0x41, 0xCC, + 0x81, 0xCD, 0x03, 0x41, 0xCC, 0x83, 0xCD, 0x03, + // Bytes 30c0 - 30ff + 0x41, 0xCC, 0x84, 0xCD, 0x03, 0x41, 0xCC, 0x89, + 0xCD, 0x03, 0x41, 0xCC, 0x8C, 0xCD, 0x03, 0x41, + 0xCC, 0x8F, 0xCD, 0x03, 0x41, 0xCC, 0x91, 0xCD, + 0x03, 0x41, 0xCC, 0xA5, 0xB9, 0x03, 0x41, 0xCC, + 0xA8, 0xA9, 0x03, 0x42, 0xCC, 0x87, 0xCD, 0x03, + 0x42, 0xCC, 0xA3, 0xB9, 0x03, 0x42, 0xCC, 0xB1, + 0xB9, 0x03, 0x43, 0xCC, 0x81, 0xCD, 0x03, 0x43, + 0xCC, 0x82, 0xCD, 0x03, 0x43, 0xCC, 0x87, 0xCD, + // Bytes 3100 - 313f + 0x03, 0x43, 0xCC, 0x8C, 0xCD, 0x03, 0x44, 0xCC, + 0x87, 0xCD, 0x03, 0x44, 0xCC, 0x8C, 0xCD, 0x03, + 0x44, 0xCC, 0xA3, 0xB9, 0x03, 0x44, 0xCC, 0xA7, + 0xA9, 0x03, 0x44, 0xCC, 0xAD, 0xB9, 0x03, 0x44, + 0xCC, 0xB1, 0xB9, 0x03, 0x45, 0xCC, 0x80, 0xCD, + 0x03, 0x45, 0xCC, 0x81, 0xCD, 0x03, 0x45, 0xCC, + 0x83, 0xCD, 0x03, 0x45, 0xCC, 0x86, 0xCD, 0x03, + 0x45, 0xCC, 0x87, 0xCD, 0x03, 0x45, 0xCC, 0x88, + // Bytes 3140 - 317f + 0xCD, 0x03, 0x45, 0xCC, 0x89, 0xCD, 0x03, 0x45, + 0xCC, 0x8C, 0xCD, 0x03, 0x45, 0xCC, 0x8F, 0xCD, + 0x03, 0x45, 0xCC, 0x91, 0xCD, 0x03, 0x45, 0xCC, + 0xA8, 0xA9, 0x03, 0x45, 0xCC, 0xAD, 0xB9, 0x03, + 0x45, 0xCC, 0xB0, 0xB9, 0x03, 0x46, 0xCC, 0x87, + 0xCD, 0x03, 0x47, 0xCC, 0x81, 0xCD, 0x03, 0x47, + 0xCC, 0x82, 0xCD, 0x03, 0x47, 0xCC, 0x84, 0xCD, + 0x03, 0x47, 0xCC, 0x86, 0xCD, 0x03, 0x47, 0xCC, + // Bytes 3180 - 31bf + 0x87, 0xCD, 0x03, 0x47, 0xCC, 0x8C, 0xCD, 0x03, + 0x47, 0xCC, 0xA7, 0xA9, 0x03, 0x48, 0xCC, 0x82, + 0xCD, 0x03, 0x48, 0xCC, 0x87, 0xCD, 0x03, 0x48, + 0xCC, 0x88, 0xCD, 0x03, 0x48, 0xCC, 0x8C, 0xCD, + 0x03, 0x48, 0xCC, 0xA3, 0xB9, 0x03, 0x48, 0xCC, + 0xA7, 0xA9, 0x03, 0x48, 0xCC, 0xAE, 0xB9, 0x03, + 0x49, 0xCC, 0x80, 0xCD, 0x03, 0x49, 0xCC, 0x81, + 0xCD, 0x03, 0x49, 0xCC, 0x82, 0xCD, 0x03, 0x49, + // Bytes 31c0 - 31ff + 0xCC, 0x83, 0xCD, 0x03, 0x49, 0xCC, 0x84, 0xCD, + 0x03, 0x49, 0xCC, 0x86, 0xCD, 0x03, 0x49, 0xCC, + 0x87, 0xCD, 0x03, 0x49, 0xCC, 0x89, 0xCD, 0x03, + 0x49, 0xCC, 0x8C, 0xCD, 0x03, 0x49, 0xCC, 0x8F, + 0xCD, 0x03, 0x49, 0xCC, 0x91, 0xCD, 0x03, 0x49, + 0xCC, 0xA3, 0xB9, 0x03, 0x49, 0xCC, 0xA8, 0xA9, + 0x03, 0x49, 0xCC, 0xB0, 0xB9, 0x03, 0x4A, 0xCC, + 0x82, 0xCD, 0x03, 0x4B, 0xCC, 0x81, 0xCD, 0x03, + // Bytes 3200 - 323f + 0x4B, 0xCC, 0x8C, 0xCD, 0x03, 0x4B, 0xCC, 0xA3, + 0xB9, 0x03, 0x4B, 0xCC, 0xA7, 0xA9, 0x03, 0x4B, + 0xCC, 0xB1, 0xB9, 0x03, 0x4C, 0xCC, 0x81, 0xCD, + 0x03, 0x4C, 0xCC, 0x8C, 0xCD, 0x03, 0x4C, 0xCC, + 0xA7, 0xA9, 0x03, 0x4C, 0xCC, 0xAD, 0xB9, 0x03, + 0x4C, 0xCC, 0xB1, 0xB9, 0x03, 0x4D, 0xCC, 0x81, + 0xCD, 0x03, 0x4D, 0xCC, 0x87, 0xCD, 0x03, 0x4D, + 0xCC, 0xA3, 0xB9, 0x03, 0x4E, 0xCC, 0x80, 0xCD, + // Bytes 3240 - 327f + 0x03, 0x4E, 0xCC, 0x81, 0xCD, 0x03, 0x4E, 0xCC, + 0x83, 0xCD, 0x03, 0x4E, 0xCC, 0x87, 0xCD, 0x03, + 0x4E, 0xCC, 0x8C, 0xCD, 0x03, 0x4E, 0xCC, 0xA3, + 0xB9, 0x03, 0x4E, 0xCC, 0xA7, 0xA9, 0x03, 0x4E, + 0xCC, 0xAD, 0xB9, 0x03, 0x4E, 0xCC, 0xB1, 0xB9, + 0x03, 0x4F, 0xCC, 0x80, 0xCD, 0x03, 0x4F, 0xCC, + 0x81, 0xCD, 0x03, 0x4F, 0xCC, 0x86, 0xCD, 0x03, + 0x4F, 0xCC, 0x89, 0xCD, 0x03, 0x4F, 0xCC, 0x8B, + // Bytes 3280 - 32bf + 0xCD, 0x03, 0x4F, 0xCC, 0x8C, 0xCD, 0x03, 0x4F, + 0xCC, 0x8F, 0xCD, 0x03, 0x4F, 0xCC, 0x91, 0xCD, + 0x03, 0x50, 0xCC, 0x81, 0xCD, 0x03, 0x50, 0xCC, + 0x87, 0xCD, 0x03, 0x52, 0xCC, 0x81, 0xCD, 0x03, + 0x52, 0xCC, 0x87, 0xCD, 0x03, 0x52, 0xCC, 0x8C, + 0xCD, 0x03, 0x52, 0xCC, 0x8F, 0xCD, 0x03, 0x52, + 0xCC, 0x91, 0xCD, 0x03, 0x52, 0xCC, 0xA7, 0xA9, + 0x03, 0x52, 0xCC, 0xB1, 0xB9, 0x03, 0x53, 0xCC, + // Bytes 32c0 - 32ff + 0x82, 0xCD, 0x03, 0x53, 0xCC, 0x87, 0xCD, 0x03, + 0x53, 0xCC, 0xA6, 0xB9, 0x03, 0x53, 0xCC, 0xA7, + 0xA9, 0x03, 0x54, 0xCC, 0x87, 0xCD, 0x03, 0x54, + 0xCC, 0x8C, 0xCD, 0x03, 0x54, 0xCC, 0xA3, 0xB9, + 0x03, 0x54, 0xCC, 0xA6, 0xB9, 0x03, 0x54, 0xCC, + 0xA7, 0xA9, 0x03, 0x54, 0xCC, 0xAD, 0xB9, 0x03, + 0x54, 0xCC, 0xB1, 0xB9, 0x03, 0x55, 0xCC, 0x80, + 0xCD, 0x03, 0x55, 0xCC, 0x81, 0xCD, 0x03, 0x55, + // Bytes 3300 - 333f + 0xCC, 0x82, 0xCD, 0x03, 0x55, 0xCC, 0x86, 0xCD, + 0x03, 0x55, 0xCC, 0x89, 0xCD, 0x03, 0x55, 0xCC, + 0x8A, 0xCD, 0x03, 0x55, 0xCC, 0x8B, 0xCD, 0x03, + 0x55, 0xCC, 0x8C, 0xCD, 0x03, 0x55, 0xCC, 0x8F, + 0xCD, 0x03, 0x55, 0xCC, 0x91, 0xCD, 0x03, 0x55, + 0xCC, 0xA3, 0xB9, 0x03, 0x55, 0xCC, 0xA4, 0xB9, + 0x03, 0x55, 0xCC, 0xA8, 0xA9, 0x03, 0x55, 0xCC, + 0xAD, 0xB9, 0x03, 0x55, 0xCC, 0xB0, 0xB9, 0x03, + // Bytes 3340 - 337f + 0x56, 0xCC, 0x83, 0xCD, 0x03, 0x56, 0xCC, 0xA3, + 0xB9, 0x03, 0x57, 0xCC, 0x80, 0xCD, 0x03, 0x57, + 0xCC, 0x81, 0xCD, 0x03, 0x57, 0xCC, 0x82, 0xCD, + 0x03, 0x57, 0xCC, 0x87, 0xCD, 0x03, 0x57, 0xCC, + 0x88, 0xCD, 0x03, 0x57, 0xCC, 0xA3, 0xB9, 0x03, + 0x58, 0xCC, 0x87, 0xCD, 0x03, 0x58, 0xCC, 0x88, + 0xCD, 0x03, 0x59, 0xCC, 0x80, 0xCD, 0x03, 0x59, + 0xCC, 0x81, 0xCD, 0x03, 0x59, 0xCC, 0x82, 0xCD, + // Bytes 3380 - 33bf + 0x03, 0x59, 0xCC, 0x83, 0xCD, 0x03, 0x59, 0xCC, + 0x84, 0xCD, 0x03, 0x59, 0xCC, 0x87, 0xCD, 0x03, + 0x59, 0xCC, 0x88, 0xCD, 0x03, 0x59, 0xCC, 0x89, + 0xCD, 0x03, 0x59, 0xCC, 0xA3, 0xB9, 0x03, 0x5A, + 0xCC, 0x81, 0xCD, 0x03, 0x5A, 0xCC, 0x82, 0xCD, + 0x03, 0x5A, 0xCC, 0x87, 0xCD, 0x03, 0x5A, 0xCC, + 0x8C, 0xCD, 0x03, 0x5A, 0xCC, 0xA3, 0xB9, 0x03, + 0x5A, 0xCC, 0xB1, 0xB9, 0x03, 0x61, 0xCC, 0x80, + // Bytes 33c0 - 33ff + 0xCD, 0x03, 0x61, 0xCC, 0x81, 0xCD, 0x03, 0x61, + 0xCC, 0x83, 0xCD, 0x03, 0x61, 0xCC, 0x84, 0xCD, + 0x03, 0x61, 0xCC, 0x89, 0xCD, 0x03, 0x61, 0xCC, + 0x8C, 0xCD, 0x03, 0x61, 0xCC, 0x8F, 0xCD, 0x03, + 0x61, 0xCC, 0x91, 0xCD, 0x03, 0x61, 0xCC, 0xA5, + 0xB9, 0x03, 0x61, 0xCC, 0xA8, 0xA9, 0x03, 0x62, + 0xCC, 0x87, 0xCD, 0x03, 0x62, 0xCC, 0xA3, 0xB9, + 0x03, 0x62, 0xCC, 0xB1, 0xB9, 0x03, 0x63, 0xCC, + // Bytes 3400 - 343f + 0x81, 0xCD, 0x03, 0x63, 0xCC, 0x82, 0xCD, 0x03, + 0x63, 0xCC, 0x87, 0xCD, 0x03, 0x63, 0xCC, 0x8C, + 0xCD, 0x03, 0x64, 0xCC, 0x87, 0xCD, 0x03, 0x64, + 0xCC, 0x8C, 0xCD, 0x03, 0x64, 0xCC, 0xA3, 0xB9, + 0x03, 0x64, 0xCC, 0xA7, 0xA9, 0x03, 0x64, 0xCC, + 0xAD, 0xB9, 0x03, 0x64, 0xCC, 0xB1, 0xB9, 0x03, + 0x65, 0xCC, 0x80, 0xCD, 0x03, 0x65, 0xCC, 0x81, + 0xCD, 0x03, 0x65, 0xCC, 0x83, 0xCD, 0x03, 0x65, + // Bytes 3440 - 347f + 0xCC, 0x86, 0xCD, 0x03, 0x65, 0xCC, 0x87, 0xCD, + 0x03, 0x65, 0xCC, 0x88, 0xCD, 0x03, 0x65, 0xCC, + 0x89, 0xCD, 0x03, 0x65, 0xCC, 0x8C, 0xCD, 0x03, + 0x65, 0xCC, 0x8F, 0xCD, 0x03, 0x65, 0xCC, 0x91, + 0xCD, 0x03, 0x65, 0xCC, 0xA8, 0xA9, 0x03, 0x65, + 0xCC, 0xAD, 0xB9, 0x03, 0x65, 0xCC, 0xB0, 0xB9, + 0x03, 0x66, 0xCC, 0x87, 0xCD, 0x03, 0x67, 0xCC, + 0x81, 0xCD, 0x03, 0x67, 0xCC, 0x82, 0xCD, 0x03, + // Bytes 3480 - 34bf + 0x67, 0xCC, 0x84, 0xCD, 0x03, 0x67, 0xCC, 0x86, + 0xCD, 0x03, 0x67, 0xCC, 0x87, 0xCD, 0x03, 0x67, + 0xCC, 0x8C, 0xCD, 0x03, 0x67, 0xCC, 0xA7, 0xA9, + 0x03, 0x68, 0xCC, 0x82, 0xCD, 0x03, 0x68, 0xCC, + 0x87, 0xCD, 0x03, 0x68, 0xCC, 0x88, 0xCD, 0x03, + 0x68, 0xCC, 0x8C, 0xCD, 0x03, 0x68, 0xCC, 0xA3, + 0xB9, 0x03, 0x68, 0xCC, 0xA7, 0xA9, 0x03, 0x68, + 0xCC, 0xAE, 0xB9, 0x03, 0x68, 0xCC, 0xB1, 0xB9, + // Bytes 34c0 - 34ff + 0x03, 0x69, 0xCC, 0x80, 0xCD, 0x03, 0x69, 0xCC, + 0x81, 0xCD, 0x03, 0x69, 0xCC, 0x82, 0xCD, 0x03, + 0x69, 0xCC, 0x83, 0xCD, 0x03, 0x69, 0xCC, 0x84, + 0xCD, 0x03, 0x69, 0xCC, 0x86, 0xCD, 0x03, 0x69, + 0xCC, 0x89, 0xCD, 0x03, 0x69, 0xCC, 0x8C, 0xCD, + 0x03, 0x69, 0xCC, 0x8F, 0xCD, 0x03, 0x69, 0xCC, + 0x91, 0xCD, 0x03, 0x69, 0xCC, 0xA3, 0xB9, 0x03, + 0x69, 0xCC, 0xA8, 0xA9, 0x03, 0x69, 0xCC, 0xB0, + // Bytes 3500 - 353f + 0xB9, 0x03, 0x6A, 0xCC, 0x82, 0xCD, 0x03, 0x6A, + 0xCC, 0x8C, 0xCD, 0x03, 0x6B, 0xCC, 0x81, 0xCD, + 0x03, 0x6B, 0xCC, 0x8C, 0xCD, 0x03, 0x6B, 0xCC, + 0xA3, 0xB9, 0x03, 0x6B, 0xCC, 0xA7, 0xA9, 0x03, + 0x6B, 0xCC, 0xB1, 0xB9, 0x03, 0x6C, 0xCC, 0x81, + 0xCD, 0x03, 0x6C, 0xCC, 0x8C, 0xCD, 0x03, 0x6C, + 0xCC, 0xA7, 0xA9, 0x03, 0x6C, 0xCC, 0xAD, 0xB9, + 0x03, 0x6C, 0xCC, 0xB1, 0xB9, 0x03, 0x6D, 0xCC, + // Bytes 3540 - 357f + 0x81, 0xCD, 0x03, 0x6D, 0xCC, 0x87, 0xCD, 0x03, + 0x6D, 0xCC, 0xA3, 0xB9, 0x03, 0x6E, 0xCC, 0x80, + 0xCD, 0x03, 0x6E, 0xCC, 0x81, 0xCD, 0x03, 0x6E, + 0xCC, 0x83, 0xCD, 0x03, 0x6E, 0xCC, 0x87, 0xCD, + 0x03, 0x6E, 0xCC, 0x8C, 0xCD, 0x03, 0x6E, 0xCC, + 0xA3, 0xB9, 0x03, 0x6E, 0xCC, 0xA7, 0xA9, 0x03, + 0x6E, 0xCC, 0xAD, 0xB9, 0x03, 0x6E, 0xCC, 0xB1, + 0xB9, 0x03, 0x6F, 0xCC, 0x80, 0xCD, 0x03, 0x6F, + // Bytes 3580 - 35bf + 0xCC, 0x81, 0xCD, 0x03, 0x6F, 0xCC, 0x86, 0xCD, + 0x03, 0x6F, 0xCC, 0x89, 0xCD, 0x03, 0x6F, 0xCC, + 0x8B, 0xCD, 0x03, 0x6F, 0xCC, 0x8C, 0xCD, 0x03, + 0x6F, 0xCC, 0x8F, 0xCD, 0x03, 0x6F, 0xCC, 0x91, + 0xCD, 0x03, 0x70, 0xCC, 0x81, 0xCD, 0x03, 0x70, + 0xCC, 0x87, 0xCD, 0x03, 0x72, 0xCC, 0x81, 0xCD, + 0x03, 0x72, 0xCC, 0x87, 0xCD, 0x03, 0x72, 0xCC, + 0x8C, 0xCD, 0x03, 0x72, 0xCC, 0x8F, 0xCD, 0x03, + // Bytes 35c0 - 35ff + 0x72, 0xCC, 0x91, 0xCD, 0x03, 0x72, 0xCC, 0xA7, + 0xA9, 0x03, 0x72, 0xCC, 0xB1, 0xB9, 0x03, 0x73, + 0xCC, 0x82, 0xCD, 0x03, 0x73, 0xCC, 0x87, 0xCD, + 0x03, 0x73, 0xCC, 0xA6, 0xB9, 0x03, 0x73, 0xCC, + 0xA7, 0xA9, 0x03, 0x74, 0xCC, 0x87, 0xCD, 0x03, + 0x74, 0xCC, 0x88, 0xCD, 0x03, 0x74, 0xCC, 0x8C, + 0xCD, 0x03, 0x74, 0xCC, 0xA3, 0xB9, 0x03, 0x74, + 0xCC, 0xA6, 0xB9, 0x03, 0x74, 0xCC, 0xA7, 0xA9, + // Bytes 3600 - 363f + 0x03, 0x74, 0xCC, 0xAD, 0xB9, 0x03, 0x74, 0xCC, + 0xB1, 0xB9, 0x03, 0x75, 0xCC, 0x80, 0xCD, 0x03, + 0x75, 0xCC, 0x81, 0xCD, 0x03, 0x75, 0xCC, 0x82, + 0xCD, 0x03, 0x75, 0xCC, 0x86, 0xCD, 0x03, 0x75, + 0xCC, 0x89, 0xCD, 0x03, 0x75, 0xCC, 0x8A, 0xCD, + 0x03, 0x75, 0xCC, 0x8B, 0xCD, 0x03, 0x75, 0xCC, + 0x8C, 0xCD, 0x03, 0x75, 0xCC, 0x8F, 0xCD, 0x03, + 0x75, 0xCC, 0x91, 0xCD, 0x03, 0x75, 0xCC, 0xA3, + // Bytes 3640 - 367f + 0xB9, 0x03, 0x75, 0xCC, 0xA4, 0xB9, 0x03, 0x75, + 0xCC, 0xA8, 0xA9, 0x03, 0x75, 0xCC, 0xAD, 0xB9, + 0x03, 0x75, 0xCC, 0xB0, 0xB9, 0x03, 0x76, 0xCC, + 0x83, 0xCD, 0x03, 0x76, 0xCC, 0xA3, 0xB9, 0x03, + 0x77, 0xCC, 0x80, 0xCD, 0x03, 0x77, 0xCC, 0x81, + 0xCD, 0x03, 0x77, 0xCC, 0x82, 0xCD, 0x03, 0x77, + 0xCC, 0x87, 0xCD, 0x03, 0x77, 0xCC, 0x88, 0xCD, + 0x03, 0x77, 0xCC, 0x8A, 0xCD, 0x03, 0x77, 0xCC, + // Bytes 3680 - 36bf + 0xA3, 0xB9, 0x03, 0x78, 0xCC, 0x87, 0xCD, 0x03, + 0x78, 0xCC, 0x88, 0xCD, 0x03, 0x79, 0xCC, 0x80, + 0xCD, 0x03, 0x79, 0xCC, 0x81, 0xCD, 0x03, 0x79, + 0xCC, 0x82, 0xCD, 0x03, 0x79, 0xCC, 0x83, 0xCD, + 0x03, 0x79, 0xCC, 0x84, 0xCD, 0x03, 0x79, 0xCC, + 0x87, 0xCD, 0x03, 0x79, 0xCC, 0x88, 0xCD, 0x03, + 0x79, 0xCC, 0x89, 0xCD, 0x03, 0x79, 0xCC, 0x8A, + 0xCD, 0x03, 0x79, 0xCC, 0xA3, 0xB9, 0x03, 0x7A, + // Bytes 36c0 - 36ff + 0xCC, 0x81, 0xCD, 0x03, 0x7A, 0xCC, 0x82, 0xCD, + 0x03, 0x7A, 0xCC, 0x87, 0xCD, 0x03, 0x7A, 0xCC, + 0x8C, 0xCD, 0x03, 0x7A, 0xCC, 0xA3, 0xB9, 0x03, + 0x7A, 0xCC, 0xB1, 0xB9, 0x04, 0xC2, 0xA8, 0xCC, + 0x80, 0xCE, 0x04, 0xC2, 0xA8, 0xCC, 0x81, 0xCE, + 0x04, 0xC2, 0xA8, 0xCD, 0x82, 0xCE, 0x04, 0xC3, + 0x86, 0xCC, 0x81, 0xCD, 0x04, 0xC3, 0x86, 0xCC, + 0x84, 0xCD, 0x04, 0xC3, 0x98, 0xCC, 0x81, 0xCD, + // Bytes 3700 - 373f + 0x04, 0xC3, 0xA6, 0xCC, 0x81, 0xCD, 0x04, 0xC3, + 0xA6, 0xCC, 0x84, 0xCD, 0x04, 0xC3, 0xB8, 0xCC, + 0x81, 0xCD, 0x04, 0xC5, 0xBF, 0xCC, 0x87, 0xCD, + 0x04, 0xC6, 0xB7, 0xCC, 0x8C, 0xCD, 0x04, 0xCA, + 0x92, 0xCC, 0x8C, 0xCD, 0x04, 0xCE, 0x91, 0xCC, + 0x80, 0xCD, 0x04, 0xCE, 0x91, 0xCC, 0x81, 0xCD, + 0x04, 0xCE, 0x91, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0x91, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0x91, 0xCD, + // Bytes 3740 - 377f + 0x85, 0xDD, 0x04, 0xCE, 0x95, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0x95, 0xCC, 0x81, 0xCD, 0x04, 0xCE, + 0x97, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0x97, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0x97, 0xCD, 0x85, 0xDD, + 0x04, 0xCE, 0x99, 0xCC, 0x80, 0xCD, 0x04, 0xCE, + 0x99, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0x99, 0xCC, + 0x84, 0xCD, 0x04, 0xCE, 0x99, 0xCC, 0x86, 0xCD, + 0x04, 0xCE, 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xCE, + // Bytes 3780 - 37bf + 0x9F, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0x9F, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0xA1, 0xCC, 0x94, 0xCD, + 0x04, 0xCE, 0xA5, 0xCC, 0x80, 0xCD, 0x04, 0xCE, + 0xA5, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0xA5, 0xCC, + 0x84, 0xCD, 0x04, 0xCE, 0xA5, 0xCC, 0x86, 0xCD, + 0x04, 0xCE, 0xA5, 0xCC, 0x88, 0xCD, 0x04, 0xCE, + 0xA9, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0xA9, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0xA9, 0xCD, 0x85, 0xDD, + // Bytes 37c0 - 37ff + 0x04, 0xCE, 0xB1, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0xB1, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0xB1, 0xCD, + 0x85, 0xDD, 0x04, 0xCE, 0xB5, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0xB5, 0xCC, 0x81, 0xCD, 0x04, 0xCE, + 0xB7, 0xCD, 0x85, 0xDD, 0x04, 0xCE, 0xB9, 0xCC, + 0x80, 0xCD, 0x04, 0xCE, 0xB9, 0xCC, 0x81, 0xCD, + 0x04, 0xCE, 0xB9, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0xB9, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0xB9, 0xCD, + // Bytes 3800 - 383f + 0x82, 0xCD, 0x04, 0xCE, 0xBF, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0xBF, 0xCC, 0x81, 0xCD, 0x04, 0xCF, + 0x81, 0xCC, 0x93, 0xCD, 0x04, 0xCF, 0x81, 0xCC, + 0x94, 0xCD, 0x04, 0xCF, 0x85, 0xCC, 0x80, 0xCD, + 0x04, 0xCF, 0x85, 0xCC, 0x81, 0xCD, 0x04, 0xCF, + 0x85, 0xCC, 0x84, 0xCD, 0x04, 0xCF, 0x85, 0xCC, + 0x86, 0xCD, 0x04, 0xCF, 0x85, 0xCD, 0x82, 0xCD, + 0x04, 0xCF, 0x89, 0xCD, 0x85, 0xDD, 0x04, 0xCF, + // Bytes 3840 - 387f + 0x92, 0xCC, 0x81, 0xCD, 0x04, 0xCF, 0x92, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0x86, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0x90, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0x90, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x93, 0xCC, + 0x81, 0xCD, 0x04, 0xD0, 0x95, 0xCC, 0x80, 0xCD, + 0x04, 0xD0, 0x95, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0x95, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x96, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0x96, 0xCC, 0x88, 0xCD, + // Bytes 3880 - 38bf + 0x04, 0xD0, 0x97, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0x98, 0xCC, 0x80, 0xCD, 0x04, 0xD0, 0x98, 0xCC, + 0x84, 0xCD, 0x04, 0xD0, 0x98, 0xCC, 0x86, 0xCD, + 0x04, 0xD0, 0x98, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0x9A, 0xCC, 0x81, 0xCD, 0x04, 0xD0, 0x9E, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xA3, 0xCC, 0x84, 0xCD, + 0x04, 0xD0, 0xA3, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0xA3, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xA3, 0xCC, + // Bytes 38c0 - 38ff + 0x8B, 0xCD, 0x04, 0xD0, 0xA7, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xAB, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0xAD, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xB0, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0xB0, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xB3, 0xCC, 0x81, 0xCD, 0x04, 0xD0, + 0xB5, 0xCC, 0x80, 0xCD, 0x04, 0xD0, 0xB5, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0xB5, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xB6, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + // Bytes 3900 - 393f + 0xB6, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xB7, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xB8, 0xCC, 0x80, 0xCD, + 0x04, 0xD0, 0xB8, 0xCC, 0x84, 0xCD, 0x04, 0xD0, + 0xB8, 0xCC, 0x86, 0xCD, 0x04, 0xD0, 0xB8, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xBA, 0xCC, 0x81, 0xCD, + 0x04, 0xD0, 0xBE, 0xCC, 0x88, 0xCD, 0x04, 0xD1, + 0x83, 0xCC, 0x84, 0xCD, 0x04, 0xD1, 0x83, 0xCC, + 0x86, 0xCD, 0x04, 0xD1, 0x83, 0xCC, 0x88, 0xCD, + // Bytes 3940 - 397f + 0x04, 0xD1, 0x83, 0xCC, 0x8B, 0xCD, 0x04, 0xD1, + 0x87, 0xCC, 0x88, 0xCD, 0x04, 0xD1, 0x8B, 0xCC, + 0x88, 0xCD, 0x04, 0xD1, 0x8D, 0xCC, 0x88, 0xCD, + 0x04, 0xD1, 0x96, 0xCC, 0x88, 0xCD, 0x04, 0xD1, + 0xB4, 0xCC, 0x8F, 0xCD, 0x04, 0xD1, 0xB5, 0xCC, + 0x8F, 0xCD, 0x04, 0xD3, 0x98, 0xCC, 0x88, 0xCD, + 0x04, 0xD3, 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xD3, + 0xA8, 0xCC, 0x88, 0xCD, 0x04, 0xD3, 0xA9, 0xCC, + // Bytes 3980 - 39bf + 0x88, 0xCD, 0x04, 0xD8, 0xA7, 0xD9, 0x93, 0xCD, + 0x04, 0xD8, 0xA7, 0xD9, 0x94, 0xCD, 0x04, 0xD8, + 0xA7, 0xD9, 0x95, 0xB9, 0x04, 0xD9, 0x88, 0xD9, + 0x94, 0xCD, 0x04, 0xD9, 0x8A, 0xD9, 0x94, 0xCD, + 0x04, 0xDB, 0x81, 0xD9, 0x94, 0xCD, 0x04, 0xDB, + 0x92, 0xD9, 0x94, 0xCD, 0x04, 0xDB, 0x95, 0xD9, + 0x94, 0xCD, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x80, + 0xCE, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x81, 0xCE, + // Bytes 39c0 - 39ff + 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, + 0x41, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x41, + 0xCC, 0x86, 0xCC, 0x80, 0xCE, 0x05, 0x41, 0xCC, + 0x86, 0xCC, 0x81, 0xCE, 0x05, 0x41, 0xCC, 0x86, + 0xCC, 0x83, 0xCE, 0x05, 0x41, 0xCC, 0x86, 0xCC, + 0x89, 0xCE, 0x05, 0x41, 0xCC, 0x87, 0xCC, 0x84, + 0xCE, 0x05, 0x41, 0xCC, 0x88, 0xCC, 0x84, 0xCE, + 0x05, 0x41, 0xCC, 0x8A, 0xCC, 0x81, 0xCE, 0x05, + // Bytes 3a00 - 3a3f + 0x41, 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x41, + 0xCC, 0xA3, 0xCC, 0x86, 0xCE, 0x05, 0x43, 0xCC, + 0xA7, 0xCC, 0x81, 0xCE, 0x05, 0x45, 0xCC, 0x82, + 0xCC, 0x80, 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, + 0x81, 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x83, + 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x89, 0xCE, + 0x05, 0x45, 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05, + 0x45, 0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x45, + // Bytes 3a40 - 3a7f + 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x45, 0xCC, + 0xA7, 0xCC, 0x86, 0xCE, 0x05, 0x49, 0xCC, 0x88, + 0xCC, 0x81, 0xCE, 0x05, 0x4C, 0xCC, 0xA3, 0xCC, + 0x84, 0xCE, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x80, + 0xCE, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x81, 0xCE, + 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, + 0x4F, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x4F, + 0xCC, 0x83, 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC, + // Bytes 3a80 - 3abf + 0x83, 0xCC, 0x84, 0xCE, 0x05, 0x4F, 0xCC, 0x83, + 0xCC, 0x88, 0xCE, 0x05, 0x4F, 0xCC, 0x84, 0xCC, + 0x80, 0xCE, 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x81, + 0xCE, 0x05, 0x4F, 0xCC, 0x87, 0xCC, 0x84, 0xCE, + 0x05, 0x4F, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x4F, 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x4F, + 0xCC, 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC, + 0x9B, 0xCC, 0x83, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, + // Bytes 3ac0 - 3aff + 0xCC, 0x89, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, 0xCC, + 0xA3, 0xBA, 0x05, 0x4F, 0xCC, 0xA3, 0xCC, 0x82, + 0xCE, 0x05, 0x4F, 0xCC, 0xA8, 0xCC, 0x84, 0xCE, + 0x05, 0x52, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05, + 0x53, 0xCC, 0x81, 0xCC, 0x87, 0xCE, 0x05, 0x53, + 0xCC, 0x8C, 0xCC, 0x87, 0xCE, 0x05, 0x53, 0xCC, + 0xA3, 0xCC, 0x87, 0xCE, 0x05, 0x55, 0xCC, 0x83, + 0xCC, 0x81, 0xCE, 0x05, 0x55, 0xCC, 0x84, 0xCC, + // Bytes 3b00 - 3b3f + 0x88, 0xCE, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x81, 0xCE, + 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x55, 0xCC, 0x88, 0xCC, 0x8C, 0xCE, 0x05, 0x55, + 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x55, 0xCC, + 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x55, 0xCC, 0x9B, + 0xCC, 0x83, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, + 0x89, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0xA3, + // Bytes 3b40 - 3b7f + 0xBA, 0x05, 0x61, 0xCC, 0x82, 0xCC, 0x80, 0xCE, + 0x05, 0x61, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, + 0x61, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x61, + 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x61, 0xCC, + 0x86, 0xCC, 0x80, 0xCE, 0x05, 0x61, 0xCC, 0x86, + 0xCC, 0x81, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, + 0x83, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x89, + 0xCE, 0x05, 0x61, 0xCC, 0x87, 0xCC, 0x84, 0xCE, + // Bytes 3b80 - 3bbf + 0x05, 0x61, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x61, 0xCC, 0x8A, 0xCC, 0x81, 0xCE, 0x05, 0x61, + 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x61, 0xCC, + 0xA3, 0xCC, 0x86, 0xCE, 0x05, 0x63, 0xCC, 0xA7, + 0xCC, 0x81, 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, + 0x80, 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x81, + 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x83, 0xCE, + 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, + // Bytes 3bc0 - 3bff + 0x65, 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05, 0x65, + 0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x65, 0xCC, + 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x65, 0xCC, 0xA7, + 0xCC, 0x86, 0xCE, 0x05, 0x69, 0xCC, 0x88, 0xCC, + 0x81, 0xCE, 0x05, 0x6C, 0xCC, 0xA3, 0xCC, 0x84, + 0xCE, 0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x80, 0xCE, + 0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, + 0x6F, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x6F, + // Bytes 3c00 - 3c3f + 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x6F, 0xCC, + 0x83, 0xCC, 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x83, + 0xCC, 0x84, 0xCE, 0x05, 0x6F, 0xCC, 0x83, 0xCC, + 0x88, 0xCE, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x80, + 0xCE, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x81, 0xCE, + 0x05, 0x6F, 0xCC, 0x87, 0xCC, 0x84, 0xCE, 0x05, + 0x6F, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x6F, + 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x6F, 0xCC, + // Bytes 3c40 - 3c7f + 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, + 0xCC, 0x83, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, + 0x89, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0xA3, + 0xBA, 0x05, 0x6F, 0xCC, 0xA3, 0xCC, 0x82, 0xCE, + 0x05, 0x6F, 0xCC, 0xA8, 0xCC, 0x84, 0xCE, 0x05, + 0x72, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05, 0x73, + 0xCC, 0x81, 0xCC, 0x87, 0xCE, 0x05, 0x73, 0xCC, + 0x8C, 0xCC, 0x87, 0xCE, 0x05, 0x73, 0xCC, 0xA3, + // Bytes 3c80 - 3cbf + 0xCC, 0x87, 0xCE, 0x05, 0x75, 0xCC, 0x83, 0xCC, + 0x81, 0xCE, 0x05, 0x75, 0xCC, 0x84, 0xCC, 0x88, + 0xCE, 0x05, 0x75, 0xCC, 0x88, 0xCC, 0x80, 0xCE, + 0x05, 0x75, 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x05, + 0x75, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x75, + 0xCC, 0x88, 0xCC, 0x8C, 0xCE, 0x05, 0x75, 0xCC, + 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x75, 0xCC, 0x9B, + 0xCC, 0x81, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, + // Bytes 3cc0 - 3cff + 0x83, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x89, + 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0xA3, 0xBA, + 0x05, 0xE1, 0xBE, 0xBF, 0xCC, 0x80, 0xCE, 0x05, + 0xE1, 0xBE, 0xBF, 0xCC, 0x81, 0xCE, 0x05, 0xE1, + 0xBE, 0xBF, 0xCD, 0x82, 0xCE, 0x05, 0xE1, 0xBF, + 0xBE, 0xCC, 0x80, 0xCE, 0x05, 0xE1, 0xBF, 0xBE, + 0xCC, 0x81, 0xCE, 0x05, 0xE1, 0xBF, 0xBE, 0xCD, + 0x82, 0xCE, 0x05, 0xE2, 0x86, 0x90, 0xCC, 0xB8, + // Bytes 3d00 - 3d3f + 0x05, 0x05, 0xE2, 0x86, 0x92, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x86, 0x94, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x87, 0x90, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x87, 0x92, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87, + 0x94, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x83, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x88, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x8B, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x88, 0xA3, 0xCC, 0xB8, 0x05, + // Bytes 3d40 - 3d7f + 0x05, 0xE2, 0x88, 0xA5, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x88, 0xBC, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x89, 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, + 0x85, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x88, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x8D, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xA1, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x89, 0xA4, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x89, 0xA5, 0xCC, 0xB8, 0x05, 0x05, + // Bytes 3d80 - 3dbf + 0xE2, 0x89, 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x89, 0xB3, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, + 0xB6, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB7, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBA, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBB, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x89, 0xBC, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x89, 0xBD, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x8A, 0x82, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + // Bytes 3dc0 - 3dff + 0x8A, 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, + 0x86, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x87, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x91, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x92, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x8A, 0xA2, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x8A, 0xA8, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x8A, 0xA9, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x8A, 0xAB, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, + // Bytes 3e00 - 3e3f + 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB3, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB4, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB5, 0xCC, 0xB8, + 0x05, 0x06, 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x80, + // Bytes 3e40 - 3e7f + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 3e80 - 3ebf + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x82, + // Bytes 3ec0 - 3eff + 0xCE, 0x06, 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x80, + // Bytes 3f00 - 3f3f + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB7, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCD, 0x82, 0xCD, 0x85, + // Bytes 3f40 - 3f7f + 0xDE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 3f80 - 3fbf + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x82, + // Bytes 3fc0 - 3fff + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x85, + // Bytes 4000 - 403f + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x85, + 0xDE, 0x06, 0xE0, 0xA4, 0xA8, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xA4, 0xB0, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xA4, 0xB3, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xB1, 0x86, 0xE0, 0xB1, 0x96, + 0x89, 0x06, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8A, + // Bytes 4040 - 407f + 0x15, 0x06, 0xE3, 0x81, 0x86, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x91, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x93, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x95, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x97, 0xE3, 0x82, 0x99, + // Bytes 4080 - 40bf + 0x11, 0x06, 0xE3, 0x81, 0x99, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA1, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA4, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA6, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA8, 0xE3, 0x82, 0x99, + // Bytes 40c0 - 40ff + 0x11, 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x9A, + // Bytes 4100 - 413f + 0x11, 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x82, 0x9D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xA6, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, + // Bytes 4140 - 417f + 0x11, 0x06, 0xE3, 0x82, 0xB3, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB9, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBD, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x81, 0xE3, 0x82, 0x99, + // Bytes 4180 - 41bf + 0x11, 0x06, 0xE3, 0x83, 0x84, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x86, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, + // Bytes 41c0 - 41ff + 0x11, 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xB0, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xB1, 0xE3, 0x82, 0x99, + // Bytes 4200 - 423f + 0x11, 0x06, 0xE3, 0x83, 0xB2, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xBD, 0xE3, 0x82, 0x99, + 0x11, 0x08, 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 4240 - 427f + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x94, + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + // Bytes 4280 - 42bf + 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x94, + // Bytes 42c0 - 42ff + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + // Bytes 4300 - 433f + 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x94, + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, + // Bytes 4340 - 437f + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + 0xDF, 0x08, 0xF0, 0x91, 0x82, 0x99, 0xF0, 0x91, + // Bytes 4380 - 43bf + 0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91, 0x82, 0x9B, + 0xF0, 0x91, 0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91, + 0x82, 0xA5, 0xF0, 0x91, 0x82, 0xBA, 0x0D, 0x42, + 0xC2, 0xB4, 0x01, 0x43, 0x20, 0xCC, 0x81, 0xCD, + 0x43, 0x20, 0xCC, 0x83, 0xCD, 0x43, 0x20, 0xCC, + 0x84, 0xCD, 0x43, 0x20, 0xCC, 0x85, 0xCD, 0x43, + 0x20, 0xCC, 0x86, 0xCD, 0x43, 0x20, 0xCC, 0x87, + 0xCD, 0x43, 0x20, 0xCC, 0x88, 0xCD, 0x43, 0x20, + // Bytes 43c0 - 43ff + 0xCC, 0x8A, 0xCD, 0x43, 0x20, 0xCC, 0x8B, 0xCD, + 0x43, 0x20, 0xCC, 0x93, 0xCD, 0x43, 0x20, 0xCC, + 0x94, 0xCD, 0x43, 0x20, 0xCC, 0xA7, 0xA9, 0x43, + 0x20, 0xCC, 0xA8, 0xA9, 0x43, 0x20, 0xCC, 0xB3, + 0xB9, 0x43, 0x20, 0xCD, 0x82, 0xCD, 0x43, 0x20, + 0xCD, 0x85, 0xDD, 0x43, 0x20, 0xD9, 0x8B, 0x5D, + 0x43, 0x20, 0xD9, 0x8C, 0x61, 0x43, 0x20, 0xD9, + 0x8D, 0x65, 0x43, 0x20, 0xD9, 0x8E, 0x69, 0x43, + // Bytes 4400 - 443f + 0x20, 0xD9, 0x8F, 0x6D, 0x43, 0x20, 0xD9, 0x90, + 0x71, 0x43, 0x20, 0xD9, 0x91, 0x75, 0x43, 0x20, + 0xD9, 0x92, 0x79, 0x43, 0x41, 0xCC, 0x8A, 0xCD, + 0x43, 0x73, 0xCC, 0x87, 0xCD, 0x44, 0x20, 0xE3, + 0x82, 0x99, 0x11, 0x44, 0x20, 0xE3, 0x82, 0x9A, + 0x11, 0x44, 0xC2, 0xA8, 0xCC, 0x81, 0xCE, 0x44, + 0xCE, 0x91, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x95, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x97, 0xCC, 0x81, + // Bytes 4440 - 447f + 0xCD, 0x44, 0xCE, 0x99, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0x9F, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xA5, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xA5, 0xCC, 0x88, + 0xCD, 0x44, 0xCE, 0xA9, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB5, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB7, 0xCC, 0x81, + 0xCD, 0x44, 0xCE, 0xB9, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0xBF, 0xCC, 0x81, 0xCD, 0x44, 0xCF, 0x85, + // Bytes 4480 - 44bf + 0xCC, 0x81, 0xCD, 0x44, 0xCF, 0x89, 0xCC, 0x81, + 0xCD, 0x44, 0xD7, 0x90, 0xD6, 0xB7, 0x35, 0x44, + 0xD7, 0x90, 0xD6, 0xB8, 0x39, 0x44, 0xD7, 0x90, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x91, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x91, 0xD6, 0xBF, 0x4D, 0x44, + 0xD7, 0x92, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x93, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x94, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x95, 0xD6, 0xB9, 0x3D, 0x44, + // Bytes 44c0 - 44ff + 0xD7, 0x95, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x96, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x98, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x99, 0xD6, 0xB4, 0x29, 0x44, + 0xD7, 0x99, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9A, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9B, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x9B, 0xD6, 0xBF, 0x4D, 0x44, + 0xD7, 0x9C, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9E, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA0, 0xD6, 0xBC, + // Bytes 4500 - 453f + 0x45, 0x44, 0xD7, 0xA1, 0xD6, 0xBC, 0x45, 0x44, + 0xD7, 0xA3, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA4, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA4, 0xD6, 0xBF, + 0x4D, 0x44, 0xD7, 0xA6, 0xD6, 0xBC, 0x45, 0x44, + 0xD7, 0xA7, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA8, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA9, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0xA9, 0xD7, 0x81, 0x51, 0x44, + 0xD7, 0xA9, 0xD7, 0x82, 0x55, 0x44, 0xD7, 0xAA, + // Bytes 4540 - 457f + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xB2, 0xD6, 0xB7, + 0x35, 0x44, 0xD8, 0xA7, 0xD9, 0x8B, 0x5D, 0x44, + 0xD8, 0xA7, 0xD9, 0x93, 0xCD, 0x44, 0xD8, 0xA7, + 0xD9, 0x94, 0xCD, 0x44, 0xD8, 0xA7, 0xD9, 0x95, + 0xB9, 0x44, 0xD8, 0xB0, 0xD9, 0xB0, 0x7D, 0x44, + 0xD8, 0xB1, 0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x80, + 0xD9, 0x8B, 0x5D, 0x44, 0xD9, 0x80, 0xD9, 0x8E, + 0x69, 0x44, 0xD9, 0x80, 0xD9, 0x8F, 0x6D, 0x44, + // Bytes 4580 - 45bf + 0xD9, 0x80, 0xD9, 0x90, 0x71, 0x44, 0xD9, 0x80, + 0xD9, 0x91, 0x75, 0x44, 0xD9, 0x80, 0xD9, 0x92, + 0x79, 0x44, 0xD9, 0x87, 0xD9, 0xB0, 0x7D, 0x44, + 0xD9, 0x88, 0xD9, 0x94, 0xCD, 0x44, 0xD9, 0x89, + 0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x8A, 0xD9, 0x94, + 0xCD, 0x44, 0xDB, 0x92, 0xD9, 0x94, 0xCD, 0x44, + 0xDB, 0x95, 0xD9, 0x94, 0xCD, 0x45, 0x20, 0xCC, + 0x88, 0xCC, 0x80, 0xCE, 0x45, 0x20, 0xCC, 0x88, + // Bytes 45c0 - 45ff + 0xCC, 0x81, 0xCE, 0x45, 0x20, 0xCC, 0x88, 0xCD, + 0x82, 0xCE, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x81, 0xCE, + 0x45, 0x20, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x45, + 0x20, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x45, 0x20, + 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x45, 0x20, 0xCC, + 0x94, 0xCD, 0x82, 0xCE, 0x45, 0x20, 0xD9, 0x8C, + 0xD9, 0x91, 0x76, 0x45, 0x20, 0xD9, 0x8D, 0xD9, + // Bytes 4600 - 463f + 0x91, 0x76, 0x45, 0x20, 0xD9, 0x8E, 0xD9, 0x91, + 0x76, 0x45, 0x20, 0xD9, 0x8F, 0xD9, 0x91, 0x76, + 0x45, 0x20, 0xD9, 0x90, 0xD9, 0x91, 0x76, 0x45, + 0x20, 0xD9, 0x91, 0xD9, 0xB0, 0x7E, 0x45, 0xE2, + 0xAB, 0x9D, 0xCC, 0xB8, 0x05, 0x46, 0xCE, 0xB9, + 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x46, 0xCF, 0x85, + 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x46, 0xD7, 0xA9, + 0xD6, 0xBC, 0xD7, 0x81, 0x52, 0x46, 0xD7, 0xA9, + // Bytes 4640 - 467f + 0xD6, 0xBC, 0xD7, 0x82, 0x56, 0x46, 0xD9, 0x80, + 0xD9, 0x8E, 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80, + 0xD9, 0x8F, 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80, + 0xD9, 0x90, 0xD9, 0x91, 0x76, 0x46, 0xE0, 0xA4, + 0x95, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x96, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x97, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x9C, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + // Bytes 4680 - 46bf + 0xA1, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xA2, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xAB, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xAF, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xA1, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xA2, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xAF, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0x96, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + // Bytes 46c0 - 46ff + 0x97, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0x9C, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xAB, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xB2, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xB8, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xAC, + 0xA1, 0xE0, 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xAC, + 0xA2, 0xE0, 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xBE, + 0xB2, 0xE0, 0xBE, 0x80, 0xA1, 0x46, 0xE0, 0xBE, + // Bytes 4700 - 473f + 0xB3, 0xE0, 0xBE, 0x80, 0xA1, 0x46, 0xE3, 0x83, + 0x86, 0xE3, 0x82, 0x99, 0x11, 0x48, 0xF0, 0x9D, + 0x85, 0x97, 0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x48, + 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, + 0xB1, 0x48, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, + 0x85, 0xA5, 0xB1, 0x48, 0xF0, 0x9D, 0x86, 0xBA, + 0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x49, 0xE0, 0xBE, + 0xB2, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2, + // Bytes 4740 - 477f + 0x49, 0xE0, 0xBE, 0xB3, 0xE0, 0xBD, 0xB1, 0xE0, + 0xBE, 0x80, 0xA2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, + 0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, + 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x4C, + 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, + 0xF0, 0x9D, 0x85, 0xB0, 0xB2, 0x4C, 0xF0, 0x9D, + 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, + // Bytes 4780 - 47bf + 0x85, 0xB1, 0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xB2, + 0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, + 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xB2, 0x4C, + 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, + 0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x4C, 0xF0, 0x9D, + 0x86, 0xBA, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, + 0x85, 0xAE, 0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xBA, + // Bytes 47c0 - 47ff + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, + 0xB2, 0x83, 0x41, 0xCC, 0x82, 0xCD, 0x83, 0x41, + 0xCC, 0x86, 0xCD, 0x83, 0x41, 0xCC, 0x87, 0xCD, + 0x83, 0x41, 0xCC, 0x88, 0xCD, 0x83, 0x41, 0xCC, + 0x8A, 0xCD, 0x83, 0x41, 0xCC, 0xA3, 0xB9, 0x83, + 0x43, 0xCC, 0xA7, 0xA9, 0x83, 0x45, 0xCC, 0x82, + 0xCD, 0x83, 0x45, 0xCC, 0x84, 0xCD, 0x83, 0x45, + 0xCC, 0xA3, 0xB9, 0x83, 0x45, 0xCC, 0xA7, 0xA9, + // Bytes 4800 - 483f + 0x83, 0x49, 0xCC, 0x88, 0xCD, 0x83, 0x4C, 0xCC, + 0xA3, 0xB9, 0x83, 0x4F, 0xCC, 0x82, 0xCD, 0x83, + 0x4F, 0xCC, 0x83, 0xCD, 0x83, 0x4F, 0xCC, 0x84, + 0xCD, 0x83, 0x4F, 0xCC, 0x87, 0xCD, 0x83, 0x4F, + 0xCC, 0x88, 0xCD, 0x83, 0x4F, 0xCC, 0x9B, 0xB1, + 0x83, 0x4F, 0xCC, 0xA3, 0xB9, 0x83, 0x4F, 0xCC, + 0xA8, 0xA9, 0x83, 0x52, 0xCC, 0xA3, 0xB9, 0x83, + 0x53, 0xCC, 0x81, 0xCD, 0x83, 0x53, 0xCC, 0x8C, + // Bytes 4840 - 487f + 0xCD, 0x83, 0x53, 0xCC, 0xA3, 0xB9, 0x83, 0x55, + 0xCC, 0x83, 0xCD, 0x83, 0x55, 0xCC, 0x84, 0xCD, + 0x83, 0x55, 0xCC, 0x88, 0xCD, 0x83, 0x55, 0xCC, + 0x9B, 0xB1, 0x83, 0x61, 0xCC, 0x82, 0xCD, 0x83, + 0x61, 0xCC, 0x86, 0xCD, 0x83, 0x61, 0xCC, 0x87, + 0xCD, 0x83, 0x61, 0xCC, 0x88, 0xCD, 0x83, 0x61, + 0xCC, 0x8A, 0xCD, 0x83, 0x61, 0xCC, 0xA3, 0xB9, + 0x83, 0x63, 0xCC, 0xA7, 0xA9, 0x83, 0x65, 0xCC, + // Bytes 4880 - 48bf + 0x82, 0xCD, 0x83, 0x65, 0xCC, 0x84, 0xCD, 0x83, + 0x65, 0xCC, 0xA3, 0xB9, 0x83, 0x65, 0xCC, 0xA7, + 0xA9, 0x83, 0x69, 0xCC, 0x88, 0xCD, 0x83, 0x6C, + 0xCC, 0xA3, 0xB9, 0x83, 0x6F, 0xCC, 0x82, 0xCD, + 0x83, 0x6F, 0xCC, 0x83, 0xCD, 0x83, 0x6F, 0xCC, + 0x84, 0xCD, 0x83, 0x6F, 0xCC, 0x87, 0xCD, 0x83, + 0x6F, 0xCC, 0x88, 0xCD, 0x83, 0x6F, 0xCC, 0x9B, + 0xB1, 0x83, 0x6F, 0xCC, 0xA3, 0xB9, 0x83, 0x6F, + // Bytes 48c0 - 48ff + 0xCC, 0xA8, 0xA9, 0x83, 0x72, 0xCC, 0xA3, 0xB9, + 0x83, 0x73, 0xCC, 0x81, 0xCD, 0x83, 0x73, 0xCC, + 0x8C, 0xCD, 0x83, 0x73, 0xCC, 0xA3, 0xB9, 0x83, + 0x75, 0xCC, 0x83, 0xCD, 0x83, 0x75, 0xCC, 0x84, + 0xCD, 0x83, 0x75, 0xCC, 0x88, 0xCD, 0x83, 0x75, + 0xCC, 0x9B, 0xB1, 0x84, 0xCE, 0x91, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0x95, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x95, + // Bytes 4900 - 493f + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x97, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x99, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x9F, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x9F, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xA9, + 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xA9, 0xCC, 0x94, + 0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x84, + // Bytes 4940 - 497f + 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x84, 0xCE, 0xB1, + 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x94, + 0xCD, 0x84, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x84, + 0xCE, 0xB5, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB5, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x80, + 0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x84, + 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB7, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xB7, 0xCD, 0x82, + // Bytes 4980 - 49bf + 0xCD, 0x84, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x84, + 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB9, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xBF, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0xBF, 0xCC, 0x94, 0xCD, 0x84, + 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x84, 0xCF, 0x85, + 0xCC, 0x93, 0xCD, 0x84, 0xCF, 0x85, 0xCC, 0x94, + 0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x84, + 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x84, 0xCF, 0x89, + // Bytes 49c0 - 49ff + 0xCC, 0x93, 0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x94, + 0xCD, 0x84, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + // Bytes 4a00 - 4a3f + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + // Bytes 4a40 - 4a7f + 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + // Bytes 4a80 - 4abf + 0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + // Bytes 4ac0 - 4aff + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x42, + 0xCC, 0x80, 0xCD, 0x33, 0x42, 0xCC, 0x81, 0xCD, + 0x33, 0x42, 0xCC, 0x93, 0xCD, 0x33, 0x43, 0xE1, + // Bytes 4b00 - 4b3f + 0x85, 0xA1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA2, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA3, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xA4, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xA5, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA6, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA7, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xA8, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xA9, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAA, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAB, 0x01, 0x00, + // Bytes 4b40 - 4b7f + 0x43, 0xE1, 0x85, 0xAC, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAE, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAF, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xB0, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xB1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB2, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB3, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xB4, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xB5, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAA, + // Bytes 4b80 - 4bbf + 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAC, 0x01, 0x00, + 0x43, 0xE1, 0x86, 0xAD, 0x01, 0x00, 0x43, 0xE1, + 0x86, 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB1, + 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB2, 0x01, 0x00, + 0x43, 0xE1, 0x86, 0xB3, 0x01, 0x00, 0x43, 0xE1, + 0x86, 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB5, + 0x01, 0x00, 0x44, 0xCC, 0x88, 0xCC, 0x81, 0xCE, + 0x33, 0x43, 0xE3, 0x82, 0x99, 0x11, 0x04, 0x43, + // Bytes 4bc0 - 4bff + 0xE3, 0x82, 0x9A, 0x11, 0x04, 0x46, 0xE0, 0xBD, + 0xB1, 0xE0, 0xBD, 0xB2, 0xA2, 0x27, 0x46, 0xE0, + 0xBD, 0xB1, 0xE0, 0xBD, 0xB4, 0xA6, 0x27, 0x46, + 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2, 0x27, + 0x00, 0x01, +} + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfcTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfcTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfcValues[c0] + } + i := nfcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfcTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfcTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfcValues[c0] + } + i := nfcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// nfcTrie. Total size: 10798 bytes (10.54 KiB). Checksum: b5981cc85e3bd14. +type nfcTrie struct{} + +func newNfcTrie(i int) *nfcTrie { + return &nfcTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *nfcTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 46: + return uint16(nfcValues[n<<6+uint32(b)]) + default: + n -= 46 + return uint16(nfcSparse.lookup(n, b)) + } +} + +// nfcValues: 48 blocks, 3072 entries, 6144 bytes +// The third block is the zero block. +var nfcValues = [3072]uint16{ + // Block 0x0, offset 0x0 + 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, + // Block 0x1, offset 0x40 + 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, + 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, + 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, + 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, + 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, + 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, + 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, + 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, + 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, + 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x30b0, 0xc1: 0x30b5, 0xc2: 0x47c9, 0xc3: 0x30ba, 0xc4: 0x47d8, 0xc5: 0x47dd, + 0xc6: 0xa000, 0xc7: 0x47e7, 0xc8: 0x3123, 0xc9: 0x3128, 0xca: 0x47ec, 0xcb: 0x313c, + 0xcc: 0x31af, 0xcd: 0x31b4, 0xce: 0x31b9, 0xcf: 0x4800, 0xd1: 0x3245, + 0xd2: 0x3268, 0xd3: 0x326d, 0xd4: 0x480a, 0xd5: 0x480f, 0xd6: 0x481e, + 0xd8: 0xa000, 0xd9: 0x32f4, 0xda: 0x32f9, 0xdb: 0x32fe, 0xdc: 0x4850, 0xdd: 0x3376, + 0xe0: 0x33bc, 0xe1: 0x33c1, 0xe2: 0x485a, 0xe3: 0x33c6, + 0xe4: 0x4869, 0xe5: 0x486e, 0xe6: 0xa000, 0xe7: 0x4878, 0xe8: 0x342f, 0xe9: 0x3434, + 0xea: 0x487d, 0xeb: 0x3448, 0xec: 0x34c0, 0xed: 0x34c5, 0xee: 0x34ca, 0xef: 0x4891, + 0xf1: 0x3556, 0xf2: 0x3579, 0xf3: 0x357e, 0xf4: 0x489b, 0xf5: 0x48a0, + 0xf6: 0x48af, 0xf8: 0xa000, 0xf9: 0x360a, 0xfa: 0x360f, 0xfb: 0x3614, + 0xfc: 0x48e1, 0xfd: 0x3691, 0xff: 0x36aa, + // Block 0x4, offset 0x100 + 0x100: 0x30bf, 0x101: 0x33cb, 0x102: 0x47ce, 0x103: 0x485f, 0x104: 0x30dd, 0x105: 0x33e9, + 0x106: 0x30f1, 0x107: 0x33fd, 0x108: 0x30f6, 0x109: 0x3402, 0x10a: 0x30fb, 0x10b: 0x3407, + 0x10c: 0x3100, 0x10d: 0x340c, 0x10e: 0x310a, 0x10f: 0x3416, + 0x112: 0x47f1, 0x113: 0x4882, 0x114: 0x3132, 0x115: 0x343e, 0x116: 0x3137, 0x117: 0x3443, + 0x118: 0x3155, 0x119: 0x3461, 0x11a: 0x3146, 0x11b: 0x3452, 0x11c: 0x316e, 0x11d: 0x347a, + 0x11e: 0x3178, 0x11f: 0x3484, 0x120: 0x317d, 0x121: 0x3489, 0x122: 0x3187, 0x123: 0x3493, + 0x124: 0x318c, 0x125: 0x3498, 0x128: 0x31be, 0x129: 0x34cf, + 0x12a: 0x31c3, 0x12b: 0x34d4, 0x12c: 0x31c8, 0x12d: 0x34d9, 0x12e: 0x31eb, 0x12f: 0x34f7, + 0x130: 0x31cd, 0x134: 0x31f5, 0x135: 0x3501, + 0x136: 0x3209, 0x137: 0x351a, 0x139: 0x3213, 0x13a: 0x3524, 0x13b: 0x321d, + 0x13c: 0x352e, 0x13d: 0x3218, 0x13e: 0x3529, + // Block 0x5, offset 0x140 + 0x143: 0x3240, 0x144: 0x3551, 0x145: 0x3259, + 0x146: 0x356a, 0x147: 0x324f, 0x148: 0x3560, + 0x14c: 0x4814, 0x14d: 0x48a5, 0x14e: 0x3272, 0x14f: 0x3583, 0x150: 0x327c, 0x151: 0x358d, + 0x154: 0x329a, 0x155: 0x35ab, 0x156: 0x32b3, 0x157: 0x35c4, + 0x158: 0x32a4, 0x159: 0x35b5, 0x15a: 0x4837, 0x15b: 0x48c8, 0x15c: 0x32bd, 0x15d: 0x35ce, + 0x15e: 0x32cc, 0x15f: 0x35dd, 0x160: 0x483c, 0x161: 0x48cd, 0x162: 0x32e5, 0x163: 0x35fb, + 0x164: 0x32d6, 0x165: 0x35ec, 0x168: 0x4846, 0x169: 0x48d7, + 0x16a: 0x484b, 0x16b: 0x48dc, 0x16c: 0x3303, 0x16d: 0x3619, 0x16e: 0x330d, 0x16f: 0x3623, + 0x170: 0x3312, 0x171: 0x3628, 0x172: 0x3330, 0x173: 0x3646, 0x174: 0x3353, 0x175: 0x3669, + 0x176: 0x337b, 0x177: 0x3696, 0x178: 0x338f, 0x179: 0x339e, 0x17a: 0x36be, 0x17b: 0x33a8, + 0x17c: 0x36c8, 0x17d: 0x33ad, 0x17e: 0x36cd, 0x17f: 0xa000, + // Block 0x6, offset 0x180 + 0x184: 0x8100, 0x185: 0x8100, + 0x186: 0x8100, + 0x18d: 0x30c9, 0x18e: 0x33d5, 0x18f: 0x31d7, 0x190: 0x34e3, 0x191: 0x3281, + 0x192: 0x3592, 0x193: 0x3317, 0x194: 0x362d, 0x195: 0x3b10, 0x196: 0x3c9f, 0x197: 0x3b09, + 0x198: 0x3c98, 0x199: 0x3b17, 0x19a: 0x3ca6, 0x19b: 0x3b02, 0x19c: 0x3c91, + 0x19e: 0x39f1, 0x19f: 0x3b80, 0x1a0: 0x39ea, 0x1a1: 0x3b79, 0x1a2: 0x36f4, 0x1a3: 0x3706, + 0x1a6: 0x3182, 0x1a7: 0x348e, 0x1a8: 0x31ff, 0x1a9: 0x3510, + 0x1aa: 0x482d, 0x1ab: 0x48be, 0x1ac: 0x3ad1, 0x1ad: 0x3c60, 0x1ae: 0x3718, 0x1af: 0x371e, + 0x1b0: 0x3506, 0x1b4: 0x3169, 0x1b5: 0x3475, + 0x1b8: 0x323b, 0x1b9: 0x354c, 0x1ba: 0x39f8, 0x1bb: 0x3b87, + 0x1bc: 0x36ee, 0x1bd: 0x3700, 0x1be: 0x36fa, 0x1bf: 0x370c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x30ce, 0x1c1: 0x33da, 0x1c2: 0x30d3, 0x1c3: 0x33df, 0x1c4: 0x314b, 0x1c5: 0x3457, + 0x1c6: 0x3150, 0x1c7: 0x345c, 0x1c8: 0x31dc, 0x1c9: 0x34e8, 0x1ca: 0x31e1, 0x1cb: 0x34ed, + 0x1cc: 0x3286, 0x1cd: 0x3597, 0x1ce: 0x328b, 0x1cf: 0x359c, 0x1d0: 0x32a9, 0x1d1: 0x35ba, + 0x1d2: 0x32ae, 0x1d3: 0x35bf, 0x1d4: 0x331c, 0x1d5: 0x3632, 0x1d6: 0x3321, 0x1d7: 0x3637, + 0x1d8: 0x32c7, 0x1d9: 0x35d8, 0x1da: 0x32e0, 0x1db: 0x35f6, + 0x1de: 0x319b, 0x1df: 0x34a7, + 0x1e6: 0x47d3, 0x1e7: 0x4864, 0x1e8: 0x47fb, 0x1e9: 0x488c, + 0x1ea: 0x3aa0, 0x1eb: 0x3c2f, 0x1ec: 0x3a7d, 0x1ed: 0x3c0c, 0x1ee: 0x4819, 0x1ef: 0x48aa, + 0x1f0: 0x3a99, 0x1f1: 0x3c28, 0x1f2: 0x3385, 0x1f3: 0x36a0, + // Block 0x8, offset 0x200 + 0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133, + 0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933, + 0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933, + 0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e, + 0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e, + 0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e, + 0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e, + 0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e, + 0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101, + 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e, + 0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133, + // Block 0x9, offset 0x240 + 0x240: 0x4aef, 0x241: 0x4af4, 0x242: 0x9933, 0x243: 0x4af9, 0x244: 0x4bb2, 0x245: 0x9937, + 0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133, + 0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133, + 0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133, + 0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136, + 0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133, + 0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133, + 0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133, + 0x274: 0x01ee, + 0x27a: 0x8100, + 0x27e: 0x0037, + // Block 0xa, offset 0x280 + 0x284: 0x8100, 0x285: 0x36e2, + 0x286: 0x372a, 0x287: 0x00ce, 0x288: 0x3748, 0x289: 0x3754, 0x28a: 0x3766, + 0x28c: 0x3784, 0x28e: 0x3796, 0x28f: 0x37b4, 0x290: 0x3f49, 0x291: 0xa000, + 0x295: 0xa000, 0x297: 0xa000, + 0x299: 0xa000, + 0x29f: 0xa000, 0x2a1: 0xa000, + 0x2a5: 0xa000, 0x2a9: 0xa000, + 0x2aa: 0x3778, 0x2ab: 0x37a8, 0x2ac: 0x493f, 0x2ad: 0x37d8, 0x2ae: 0x4969, 0x2af: 0x37ea, + 0x2b0: 0x3fb1, 0x2b1: 0xa000, 0x2b5: 0xa000, + 0x2b7: 0xa000, 0x2b9: 0xa000, + 0x2bf: 0xa000, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x3862, 0x2c1: 0x386e, 0x2c3: 0x385c, + 0x2c6: 0xa000, 0x2c7: 0x384a, + 0x2cc: 0x389e, 0x2cd: 0x3886, 0x2ce: 0x38b0, 0x2d0: 0xa000, + 0x2d3: 0xa000, 0x2d5: 0xa000, 0x2d6: 0xa000, 0x2d7: 0xa000, + 0x2d8: 0xa000, 0x2d9: 0x3892, 0x2da: 0xa000, + 0x2de: 0xa000, 0x2e3: 0xa000, + 0x2e7: 0xa000, + 0x2eb: 0xa000, 0x2ed: 0xa000, + 0x2f0: 0xa000, 0x2f3: 0xa000, 0x2f5: 0xa000, + 0x2f6: 0xa000, 0x2f7: 0xa000, 0x2f8: 0xa000, 0x2f9: 0x3916, 0x2fa: 0xa000, + 0x2fe: 0xa000, + // Block 0xc, offset 0x300 + 0x301: 0x3874, 0x302: 0x38f8, + 0x310: 0x3850, 0x311: 0x38d4, + 0x312: 0x3856, 0x313: 0x38da, 0x316: 0x3868, 0x317: 0x38ec, + 0x318: 0xa000, 0x319: 0xa000, 0x31a: 0x396a, 0x31b: 0x3970, 0x31c: 0x387a, 0x31d: 0x38fe, + 0x31e: 0x3880, 0x31f: 0x3904, 0x322: 0x388c, 0x323: 0x3910, + 0x324: 0x3898, 0x325: 0x391c, 0x326: 0x38a4, 0x327: 0x3928, 0x328: 0xa000, 0x329: 0xa000, + 0x32a: 0x3976, 0x32b: 0x397c, 0x32c: 0x38ce, 0x32d: 0x3952, 0x32e: 0x38aa, 0x32f: 0x392e, + 0x330: 0x38b6, 0x331: 0x393a, 0x332: 0x38bc, 0x333: 0x3940, 0x334: 0x38c2, 0x335: 0x3946, + 0x338: 0x38c8, 0x339: 0x394c, + // Block 0xd, offset 0x340 + 0x351: 0x812e, + 0x352: 0x8133, 0x353: 0x8133, 0x354: 0x8133, 0x355: 0x8133, 0x356: 0x812e, 0x357: 0x8133, + 0x358: 0x8133, 0x359: 0x8133, 0x35a: 0x812f, 0x35b: 0x812e, 0x35c: 0x8133, 0x35d: 0x8133, + 0x35e: 0x8133, 0x35f: 0x8133, 0x360: 0x8133, 0x361: 0x8133, 0x362: 0x812e, 0x363: 0x812e, + 0x364: 0x812e, 0x365: 0x812e, 0x366: 0x812e, 0x367: 0x812e, 0x368: 0x8133, 0x369: 0x8133, + 0x36a: 0x812e, 0x36b: 0x8133, 0x36c: 0x8133, 0x36d: 0x812f, 0x36e: 0x8132, 0x36f: 0x8133, + 0x370: 0x8106, 0x371: 0x8107, 0x372: 0x8108, 0x373: 0x8109, 0x374: 0x810a, 0x375: 0x810b, + 0x376: 0x810c, 0x377: 0x810d, 0x378: 0x810e, 0x379: 0x810f, 0x37a: 0x810f, 0x37b: 0x8110, + 0x37c: 0x8111, 0x37d: 0x8112, 0x37f: 0x8113, + // Block 0xe, offset 0x380 + 0x388: 0xa000, 0x38a: 0xa000, 0x38b: 0x8117, + 0x38c: 0x8118, 0x38d: 0x8119, 0x38e: 0x811a, 0x38f: 0x811b, 0x390: 0x811c, 0x391: 0x811d, + 0x392: 0x811e, 0x393: 0x9933, 0x394: 0x9933, 0x395: 0x992e, 0x396: 0x812e, 0x397: 0x8133, + 0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x8133, 0x39b: 0x8133, 0x39c: 0x812e, 0x39d: 0x8133, + 0x39e: 0x8133, 0x39f: 0x812e, + 0x3b0: 0x811f, + // Block 0xf, offset 0x3c0 + 0x3ca: 0x8133, 0x3cb: 0x8133, + 0x3cc: 0x8133, 0x3cd: 0x8133, 0x3ce: 0x8133, 0x3cf: 0x812e, 0x3d0: 0x812e, 0x3d1: 0x812e, + 0x3d2: 0x812e, 0x3d3: 0x812e, 0x3d4: 0x8133, 0x3d5: 0x8133, 0x3d6: 0x8133, 0x3d7: 0x8133, + 0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x8133, 0x3dd: 0x8133, + 0x3de: 0x8133, 0x3df: 0x8133, 0x3e0: 0x8133, 0x3e1: 0x8133, 0x3e3: 0x812e, + 0x3e4: 0x8133, 0x3e5: 0x8133, 0x3e6: 0x812e, 0x3e7: 0x8133, 0x3e8: 0x8133, 0x3e9: 0x812e, + 0x3ea: 0x8133, 0x3eb: 0x8133, 0x3ec: 0x8133, 0x3ed: 0x812e, 0x3ee: 0x812e, 0x3ef: 0x812e, + 0x3f0: 0x8117, 0x3f1: 0x8118, 0x3f2: 0x8119, 0x3f3: 0x8133, 0x3f4: 0x8133, 0x3f5: 0x8133, + 0x3f6: 0x812e, 0x3f7: 0x8133, 0x3f8: 0x8133, 0x3f9: 0x812e, 0x3fa: 0x812e, 0x3fb: 0x8133, + 0x3fc: 0x8133, 0x3fd: 0x8133, 0x3fe: 0x8133, 0x3ff: 0x8133, + // Block 0x10, offset 0x400 + 0x405: 0xa000, + 0x406: 0x2e5d, 0x407: 0xa000, 0x408: 0x2e65, 0x409: 0xa000, 0x40a: 0x2e6d, 0x40b: 0xa000, + 0x40c: 0x2e75, 0x40d: 0xa000, 0x40e: 0x2e7d, 0x411: 0xa000, + 0x412: 0x2e85, + 0x434: 0x8103, 0x435: 0x9900, + 0x43a: 0xa000, 0x43b: 0x2e8d, + 0x43c: 0xa000, 0x43d: 0x2e95, 0x43e: 0xa000, 0x43f: 0xa000, + // Block 0x11, offset 0x440 + 0x440: 0x8133, 0x441: 0x8133, 0x442: 0x812e, 0x443: 0x8133, 0x444: 0x8133, 0x445: 0x8133, + 0x446: 0x8133, 0x447: 0x8133, 0x448: 0x8133, 0x449: 0x8133, 0x44a: 0x812e, 0x44b: 0x8133, + 0x44c: 0x8133, 0x44d: 0x8136, 0x44e: 0x812b, 0x44f: 0x812e, 0x450: 0x812a, 0x451: 0x8133, + 0x452: 0x8133, 0x453: 0x8133, 0x454: 0x8133, 0x455: 0x8133, 0x456: 0x8133, 0x457: 0x8133, + 0x458: 0x8133, 0x459: 0x8133, 0x45a: 0x8133, 0x45b: 0x8133, 0x45c: 0x8133, 0x45d: 0x8133, + 0x45e: 0x8133, 0x45f: 0x8133, 0x460: 0x8133, 0x461: 0x8133, 0x462: 0x8133, 0x463: 0x8133, + 0x464: 0x8133, 0x465: 0x8133, 0x466: 0x8133, 0x467: 0x8133, 0x468: 0x8133, 0x469: 0x8133, + 0x46a: 0x8133, 0x46b: 0x8133, 0x46c: 0x8133, 0x46d: 0x8133, 0x46e: 0x8133, 0x46f: 0x8133, + 0x470: 0x8133, 0x471: 0x8133, 0x472: 0x8133, 0x473: 0x8133, 0x474: 0x8133, 0x475: 0x8133, + 0x476: 0x8134, 0x477: 0x8132, 0x478: 0x8132, 0x479: 0x812e, 0x47a: 0x812d, 0x47b: 0x8133, + 0x47c: 0x8135, 0x47d: 0x812e, 0x47e: 0x8133, 0x47f: 0x812e, + // Block 0x12, offset 0x480 + 0x480: 0x30d8, 0x481: 0x33e4, 0x482: 0x30e2, 0x483: 0x33ee, 0x484: 0x30e7, 0x485: 0x33f3, + 0x486: 0x30ec, 0x487: 0x33f8, 0x488: 0x3a0d, 0x489: 0x3b9c, 0x48a: 0x3105, 0x48b: 0x3411, + 0x48c: 0x310f, 0x48d: 0x341b, 0x48e: 0x311e, 0x48f: 0x342a, 0x490: 0x3114, 0x491: 0x3420, + 0x492: 0x3119, 0x493: 0x3425, 0x494: 0x3a30, 0x495: 0x3bbf, 0x496: 0x3a37, 0x497: 0x3bc6, + 0x498: 0x315a, 0x499: 0x3466, 0x49a: 0x315f, 0x49b: 0x346b, 0x49c: 0x3a45, 0x49d: 0x3bd4, + 0x49e: 0x3164, 0x49f: 0x3470, 0x4a0: 0x3173, 0x4a1: 0x347f, 0x4a2: 0x3191, 0x4a3: 0x349d, + 0x4a4: 0x31a0, 0x4a5: 0x34ac, 0x4a6: 0x3196, 0x4a7: 0x34a2, 0x4a8: 0x31a5, 0x4a9: 0x34b1, + 0x4aa: 0x31aa, 0x4ab: 0x34b6, 0x4ac: 0x31f0, 0x4ad: 0x34fc, 0x4ae: 0x3a4c, 0x4af: 0x3bdb, + 0x4b0: 0x31fa, 0x4b1: 0x350b, 0x4b2: 0x3204, 0x4b3: 0x3515, 0x4b4: 0x320e, 0x4b5: 0x351f, + 0x4b6: 0x4805, 0x4b7: 0x4896, 0x4b8: 0x3a53, 0x4b9: 0x3be2, 0x4ba: 0x3227, 0x4bb: 0x3538, + 0x4bc: 0x3222, 0x4bd: 0x3533, 0x4be: 0x322c, 0x4bf: 0x353d, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x3231, 0x4c1: 0x3542, 0x4c2: 0x3236, 0x4c3: 0x3547, 0x4c4: 0x324a, 0x4c5: 0x355b, + 0x4c6: 0x3254, 0x4c7: 0x3565, 0x4c8: 0x3263, 0x4c9: 0x3574, 0x4ca: 0x325e, 0x4cb: 0x356f, + 0x4cc: 0x3a76, 0x4cd: 0x3c05, 0x4ce: 0x3a84, 0x4cf: 0x3c13, 0x4d0: 0x3a8b, 0x4d1: 0x3c1a, + 0x4d2: 0x3a92, 0x4d3: 0x3c21, 0x4d4: 0x3290, 0x4d5: 0x35a1, 0x4d6: 0x3295, 0x4d7: 0x35a6, + 0x4d8: 0x329f, 0x4d9: 0x35b0, 0x4da: 0x4832, 0x4db: 0x48c3, 0x4dc: 0x3ad8, 0x4dd: 0x3c67, + 0x4de: 0x32b8, 0x4df: 0x35c9, 0x4e0: 0x32c2, 0x4e1: 0x35d3, 0x4e2: 0x4841, 0x4e3: 0x48d2, + 0x4e4: 0x3adf, 0x4e5: 0x3c6e, 0x4e6: 0x3ae6, 0x4e7: 0x3c75, 0x4e8: 0x3aed, 0x4e9: 0x3c7c, + 0x4ea: 0x32d1, 0x4eb: 0x35e2, 0x4ec: 0x32db, 0x4ed: 0x35f1, 0x4ee: 0x32ef, 0x4ef: 0x3605, + 0x4f0: 0x32ea, 0x4f1: 0x3600, 0x4f2: 0x332b, 0x4f3: 0x3641, 0x4f4: 0x333a, 0x4f5: 0x3650, + 0x4f6: 0x3335, 0x4f7: 0x364b, 0x4f8: 0x3af4, 0x4f9: 0x3c83, 0x4fa: 0x3afb, 0x4fb: 0x3c8a, + 0x4fc: 0x333f, 0x4fd: 0x3655, 0x4fe: 0x3344, 0x4ff: 0x365a, + // Block 0x14, offset 0x500 + 0x500: 0x3349, 0x501: 0x365f, 0x502: 0x334e, 0x503: 0x3664, 0x504: 0x335d, 0x505: 0x3673, + 0x506: 0x3358, 0x507: 0x366e, 0x508: 0x3362, 0x509: 0x367d, 0x50a: 0x3367, 0x50b: 0x3682, + 0x50c: 0x336c, 0x50d: 0x3687, 0x50e: 0x338a, 0x50f: 0x36a5, 0x510: 0x33a3, 0x511: 0x36c3, + 0x512: 0x33b2, 0x513: 0x36d2, 0x514: 0x33b7, 0x515: 0x36d7, 0x516: 0x34bb, 0x517: 0x35e7, + 0x518: 0x3678, 0x519: 0x36b4, 0x51b: 0x3712, + 0x520: 0x47e2, 0x521: 0x4873, 0x522: 0x30c4, 0x523: 0x33d0, + 0x524: 0x39b9, 0x525: 0x3b48, 0x526: 0x39b2, 0x527: 0x3b41, 0x528: 0x39c7, 0x529: 0x3b56, + 0x52a: 0x39c0, 0x52b: 0x3b4f, 0x52c: 0x39ff, 0x52d: 0x3b8e, 0x52e: 0x39d5, 0x52f: 0x3b64, + 0x530: 0x39ce, 0x531: 0x3b5d, 0x532: 0x39e3, 0x533: 0x3b72, 0x534: 0x39dc, 0x535: 0x3b6b, + 0x536: 0x3a06, 0x537: 0x3b95, 0x538: 0x47f6, 0x539: 0x4887, 0x53a: 0x3141, 0x53b: 0x344d, + 0x53c: 0x312d, 0x53d: 0x3439, 0x53e: 0x3a1b, 0x53f: 0x3baa, + // Block 0x15, offset 0x540 + 0x540: 0x3a14, 0x541: 0x3ba3, 0x542: 0x3a29, 0x543: 0x3bb8, 0x544: 0x3a22, 0x545: 0x3bb1, + 0x546: 0x3a3e, 0x547: 0x3bcd, 0x548: 0x31d2, 0x549: 0x34de, 0x54a: 0x31e6, 0x54b: 0x34f2, + 0x54c: 0x4828, 0x54d: 0x48b9, 0x54e: 0x3277, 0x54f: 0x3588, 0x550: 0x3a61, 0x551: 0x3bf0, + 0x552: 0x3a5a, 0x553: 0x3be9, 0x554: 0x3a6f, 0x555: 0x3bfe, 0x556: 0x3a68, 0x557: 0x3bf7, + 0x558: 0x3aca, 0x559: 0x3c59, 0x55a: 0x3aae, 0x55b: 0x3c3d, 0x55c: 0x3aa7, 0x55d: 0x3c36, + 0x55e: 0x3abc, 0x55f: 0x3c4b, 0x560: 0x3ab5, 0x561: 0x3c44, 0x562: 0x3ac3, 0x563: 0x3c52, + 0x564: 0x3326, 0x565: 0x363c, 0x566: 0x3308, 0x567: 0x361e, 0x568: 0x3b25, 0x569: 0x3cb4, + 0x56a: 0x3b1e, 0x56b: 0x3cad, 0x56c: 0x3b33, 0x56d: 0x3cc2, 0x56e: 0x3b2c, 0x56f: 0x3cbb, + 0x570: 0x3b3a, 0x571: 0x3cc9, 0x572: 0x3371, 0x573: 0x368c, 0x574: 0x3399, 0x575: 0x36b9, + 0x576: 0x3394, 0x577: 0x36af, 0x578: 0x3380, 0x579: 0x369b, + // Block 0x16, offset 0x580 + 0x580: 0x4945, 0x581: 0x494b, 0x582: 0x4a5f, 0x583: 0x4a77, 0x584: 0x4a67, 0x585: 0x4a7f, + 0x586: 0x4a6f, 0x587: 0x4a87, 0x588: 0x48eb, 0x589: 0x48f1, 0x58a: 0x49cf, 0x58b: 0x49e7, + 0x58c: 0x49d7, 0x58d: 0x49ef, 0x58e: 0x49df, 0x58f: 0x49f7, 0x590: 0x4957, 0x591: 0x495d, + 0x592: 0x3ef9, 0x593: 0x3f09, 0x594: 0x3f01, 0x595: 0x3f11, + 0x598: 0x48f7, 0x599: 0x48fd, 0x59a: 0x3e29, 0x59b: 0x3e39, 0x59c: 0x3e31, 0x59d: 0x3e41, + 0x5a0: 0x496f, 0x5a1: 0x4975, 0x5a2: 0x4a8f, 0x5a3: 0x4aa7, + 0x5a4: 0x4a97, 0x5a5: 0x4aaf, 0x5a6: 0x4a9f, 0x5a7: 0x4ab7, 0x5a8: 0x4903, 0x5a9: 0x4909, + 0x5aa: 0x49ff, 0x5ab: 0x4a17, 0x5ac: 0x4a07, 0x5ad: 0x4a1f, 0x5ae: 0x4a0f, 0x5af: 0x4a27, + 0x5b0: 0x4987, 0x5b1: 0x498d, 0x5b2: 0x3f59, 0x5b3: 0x3f71, 0x5b4: 0x3f61, 0x5b5: 0x3f79, + 0x5b6: 0x3f69, 0x5b7: 0x3f81, 0x5b8: 0x490f, 0x5b9: 0x4915, 0x5ba: 0x3e59, 0x5bb: 0x3e71, + 0x5bc: 0x3e61, 0x5bd: 0x3e79, 0x5be: 0x3e69, 0x5bf: 0x3e81, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x4993, 0x5c1: 0x4999, 0x5c2: 0x3f89, 0x5c3: 0x3f99, 0x5c4: 0x3f91, 0x5c5: 0x3fa1, + 0x5c8: 0x491b, 0x5c9: 0x4921, 0x5ca: 0x3e89, 0x5cb: 0x3e99, + 0x5cc: 0x3e91, 0x5cd: 0x3ea1, 0x5d0: 0x49a5, 0x5d1: 0x49ab, + 0x5d2: 0x3fc1, 0x5d3: 0x3fd9, 0x5d4: 0x3fc9, 0x5d5: 0x3fe1, 0x5d6: 0x3fd1, 0x5d7: 0x3fe9, + 0x5d9: 0x4927, 0x5db: 0x3ea9, 0x5dd: 0x3eb1, + 0x5df: 0x3eb9, 0x5e0: 0x49bd, 0x5e1: 0x49c3, 0x5e2: 0x4abf, 0x5e3: 0x4ad7, + 0x5e4: 0x4ac7, 0x5e5: 0x4adf, 0x5e6: 0x4acf, 0x5e7: 0x4ae7, 0x5e8: 0x492d, 0x5e9: 0x4933, + 0x5ea: 0x4a2f, 0x5eb: 0x4a47, 0x5ec: 0x4a37, 0x5ed: 0x4a4f, 0x5ee: 0x4a3f, 0x5ef: 0x4a57, + 0x5f0: 0x4939, 0x5f1: 0x445f, 0x5f2: 0x37d2, 0x5f3: 0x4465, 0x5f4: 0x4963, 0x5f5: 0x446b, + 0x5f6: 0x37e4, 0x5f7: 0x4471, 0x5f8: 0x3802, 0x5f9: 0x4477, 0x5fa: 0x381a, 0x5fb: 0x447d, + 0x5fc: 0x49b1, 0x5fd: 0x4483, + // Block 0x18, offset 0x600 + 0x600: 0x3ee1, 0x601: 0x3ee9, 0x602: 0x42c5, 0x603: 0x42e3, 0x604: 0x42cf, 0x605: 0x42ed, + 0x606: 0x42d9, 0x607: 0x42f7, 0x608: 0x3e19, 0x609: 0x3e21, 0x60a: 0x4211, 0x60b: 0x422f, + 0x60c: 0x421b, 0x60d: 0x4239, 0x60e: 0x4225, 0x60f: 0x4243, 0x610: 0x3f29, 0x611: 0x3f31, + 0x612: 0x4301, 0x613: 0x431f, 0x614: 0x430b, 0x615: 0x4329, 0x616: 0x4315, 0x617: 0x4333, + 0x618: 0x3e49, 0x619: 0x3e51, 0x61a: 0x424d, 0x61b: 0x426b, 0x61c: 0x4257, 0x61d: 0x4275, + 0x61e: 0x4261, 0x61f: 0x427f, 0x620: 0x4001, 0x621: 0x4009, 0x622: 0x433d, 0x623: 0x435b, + 0x624: 0x4347, 0x625: 0x4365, 0x626: 0x4351, 0x627: 0x436f, 0x628: 0x3ec1, 0x629: 0x3ec9, + 0x62a: 0x4289, 0x62b: 0x42a7, 0x62c: 0x4293, 0x62d: 0x42b1, 0x62e: 0x429d, 0x62f: 0x42bb, + 0x630: 0x37c6, 0x631: 0x37c0, 0x632: 0x3ed1, 0x633: 0x37cc, 0x634: 0x3ed9, + 0x636: 0x4951, 0x637: 0x3ef1, 0x638: 0x3736, 0x639: 0x3730, 0x63a: 0x3724, 0x63b: 0x442f, + 0x63c: 0x373c, 0x63d: 0x8100, 0x63e: 0x0257, 0x63f: 0xa100, + // Block 0x19, offset 0x640 + 0x640: 0x8100, 0x641: 0x36e8, 0x642: 0x3f19, 0x643: 0x37de, 0x644: 0x3f21, + 0x646: 0x497b, 0x647: 0x3f39, 0x648: 0x3742, 0x649: 0x4435, 0x64a: 0x374e, 0x64b: 0x443b, + 0x64c: 0x375a, 0x64d: 0x3cd0, 0x64e: 0x3cd7, 0x64f: 0x3cde, 0x650: 0x37f6, 0x651: 0x37f0, + 0x652: 0x3f41, 0x653: 0x4625, 0x656: 0x37fc, 0x657: 0x3f51, + 0x658: 0x3772, 0x659: 0x376c, 0x65a: 0x3760, 0x65b: 0x4441, 0x65d: 0x3ce5, + 0x65e: 0x3cec, 0x65f: 0x3cf3, 0x660: 0x382c, 0x661: 0x3826, 0x662: 0x3fa9, 0x663: 0x462d, + 0x664: 0x380e, 0x665: 0x3814, 0x666: 0x3832, 0x667: 0x3fb9, 0x668: 0x37a2, 0x669: 0x379c, + 0x66a: 0x3790, 0x66b: 0x444d, 0x66c: 0x378a, 0x66d: 0x36dc, 0x66e: 0x4429, 0x66f: 0x0081, + 0x672: 0x3ff1, 0x673: 0x3838, 0x674: 0x3ff9, + 0x676: 0x49c9, 0x677: 0x4011, 0x678: 0x377e, 0x679: 0x4447, 0x67a: 0x37ae, 0x67b: 0x4459, + 0x67c: 0x37ba, 0x67d: 0x4397, 0x67e: 0xa100, + // Block 0x1a, offset 0x680 + 0x681: 0x3d47, 0x683: 0xa000, 0x684: 0x3d4e, 0x685: 0xa000, + 0x687: 0x3d55, 0x688: 0xa000, 0x689: 0x3d5c, + 0x68d: 0xa000, + 0x6a0: 0x30a6, 0x6a1: 0xa000, 0x6a2: 0x3d6a, + 0x6a4: 0xa000, 0x6a5: 0xa000, + 0x6ad: 0x3d63, 0x6ae: 0x30a1, 0x6af: 0x30ab, + 0x6b0: 0x3d71, 0x6b1: 0x3d78, 0x6b2: 0xa000, 0x6b3: 0xa000, 0x6b4: 0x3d7f, 0x6b5: 0x3d86, + 0x6b6: 0xa000, 0x6b7: 0xa000, 0x6b8: 0x3d8d, 0x6b9: 0x3d94, 0x6ba: 0xa000, 0x6bb: 0xa000, + 0x6bc: 0xa000, 0x6bd: 0xa000, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x3d9b, 0x6c1: 0x3da2, 0x6c2: 0xa000, 0x6c3: 0xa000, 0x6c4: 0x3db7, 0x6c5: 0x3dbe, + 0x6c6: 0xa000, 0x6c7: 0xa000, 0x6c8: 0x3dc5, 0x6c9: 0x3dcc, + 0x6d1: 0xa000, + 0x6d2: 0xa000, + 0x6e2: 0xa000, + 0x6e8: 0xa000, 0x6e9: 0xa000, + 0x6eb: 0xa000, 0x6ec: 0x3de1, 0x6ed: 0x3de8, 0x6ee: 0x3def, 0x6ef: 0x3df6, + 0x6f2: 0xa000, 0x6f3: 0xa000, 0x6f4: 0xa000, 0x6f5: 0xa000, + // Block 0x1c, offset 0x700 + 0x706: 0xa000, 0x70b: 0xa000, + 0x70c: 0x4049, 0x70d: 0xa000, 0x70e: 0x4051, 0x70f: 0xa000, 0x710: 0x4059, 0x711: 0xa000, + 0x712: 0x4061, 0x713: 0xa000, 0x714: 0x4069, 0x715: 0xa000, 0x716: 0x4071, 0x717: 0xa000, + 0x718: 0x4079, 0x719: 0xa000, 0x71a: 0x4081, 0x71b: 0xa000, 0x71c: 0x4089, 0x71d: 0xa000, + 0x71e: 0x4091, 0x71f: 0xa000, 0x720: 0x4099, 0x721: 0xa000, 0x722: 0x40a1, + 0x724: 0xa000, 0x725: 0x40a9, 0x726: 0xa000, 0x727: 0x40b1, 0x728: 0xa000, 0x729: 0x40b9, + 0x72f: 0xa000, + 0x730: 0x40c1, 0x731: 0x40c9, 0x732: 0xa000, 0x733: 0x40d1, 0x734: 0x40d9, 0x735: 0xa000, + 0x736: 0x40e1, 0x737: 0x40e9, 0x738: 0xa000, 0x739: 0x40f1, 0x73a: 0x40f9, 0x73b: 0xa000, + 0x73c: 0x4101, 0x73d: 0x4109, + // Block 0x1d, offset 0x740 + 0x754: 0x4041, + 0x759: 0x9904, 0x75a: 0x9904, 0x75b: 0x8100, 0x75c: 0x8100, 0x75d: 0xa000, + 0x75e: 0x4111, + 0x766: 0xa000, + 0x76b: 0xa000, 0x76c: 0x4121, 0x76d: 0xa000, 0x76e: 0x4129, 0x76f: 0xa000, + 0x770: 0x4131, 0x771: 0xa000, 0x772: 0x4139, 0x773: 0xa000, 0x774: 0x4141, 0x775: 0xa000, + 0x776: 0x4149, 0x777: 0xa000, 0x778: 0x4151, 0x779: 0xa000, 0x77a: 0x4159, 0x77b: 0xa000, + 0x77c: 0x4161, 0x77d: 0xa000, 0x77e: 0x4169, 0x77f: 0xa000, + // Block 0x1e, offset 0x780 + 0x780: 0x4171, 0x781: 0xa000, 0x782: 0x4179, 0x784: 0xa000, 0x785: 0x4181, + 0x786: 0xa000, 0x787: 0x4189, 0x788: 0xa000, 0x789: 0x4191, + 0x78f: 0xa000, 0x790: 0x4199, 0x791: 0x41a1, + 0x792: 0xa000, 0x793: 0x41a9, 0x794: 0x41b1, 0x795: 0xa000, 0x796: 0x41b9, 0x797: 0x41c1, + 0x798: 0xa000, 0x799: 0x41c9, 0x79a: 0x41d1, 0x79b: 0xa000, 0x79c: 0x41d9, 0x79d: 0x41e1, + 0x7af: 0xa000, + 0x7b0: 0xa000, 0x7b1: 0xa000, 0x7b2: 0xa000, 0x7b4: 0x4119, + 0x7b7: 0x41e9, 0x7b8: 0x41f1, 0x7b9: 0x41f9, 0x7ba: 0x4201, + 0x7bd: 0xa000, 0x7be: 0x4209, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x1472, 0x7c1: 0x0df6, 0x7c2: 0x14ce, 0x7c3: 0x149a, 0x7c4: 0x0f52, 0x7c5: 0x07e6, + 0x7c6: 0x09da, 0x7c7: 0x1726, 0x7c8: 0x1726, 0x7c9: 0x0b06, 0x7ca: 0x155a, 0x7cb: 0x0a3e, + 0x7cc: 0x0b02, 0x7cd: 0x0cea, 0x7ce: 0x10ca, 0x7cf: 0x125a, 0x7d0: 0x1392, 0x7d1: 0x13ce, + 0x7d2: 0x1402, 0x7d3: 0x1516, 0x7d4: 0x0e6e, 0x7d5: 0x0efa, 0x7d6: 0x0fa6, 0x7d7: 0x103e, + 0x7d8: 0x135a, 0x7d9: 0x1542, 0x7da: 0x166e, 0x7db: 0x080a, 0x7dc: 0x09ae, 0x7dd: 0x0e82, + 0x7de: 0x0fca, 0x7df: 0x138e, 0x7e0: 0x16be, 0x7e1: 0x0bae, 0x7e2: 0x0f72, 0x7e3: 0x137e, + 0x7e4: 0x1412, 0x7e5: 0x0d1e, 0x7e6: 0x12b6, 0x7e7: 0x13da, 0x7e8: 0x0c1a, 0x7e9: 0x0e0a, + 0x7ea: 0x0f12, 0x7eb: 0x1016, 0x7ec: 0x1522, 0x7ed: 0x084a, 0x7ee: 0x08e2, 0x7ef: 0x094e, + 0x7f0: 0x0d86, 0x7f1: 0x0e7a, 0x7f2: 0x0fc6, 0x7f3: 0x10ea, 0x7f4: 0x1272, 0x7f5: 0x1386, + 0x7f6: 0x139e, 0x7f7: 0x14c2, 0x7f8: 0x15ea, 0x7f9: 0x169e, 0x7fa: 0x16ba, 0x7fb: 0x1126, + 0x7fc: 0x1166, 0x7fd: 0x121e, 0x7fe: 0x133e, 0x7ff: 0x1576, + // Block 0x20, offset 0x800 + 0x800: 0x16c6, 0x801: 0x1446, 0x802: 0x0ac2, 0x803: 0x0c36, 0x804: 0x11d6, 0x805: 0x1296, + 0x806: 0x0ffa, 0x807: 0x112e, 0x808: 0x1492, 0x809: 0x15e2, 0x80a: 0x0abe, 0x80b: 0x0b8a, + 0x80c: 0x0e72, 0x80d: 0x0f26, 0x80e: 0x0f5a, 0x80f: 0x120e, 0x810: 0x1236, 0x811: 0x15a2, + 0x812: 0x094a, 0x813: 0x12a2, 0x814: 0x08ee, 0x815: 0x08ea, 0x816: 0x1192, 0x817: 0x1222, + 0x818: 0x1356, 0x819: 0x15aa, 0x81a: 0x1462, 0x81b: 0x0d22, 0x81c: 0x0e6e, 0x81d: 0x1452, + 0x81e: 0x07f2, 0x81f: 0x0b5e, 0x820: 0x0c8e, 0x821: 0x102a, 0x822: 0x10aa, 0x823: 0x096e, + 0x824: 0x1136, 0x825: 0x085a, 0x826: 0x0c72, 0x827: 0x07d2, 0x828: 0x0ee6, 0x829: 0x0d9e, + 0x82a: 0x120a, 0x82b: 0x09c2, 0x82c: 0x0aae, 0x82d: 0x10f6, 0x82e: 0x135e, 0x82f: 0x1436, + 0x830: 0x0eb2, 0x831: 0x14f2, 0x832: 0x0ede, 0x833: 0x0d32, 0x834: 0x1316, 0x835: 0x0d52, + 0x836: 0x10a6, 0x837: 0x0826, 0x838: 0x08a2, 0x839: 0x08e6, 0x83a: 0x0e4e, 0x83b: 0x11f6, + 0x83c: 0x12ee, 0x83d: 0x1442, 0x83e: 0x1556, 0x83f: 0x0956, + // Block 0x21, offset 0x840 + 0x840: 0x0a0a, 0x841: 0x0b12, 0x842: 0x0c2a, 0x843: 0x0dba, 0x844: 0x0f76, 0x845: 0x113a, + 0x846: 0x1592, 0x847: 0x1676, 0x848: 0x16ca, 0x849: 0x16e2, 0x84a: 0x0932, 0x84b: 0x0dee, + 0x84c: 0x0e9e, 0x84d: 0x14e6, 0x84e: 0x0bf6, 0x84f: 0x0cd2, 0x850: 0x0cee, 0x851: 0x0d7e, + 0x852: 0x0f66, 0x853: 0x0fb2, 0x854: 0x1062, 0x855: 0x1186, 0x856: 0x122a, 0x857: 0x128e, + 0x858: 0x14d6, 0x859: 0x1366, 0x85a: 0x14fe, 0x85b: 0x157a, 0x85c: 0x090a, 0x85d: 0x0936, + 0x85e: 0x0a1e, 0x85f: 0x0fa2, 0x860: 0x13ee, 0x861: 0x1436, 0x862: 0x0c16, 0x863: 0x0c86, + 0x864: 0x0d4a, 0x865: 0x0eaa, 0x866: 0x11d2, 0x867: 0x101e, 0x868: 0x0836, 0x869: 0x0a7a, + 0x86a: 0x0b5e, 0x86b: 0x0bc2, 0x86c: 0x0c92, 0x86d: 0x103a, 0x86e: 0x1056, 0x86f: 0x1266, + 0x870: 0x1286, 0x871: 0x155e, 0x872: 0x15de, 0x873: 0x15ee, 0x874: 0x162a, 0x875: 0x084e, + 0x876: 0x117a, 0x877: 0x154a, 0x878: 0x15c6, 0x879: 0x0caa, 0x87a: 0x0812, 0x87b: 0x0872, + 0x87c: 0x0b62, 0x87d: 0x0b82, 0x87e: 0x0daa, 0x87f: 0x0e6e, + // Block 0x22, offset 0x880 + 0x880: 0x0fbe, 0x881: 0x10c6, 0x882: 0x1372, 0x883: 0x1512, 0x884: 0x171e, 0x885: 0x0dde, + 0x886: 0x159e, 0x887: 0x092e, 0x888: 0x0e2a, 0x889: 0x0e36, 0x88a: 0x0f0a, 0x88b: 0x0f42, + 0x88c: 0x1046, 0x88d: 0x10a2, 0x88e: 0x1122, 0x88f: 0x1206, 0x890: 0x1636, 0x891: 0x08aa, + 0x892: 0x0cfe, 0x893: 0x15ae, 0x894: 0x0862, 0x895: 0x0ba6, 0x896: 0x0f2a, 0x897: 0x14da, + 0x898: 0x0c62, 0x899: 0x0cb2, 0x89a: 0x0e3e, 0x89b: 0x102a, 0x89c: 0x15b6, 0x89d: 0x0912, + 0x89e: 0x09fa, 0x89f: 0x0b92, 0x8a0: 0x0dce, 0x8a1: 0x0e1a, 0x8a2: 0x0e5a, 0x8a3: 0x0eee, + 0x8a4: 0x1042, 0x8a5: 0x10b6, 0x8a6: 0x1252, 0x8a7: 0x13f2, 0x8a8: 0x13fe, 0x8a9: 0x1552, + 0x8aa: 0x15d2, 0x8ab: 0x097e, 0x8ac: 0x0f46, 0x8ad: 0x09fe, 0x8ae: 0x0fc2, 0x8af: 0x1066, + 0x8b0: 0x1382, 0x8b1: 0x15ba, 0x8b2: 0x16a6, 0x8b3: 0x16ce, 0x8b4: 0x0e32, 0x8b5: 0x0f22, + 0x8b6: 0x12be, 0x8b7: 0x11b2, 0x8b8: 0x11be, 0x8b9: 0x11e2, 0x8ba: 0x1012, 0x8bb: 0x0f9a, + 0x8bc: 0x145e, 0x8bd: 0x082e, 0x8be: 0x1326, 0x8bf: 0x0916, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x0906, 0x8c1: 0x0c06, 0x8c2: 0x0d26, 0x8c3: 0x11ee, 0x8c4: 0x0b4e, 0x8c5: 0x0efe, + 0x8c6: 0x0dea, 0x8c7: 0x14e2, 0x8c8: 0x13e2, 0x8c9: 0x15a6, 0x8ca: 0x141e, 0x8cb: 0x0c22, + 0x8cc: 0x0882, 0x8cd: 0x0a56, 0x8d0: 0x0aaa, + 0x8d2: 0x0dda, 0x8d5: 0x08f2, 0x8d6: 0x101a, 0x8d7: 0x10de, + 0x8d8: 0x1142, 0x8d9: 0x115e, 0x8da: 0x1162, 0x8db: 0x1176, 0x8dc: 0x15f6, 0x8dd: 0x11e6, + 0x8de: 0x126a, 0x8e0: 0x138a, 0x8e2: 0x144e, + 0x8e5: 0x1502, 0x8e6: 0x152e, + 0x8ea: 0x164a, 0x8eb: 0x164e, 0x8ec: 0x1652, 0x8ed: 0x16b6, 0x8ee: 0x1526, 0x8ef: 0x15c2, + 0x8f0: 0x0852, 0x8f1: 0x0876, 0x8f2: 0x088a, 0x8f3: 0x0946, 0x8f4: 0x0952, 0x8f5: 0x0992, + 0x8f6: 0x0a46, 0x8f7: 0x0a62, 0x8f8: 0x0a6a, 0x8f9: 0x0aa6, 0x8fa: 0x0ab2, 0x8fb: 0x0b8e, + 0x8fc: 0x0b96, 0x8fd: 0x0c9e, 0x8fe: 0x0cc6, 0x8ff: 0x0cce, + // Block 0x24, offset 0x900 + 0x900: 0x0ce6, 0x901: 0x0d92, 0x902: 0x0dc2, 0x903: 0x0de2, 0x904: 0x0e52, 0x905: 0x0f16, + 0x906: 0x0f32, 0x907: 0x0f62, 0x908: 0x0fb6, 0x909: 0x0fd6, 0x90a: 0x104a, 0x90b: 0x112a, + 0x90c: 0x1146, 0x90d: 0x114e, 0x90e: 0x114a, 0x90f: 0x1152, 0x910: 0x1156, 0x911: 0x115a, + 0x912: 0x116e, 0x913: 0x1172, 0x914: 0x1196, 0x915: 0x11aa, 0x916: 0x11c6, 0x917: 0x122a, + 0x918: 0x1232, 0x919: 0x123a, 0x91a: 0x124e, 0x91b: 0x1276, 0x91c: 0x12c6, 0x91d: 0x12fa, + 0x91e: 0x12fa, 0x91f: 0x1362, 0x920: 0x140a, 0x921: 0x1422, 0x922: 0x1456, 0x923: 0x145a, + 0x924: 0x149e, 0x925: 0x14a2, 0x926: 0x14fa, 0x927: 0x1502, 0x928: 0x15d6, 0x929: 0x161a, + 0x92a: 0x1632, 0x92b: 0x0c96, 0x92c: 0x184b, 0x92d: 0x12de, + 0x930: 0x07da, 0x931: 0x08de, 0x932: 0x089e, 0x933: 0x0846, 0x934: 0x0886, 0x935: 0x08b2, + 0x936: 0x0942, 0x937: 0x095e, 0x938: 0x0a46, 0x939: 0x0a32, 0x93a: 0x0a42, 0x93b: 0x0a5e, + 0x93c: 0x0aaa, 0x93d: 0x0aba, 0x93e: 0x0afe, 0x93f: 0x0b0a, + // Block 0x25, offset 0x940 + 0x940: 0x0b26, 0x941: 0x0b36, 0x942: 0x0c1e, 0x943: 0x0c26, 0x944: 0x0c56, 0x945: 0x0c76, + 0x946: 0x0ca6, 0x947: 0x0cbe, 0x948: 0x0cae, 0x949: 0x0cce, 0x94a: 0x0cc2, 0x94b: 0x0ce6, + 0x94c: 0x0d02, 0x94d: 0x0d5a, 0x94e: 0x0d66, 0x94f: 0x0d6e, 0x950: 0x0d96, 0x951: 0x0dda, + 0x952: 0x0e0a, 0x953: 0x0e0e, 0x954: 0x0e22, 0x955: 0x0ea2, 0x956: 0x0eb2, 0x957: 0x0f0a, + 0x958: 0x0f56, 0x959: 0x0f4e, 0x95a: 0x0f62, 0x95b: 0x0f7e, 0x95c: 0x0fb6, 0x95d: 0x110e, + 0x95e: 0x0fda, 0x95f: 0x100e, 0x960: 0x101a, 0x961: 0x105a, 0x962: 0x1076, 0x963: 0x109a, + 0x964: 0x10be, 0x965: 0x10c2, 0x966: 0x10de, 0x967: 0x10e2, 0x968: 0x10f2, 0x969: 0x1106, + 0x96a: 0x1102, 0x96b: 0x1132, 0x96c: 0x11ae, 0x96d: 0x11c6, 0x96e: 0x11de, 0x96f: 0x1216, + 0x970: 0x122a, 0x971: 0x1246, 0x972: 0x1276, 0x973: 0x132a, 0x974: 0x1352, 0x975: 0x13c6, + 0x976: 0x140e, 0x977: 0x141a, 0x978: 0x1422, 0x979: 0x143a, 0x97a: 0x144e, 0x97b: 0x143e, + 0x97c: 0x1456, 0x97d: 0x1452, 0x97e: 0x144a, 0x97f: 0x145a, + // Block 0x26, offset 0x980 + 0x980: 0x1466, 0x981: 0x14a2, 0x982: 0x14de, 0x983: 0x150e, 0x984: 0x1546, 0x985: 0x1566, + 0x986: 0x15b2, 0x987: 0x15d6, 0x988: 0x15f6, 0x989: 0x160a, 0x98a: 0x161a, 0x98b: 0x1626, + 0x98c: 0x1632, 0x98d: 0x1686, 0x98e: 0x1726, 0x98f: 0x17e2, 0x990: 0x17dd, 0x991: 0x180f, + 0x992: 0x0702, 0x993: 0x072a, 0x994: 0x072e, 0x995: 0x1891, 0x996: 0x18be, 0x997: 0x1936, + 0x998: 0x1712, 0x999: 0x1722, + // Block 0x27, offset 0x9c0 + 0x9c0: 0x07f6, 0x9c1: 0x07ee, 0x9c2: 0x07fe, 0x9c3: 0x1774, 0x9c4: 0x0842, 0x9c5: 0x0852, + 0x9c6: 0x0856, 0x9c7: 0x085e, 0x9c8: 0x0866, 0x9c9: 0x086a, 0x9ca: 0x0876, 0x9cb: 0x086e, + 0x9cc: 0x06ae, 0x9cd: 0x1788, 0x9ce: 0x088a, 0x9cf: 0x088e, 0x9d0: 0x0892, 0x9d1: 0x08ae, + 0x9d2: 0x1779, 0x9d3: 0x06b2, 0x9d4: 0x089a, 0x9d5: 0x08ba, 0x9d6: 0x1783, 0x9d7: 0x08ca, + 0x9d8: 0x08d2, 0x9d9: 0x0832, 0x9da: 0x08da, 0x9db: 0x08de, 0x9dc: 0x195e, 0x9dd: 0x08fa, + 0x9de: 0x0902, 0x9df: 0x06ba, 0x9e0: 0x091a, 0x9e1: 0x091e, 0x9e2: 0x0926, 0x9e3: 0x092a, + 0x9e4: 0x06be, 0x9e5: 0x0942, 0x9e6: 0x0946, 0x9e7: 0x0952, 0x9e8: 0x095e, 0x9e9: 0x0962, + 0x9ea: 0x0966, 0x9eb: 0x096e, 0x9ec: 0x098e, 0x9ed: 0x0992, 0x9ee: 0x099a, 0x9ef: 0x09aa, + 0x9f0: 0x09b2, 0x9f1: 0x09b6, 0x9f2: 0x09b6, 0x9f3: 0x09b6, 0x9f4: 0x1797, 0x9f5: 0x0f8e, + 0x9f6: 0x09ca, 0x9f7: 0x09d2, 0x9f8: 0x179c, 0x9f9: 0x09de, 0x9fa: 0x09e6, 0x9fb: 0x09ee, + 0x9fc: 0x0a16, 0x9fd: 0x0a02, 0x9fe: 0x0a0e, 0x9ff: 0x0a12, + // Block 0x28, offset 0xa00 + 0xa00: 0x0a1a, 0xa01: 0x0a22, 0xa02: 0x0a26, 0xa03: 0x0a2e, 0xa04: 0x0a36, 0xa05: 0x0a3a, + 0xa06: 0x0a3a, 0xa07: 0x0a42, 0xa08: 0x0a4a, 0xa09: 0x0a4e, 0xa0a: 0x0a5a, 0xa0b: 0x0a7e, + 0xa0c: 0x0a62, 0xa0d: 0x0a82, 0xa0e: 0x0a66, 0xa0f: 0x0a6e, 0xa10: 0x0906, 0xa11: 0x0aca, + 0xa12: 0x0a92, 0xa13: 0x0a96, 0xa14: 0x0a9a, 0xa15: 0x0a8e, 0xa16: 0x0aa2, 0xa17: 0x0a9e, + 0xa18: 0x0ab6, 0xa19: 0x17a1, 0xa1a: 0x0ad2, 0xa1b: 0x0ad6, 0xa1c: 0x0ade, 0xa1d: 0x0aea, + 0xa1e: 0x0af2, 0xa1f: 0x0b0e, 0xa20: 0x17a6, 0xa21: 0x17ab, 0xa22: 0x0b1a, 0xa23: 0x0b1e, + 0xa24: 0x0b22, 0xa25: 0x0b16, 0xa26: 0x0b2a, 0xa27: 0x06c2, 0xa28: 0x06c6, 0xa29: 0x0b32, + 0xa2a: 0x0b3a, 0xa2b: 0x0b3a, 0xa2c: 0x17b0, 0xa2d: 0x0b56, 0xa2e: 0x0b5a, 0xa2f: 0x0b5e, + 0xa30: 0x0b66, 0xa31: 0x17b5, 0xa32: 0x0b6e, 0xa33: 0x0b72, 0xa34: 0x0c4a, 0xa35: 0x0b7a, + 0xa36: 0x06ca, 0xa37: 0x0b86, 0xa38: 0x0b96, 0xa39: 0x0ba2, 0xa3a: 0x0b9e, 0xa3b: 0x17bf, + 0xa3c: 0x0baa, 0xa3d: 0x17c4, 0xa3e: 0x0bb6, 0xa3f: 0x0bb2, + // Block 0x29, offset 0xa40 + 0xa40: 0x0bba, 0xa41: 0x0bca, 0xa42: 0x0bce, 0xa43: 0x06ce, 0xa44: 0x0bde, 0xa45: 0x0be6, + 0xa46: 0x0bea, 0xa47: 0x0bee, 0xa48: 0x06d2, 0xa49: 0x17c9, 0xa4a: 0x06d6, 0xa4b: 0x0c0a, + 0xa4c: 0x0c0e, 0xa4d: 0x0c12, 0xa4e: 0x0c1a, 0xa4f: 0x1990, 0xa50: 0x0c32, 0xa51: 0x17d3, + 0xa52: 0x17d3, 0xa53: 0x12d2, 0xa54: 0x0c42, 0xa55: 0x0c42, 0xa56: 0x06da, 0xa57: 0x17f6, + 0xa58: 0x18c8, 0xa59: 0x0c52, 0xa5a: 0x0c5a, 0xa5b: 0x06de, 0xa5c: 0x0c6e, 0xa5d: 0x0c7e, + 0xa5e: 0x0c82, 0xa5f: 0x0c8a, 0xa60: 0x0c9a, 0xa61: 0x06e6, 0xa62: 0x06e2, 0xa63: 0x0c9e, + 0xa64: 0x17d8, 0xa65: 0x0ca2, 0xa66: 0x0cb6, 0xa67: 0x0cba, 0xa68: 0x0cbe, 0xa69: 0x0cba, + 0xa6a: 0x0cca, 0xa6b: 0x0cce, 0xa6c: 0x0cde, 0xa6d: 0x0cd6, 0xa6e: 0x0cda, 0xa6f: 0x0ce2, + 0xa70: 0x0ce6, 0xa71: 0x0cea, 0xa72: 0x0cf6, 0xa73: 0x0cfa, 0xa74: 0x0d12, 0xa75: 0x0d1a, + 0xa76: 0x0d2a, 0xa77: 0x0d3e, 0xa78: 0x17e7, 0xa79: 0x0d3a, 0xa7a: 0x0d2e, 0xa7b: 0x0d46, + 0xa7c: 0x0d4e, 0xa7d: 0x0d62, 0xa7e: 0x17ec, 0xa7f: 0x0d6a, + // Block 0x2a, offset 0xa80 + 0xa80: 0x0d5e, 0xa81: 0x0d56, 0xa82: 0x06ea, 0xa83: 0x0d72, 0xa84: 0x0d7a, 0xa85: 0x0d82, + 0xa86: 0x0d76, 0xa87: 0x06ee, 0xa88: 0x0d92, 0xa89: 0x0d9a, 0xa8a: 0x17f1, 0xa8b: 0x0dc6, + 0xa8c: 0x0dfa, 0xa8d: 0x0dd6, 0xa8e: 0x06fa, 0xa8f: 0x0de2, 0xa90: 0x06f6, 0xa91: 0x06f2, + 0xa92: 0x08be, 0xa93: 0x08c2, 0xa94: 0x0dfe, 0xa95: 0x0de6, 0xa96: 0x12a6, 0xa97: 0x075e, + 0xa98: 0x0e0a, 0xa99: 0x0e0e, 0xa9a: 0x0e12, 0xa9b: 0x0e26, 0xa9c: 0x0e1e, 0xa9d: 0x180a, + 0xa9e: 0x06fe, 0xa9f: 0x0e3a, 0xaa0: 0x0e2e, 0xaa1: 0x0e4a, 0xaa2: 0x0e52, 0xaa3: 0x1814, + 0xaa4: 0x0e56, 0xaa5: 0x0e42, 0xaa6: 0x0e5e, 0xaa7: 0x0702, 0xaa8: 0x0e62, 0xaa9: 0x0e66, + 0xaaa: 0x0e6a, 0xaab: 0x0e76, 0xaac: 0x1819, 0xaad: 0x0e7e, 0xaae: 0x0706, 0xaaf: 0x0e8a, + 0xab0: 0x181e, 0xab1: 0x0e8e, 0xab2: 0x070a, 0xab3: 0x0e9a, 0xab4: 0x0ea6, 0xab5: 0x0eb2, + 0xab6: 0x0eb6, 0xab7: 0x1823, 0xab8: 0x17ba, 0xab9: 0x1828, 0xaba: 0x0ed6, 0xabb: 0x182d, + 0xabc: 0x0ee2, 0xabd: 0x0eea, 0xabe: 0x0eda, 0xabf: 0x0ef6, + // Block 0x2b, offset 0xac0 + 0xac0: 0x0f06, 0xac1: 0x0f16, 0xac2: 0x0f0a, 0xac3: 0x0f0e, 0xac4: 0x0f1a, 0xac5: 0x0f1e, + 0xac6: 0x1832, 0xac7: 0x0f02, 0xac8: 0x0f36, 0xac9: 0x0f3a, 0xaca: 0x070e, 0xacb: 0x0f4e, + 0xacc: 0x0f4a, 0xacd: 0x1837, 0xace: 0x0f2e, 0xacf: 0x0f6a, 0xad0: 0x183c, 0xad1: 0x1841, + 0xad2: 0x0f6e, 0xad3: 0x0f82, 0xad4: 0x0f7e, 0xad5: 0x0f7a, 0xad6: 0x0712, 0xad7: 0x0f86, + 0xad8: 0x0f96, 0xad9: 0x0f92, 0xada: 0x0f9e, 0xadb: 0x177e, 0xadc: 0x0fae, 0xadd: 0x1846, + 0xade: 0x0fba, 0xadf: 0x1850, 0xae0: 0x0fce, 0xae1: 0x0fda, 0xae2: 0x0fee, 0xae3: 0x1855, + 0xae4: 0x1002, 0xae5: 0x1006, 0xae6: 0x185a, 0xae7: 0x185f, 0xae8: 0x1022, 0xae9: 0x1032, + 0xaea: 0x0716, 0xaeb: 0x1036, 0xaec: 0x071a, 0xaed: 0x071a, 0xaee: 0x104e, 0xaef: 0x1052, + 0xaf0: 0x105a, 0xaf1: 0x105e, 0xaf2: 0x106a, 0xaf3: 0x071e, 0xaf4: 0x1082, 0xaf5: 0x1864, + 0xaf6: 0x109e, 0xaf7: 0x1869, 0xaf8: 0x10aa, 0xaf9: 0x17ce, 0xafa: 0x10ba, 0xafb: 0x186e, + 0xafc: 0x1873, 0xafd: 0x1878, 0xafe: 0x0722, 0xaff: 0x0726, + // Block 0x2c, offset 0xb00 + 0xb00: 0x10f2, 0xb01: 0x1882, 0xb02: 0x187d, 0xb03: 0x1887, 0xb04: 0x188c, 0xb05: 0x10fa, + 0xb06: 0x10fe, 0xb07: 0x10fe, 0xb08: 0x1106, 0xb09: 0x072e, 0xb0a: 0x110a, 0xb0b: 0x0732, + 0xb0c: 0x0736, 0xb0d: 0x1896, 0xb0e: 0x111e, 0xb0f: 0x1126, 0xb10: 0x1132, 0xb11: 0x073a, + 0xb12: 0x189b, 0xb13: 0x1156, 0xb14: 0x18a0, 0xb15: 0x18a5, 0xb16: 0x1176, 0xb17: 0x118e, + 0xb18: 0x073e, 0xb19: 0x1196, 0xb1a: 0x119a, 0xb1b: 0x119e, 0xb1c: 0x18aa, 0xb1d: 0x18af, + 0xb1e: 0x18af, 0xb1f: 0x11b6, 0xb20: 0x0742, 0xb21: 0x18b4, 0xb22: 0x11ca, 0xb23: 0x11ce, + 0xb24: 0x0746, 0xb25: 0x18b9, 0xb26: 0x11ea, 0xb27: 0x074a, 0xb28: 0x11fa, 0xb29: 0x11f2, + 0xb2a: 0x1202, 0xb2b: 0x18c3, 0xb2c: 0x121a, 0xb2d: 0x074e, 0xb2e: 0x1226, 0xb2f: 0x122e, + 0xb30: 0x123e, 0xb31: 0x0752, 0xb32: 0x18cd, 0xb33: 0x18d2, 0xb34: 0x0756, 0xb35: 0x18d7, + 0xb36: 0x1256, 0xb37: 0x18dc, 0xb38: 0x1262, 0xb39: 0x126e, 0xb3a: 0x1276, 0xb3b: 0x18e1, + 0xb3c: 0x18e6, 0xb3d: 0x128a, 0xb3e: 0x18eb, 0xb3f: 0x1292, + // Block 0x2d, offset 0xb40 + 0xb40: 0x17fb, 0xb41: 0x075a, 0xb42: 0x12aa, 0xb43: 0x12ae, 0xb44: 0x0762, 0xb45: 0x12b2, + 0xb46: 0x0b2e, 0xb47: 0x18f0, 0xb48: 0x18f5, 0xb49: 0x1800, 0xb4a: 0x1805, 0xb4b: 0x12d2, + 0xb4c: 0x12d6, 0xb4d: 0x14ee, 0xb4e: 0x0766, 0xb4f: 0x1302, 0xb50: 0x12fe, 0xb51: 0x1306, + 0xb52: 0x093a, 0xb53: 0x130a, 0xb54: 0x130e, 0xb55: 0x1312, 0xb56: 0x131a, 0xb57: 0x18fa, + 0xb58: 0x1316, 0xb59: 0x131e, 0xb5a: 0x1332, 0xb5b: 0x1336, 0xb5c: 0x1322, 0xb5d: 0x133a, + 0xb5e: 0x134e, 0xb5f: 0x1362, 0xb60: 0x132e, 0xb61: 0x1342, 0xb62: 0x1346, 0xb63: 0x134a, + 0xb64: 0x18ff, 0xb65: 0x1909, 0xb66: 0x1904, 0xb67: 0x076a, 0xb68: 0x136a, 0xb69: 0x136e, + 0xb6a: 0x1376, 0xb6b: 0x191d, 0xb6c: 0x137a, 0xb6d: 0x190e, 0xb6e: 0x076e, 0xb6f: 0x0772, + 0xb70: 0x1913, 0xb71: 0x1918, 0xb72: 0x0776, 0xb73: 0x139a, 0xb74: 0x139e, 0xb75: 0x13a2, + 0xb76: 0x13a6, 0xb77: 0x13b2, 0xb78: 0x13ae, 0xb79: 0x13ba, 0xb7a: 0x13b6, 0xb7b: 0x13c6, + 0xb7c: 0x13be, 0xb7d: 0x13c2, 0xb7e: 0x13ca, 0xb7f: 0x077a, + // Block 0x2e, offset 0xb80 + 0xb80: 0x13d2, 0xb81: 0x13d6, 0xb82: 0x077e, 0xb83: 0x13e6, 0xb84: 0x13ea, 0xb85: 0x1922, + 0xb86: 0x13f6, 0xb87: 0x13fa, 0xb88: 0x0782, 0xb89: 0x1406, 0xb8a: 0x06b6, 0xb8b: 0x1927, + 0xb8c: 0x192c, 0xb8d: 0x0786, 0xb8e: 0x078a, 0xb8f: 0x1432, 0xb90: 0x144a, 0xb91: 0x1466, + 0xb92: 0x1476, 0xb93: 0x1931, 0xb94: 0x148a, 0xb95: 0x148e, 0xb96: 0x14a6, 0xb97: 0x14b2, + 0xb98: 0x193b, 0xb99: 0x178d, 0xb9a: 0x14be, 0xb9b: 0x14ba, 0xb9c: 0x14c6, 0xb9d: 0x1792, + 0xb9e: 0x14d2, 0xb9f: 0x14de, 0xba0: 0x1940, 0xba1: 0x1945, 0xba2: 0x151e, 0xba3: 0x152a, + 0xba4: 0x1532, 0xba5: 0x194a, 0xba6: 0x1536, 0xba7: 0x1562, 0xba8: 0x156e, 0xba9: 0x1572, + 0xbaa: 0x156a, 0xbab: 0x157e, 0xbac: 0x1582, 0xbad: 0x194f, 0xbae: 0x158e, 0xbaf: 0x078e, + 0xbb0: 0x1596, 0xbb1: 0x1954, 0xbb2: 0x0792, 0xbb3: 0x15ce, 0xbb4: 0x0bbe, 0xbb5: 0x15e6, + 0xbb6: 0x1959, 0xbb7: 0x1963, 0xbb8: 0x0796, 0xbb9: 0x079a, 0xbba: 0x160e, 0xbbb: 0x1968, + 0xbbc: 0x079e, 0xbbd: 0x196d, 0xbbe: 0x1626, 0xbbf: 0x1626, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x162e, 0xbc1: 0x1972, 0xbc2: 0x1646, 0xbc3: 0x07a2, 0xbc4: 0x1656, 0xbc5: 0x1662, + 0xbc6: 0x166a, 0xbc7: 0x1672, 0xbc8: 0x07a6, 0xbc9: 0x1977, 0xbca: 0x1686, 0xbcb: 0x16a2, + 0xbcc: 0x16ae, 0xbcd: 0x07aa, 0xbce: 0x07ae, 0xbcf: 0x16b2, 0xbd0: 0x197c, 0xbd1: 0x07b2, + 0xbd2: 0x1981, 0xbd3: 0x1986, 0xbd4: 0x198b, 0xbd5: 0x16d6, 0xbd6: 0x07b6, 0xbd7: 0x16ea, + 0xbd8: 0x16f2, 0xbd9: 0x16f6, 0xbda: 0x16fe, 0xbdb: 0x1706, 0xbdc: 0x170e, 0xbdd: 0x1995, +} + +// nfcIndex: 22 blocks, 1408 entries, 1408 bytes +// Block 0 is the zero block. +var nfcIndex = [1408]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x2e, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x2f, 0xc7: 0x04, + 0xc8: 0x05, 0xca: 0x30, 0xcb: 0x31, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x32, + 0xd0: 0x09, 0xd1: 0x33, 0xd2: 0x34, 0xd3: 0x0a, 0xd6: 0x0b, 0xd7: 0x35, + 0xd8: 0x36, 0xd9: 0x0c, 0xdb: 0x37, 0xdc: 0x38, 0xdd: 0x39, 0xdf: 0x3a, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, + 0xf0: 0x13, + // Block 0x4, offset 0x100 + 0x120: 0x3b, 0x121: 0x3c, 0x122: 0x3d, 0x123: 0x0d, 0x124: 0x3e, 0x125: 0x3f, 0x126: 0x40, 0x127: 0x41, + 0x128: 0x42, 0x129: 0x43, 0x12a: 0x44, 0x12b: 0x45, 0x12c: 0x40, 0x12d: 0x46, 0x12e: 0x47, 0x12f: 0x48, + 0x130: 0x44, 0x131: 0x49, 0x132: 0x4a, 0x133: 0x4b, 0x134: 0x4c, 0x135: 0x4d, 0x137: 0x4e, + 0x138: 0x4f, 0x139: 0x50, 0x13a: 0x51, 0x13b: 0x52, 0x13c: 0x53, 0x13d: 0x54, 0x13e: 0x55, 0x13f: 0x56, + // Block 0x5, offset 0x140 + 0x140: 0x57, 0x142: 0x58, 0x144: 0x59, 0x145: 0x5a, 0x146: 0x5b, 0x147: 0x5c, + 0x14d: 0x5d, + 0x15c: 0x5e, 0x15f: 0x5f, + 0x162: 0x60, 0x164: 0x61, + 0x168: 0x62, 0x169: 0x63, 0x16a: 0x64, 0x16b: 0x65, 0x16c: 0x0e, 0x16d: 0x66, 0x16e: 0x67, 0x16f: 0x68, + 0x170: 0x69, 0x173: 0x6a, 0x177: 0x0f, + 0x178: 0x10, 0x179: 0x11, 0x17a: 0x12, 0x17b: 0x13, 0x17c: 0x14, 0x17d: 0x15, 0x17e: 0x16, 0x17f: 0x17, + // Block 0x6, offset 0x180 + 0x180: 0x6b, 0x183: 0x6c, 0x184: 0x6d, 0x186: 0x6e, 0x187: 0x6f, + 0x188: 0x70, 0x189: 0x18, 0x18a: 0x19, 0x18b: 0x71, 0x18c: 0x72, + 0x1ab: 0x73, + 0x1b3: 0x74, 0x1b5: 0x75, 0x1b7: 0x76, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x77, 0x1c1: 0x1a, 0x1c2: 0x1b, 0x1c3: 0x1c, 0x1c4: 0x78, 0x1c5: 0x79, + 0x1c9: 0x7a, 0x1cc: 0x7b, 0x1cd: 0x7c, + // Block 0x8, offset 0x200 + 0x219: 0x7d, 0x21a: 0x7e, 0x21b: 0x7f, + 0x220: 0x80, 0x223: 0x81, 0x224: 0x82, 0x225: 0x83, 0x226: 0x84, 0x227: 0x85, + 0x22a: 0x86, 0x22b: 0x87, 0x22f: 0x88, + 0x230: 0x89, 0x231: 0x8a, 0x232: 0x8b, 0x233: 0x8c, 0x234: 0x8d, 0x235: 0x8e, 0x236: 0x8f, 0x237: 0x89, + 0x238: 0x8a, 0x239: 0x8b, 0x23a: 0x8c, 0x23b: 0x8d, 0x23c: 0x8e, 0x23d: 0x8f, 0x23e: 0x89, 0x23f: 0x8a, + // Block 0x9, offset 0x240 + 0x240: 0x8b, 0x241: 0x8c, 0x242: 0x8d, 0x243: 0x8e, 0x244: 0x8f, 0x245: 0x89, 0x246: 0x8a, 0x247: 0x8b, + 0x248: 0x8c, 0x249: 0x8d, 0x24a: 0x8e, 0x24b: 0x8f, 0x24c: 0x89, 0x24d: 0x8a, 0x24e: 0x8b, 0x24f: 0x8c, + 0x250: 0x8d, 0x251: 0x8e, 0x252: 0x8f, 0x253: 0x89, 0x254: 0x8a, 0x255: 0x8b, 0x256: 0x8c, 0x257: 0x8d, + 0x258: 0x8e, 0x259: 0x8f, 0x25a: 0x89, 0x25b: 0x8a, 0x25c: 0x8b, 0x25d: 0x8c, 0x25e: 0x8d, 0x25f: 0x8e, + 0x260: 0x8f, 0x261: 0x89, 0x262: 0x8a, 0x263: 0x8b, 0x264: 0x8c, 0x265: 0x8d, 0x266: 0x8e, 0x267: 0x8f, + 0x268: 0x89, 0x269: 0x8a, 0x26a: 0x8b, 0x26b: 0x8c, 0x26c: 0x8d, 0x26d: 0x8e, 0x26e: 0x8f, 0x26f: 0x89, + 0x270: 0x8a, 0x271: 0x8b, 0x272: 0x8c, 0x273: 0x8d, 0x274: 0x8e, 0x275: 0x8f, 0x276: 0x89, 0x277: 0x8a, + 0x278: 0x8b, 0x279: 0x8c, 0x27a: 0x8d, 0x27b: 0x8e, 0x27c: 0x8f, 0x27d: 0x89, 0x27e: 0x8a, 0x27f: 0x8b, + // Block 0xa, offset 0x280 + 0x280: 0x8c, 0x281: 0x8d, 0x282: 0x8e, 0x283: 0x8f, 0x284: 0x89, 0x285: 0x8a, 0x286: 0x8b, 0x287: 0x8c, + 0x288: 0x8d, 0x289: 0x8e, 0x28a: 0x8f, 0x28b: 0x89, 0x28c: 0x8a, 0x28d: 0x8b, 0x28e: 0x8c, 0x28f: 0x8d, + 0x290: 0x8e, 0x291: 0x8f, 0x292: 0x89, 0x293: 0x8a, 0x294: 0x8b, 0x295: 0x8c, 0x296: 0x8d, 0x297: 0x8e, + 0x298: 0x8f, 0x299: 0x89, 0x29a: 0x8a, 0x29b: 0x8b, 0x29c: 0x8c, 0x29d: 0x8d, 0x29e: 0x8e, 0x29f: 0x8f, + 0x2a0: 0x89, 0x2a1: 0x8a, 0x2a2: 0x8b, 0x2a3: 0x8c, 0x2a4: 0x8d, 0x2a5: 0x8e, 0x2a6: 0x8f, 0x2a7: 0x89, + 0x2a8: 0x8a, 0x2a9: 0x8b, 0x2aa: 0x8c, 0x2ab: 0x8d, 0x2ac: 0x8e, 0x2ad: 0x8f, 0x2ae: 0x89, 0x2af: 0x8a, + 0x2b0: 0x8b, 0x2b1: 0x8c, 0x2b2: 0x8d, 0x2b3: 0x8e, 0x2b4: 0x8f, 0x2b5: 0x89, 0x2b6: 0x8a, 0x2b7: 0x8b, + 0x2b8: 0x8c, 0x2b9: 0x8d, 0x2ba: 0x8e, 0x2bb: 0x8f, 0x2bc: 0x89, 0x2bd: 0x8a, 0x2be: 0x8b, 0x2bf: 0x8c, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x8d, 0x2c1: 0x8e, 0x2c2: 0x8f, 0x2c3: 0x89, 0x2c4: 0x8a, 0x2c5: 0x8b, 0x2c6: 0x8c, 0x2c7: 0x8d, + 0x2c8: 0x8e, 0x2c9: 0x8f, 0x2ca: 0x89, 0x2cb: 0x8a, 0x2cc: 0x8b, 0x2cd: 0x8c, 0x2ce: 0x8d, 0x2cf: 0x8e, + 0x2d0: 0x8f, 0x2d1: 0x89, 0x2d2: 0x8a, 0x2d3: 0x8b, 0x2d4: 0x8c, 0x2d5: 0x8d, 0x2d6: 0x8e, 0x2d7: 0x8f, + 0x2d8: 0x89, 0x2d9: 0x8a, 0x2da: 0x8b, 0x2db: 0x8c, 0x2dc: 0x8d, 0x2dd: 0x8e, 0x2de: 0x90, + // Block 0xc, offset 0x300 + 0x324: 0x1d, 0x325: 0x1e, 0x326: 0x1f, 0x327: 0x20, + 0x328: 0x21, 0x329: 0x22, 0x32a: 0x23, 0x32b: 0x24, 0x32c: 0x91, 0x32d: 0x92, 0x32e: 0x93, + 0x331: 0x94, 0x332: 0x95, 0x333: 0x96, 0x334: 0x97, + 0x338: 0x98, 0x339: 0x99, 0x33a: 0x9a, 0x33b: 0x9b, 0x33e: 0x9c, 0x33f: 0x9d, + // Block 0xd, offset 0x340 + 0x347: 0x9e, + 0x34b: 0x9f, 0x34d: 0xa0, + 0x368: 0xa1, 0x36b: 0xa2, + 0x374: 0xa3, + 0x37a: 0xa4, 0x37b: 0xa5, 0x37d: 0xa6, 0x37e: 0xa7, + // Block 0xe, offset 0x380 + 0x381: 0xa8, 0x382: 0xa9, 0x384: 0xaa, 0x385: 0x84, 0x387: 0xab, + 0x388: 0xac, 0x38b: 0xad, 0x38c: 0xae, 0x38d: 0xaf, + 0x391: 0xb0, 0x392: 0xb1, 0x393: 0xb2, 0x396: 0xb3, 0x397: 0xb4, + 0x398: 0x75, 0x39a: 0xb5, 0x39c: 0xb6, + 0x3a0: 0xb7, 0x3a4: 0xb8, 0x3a5: 0xb9, 0x3a7: 0xba, + 0x3a8: 0xbb, 0x3a9: 0xbc, 0x3aa: 0xbd, + 0x3b0: 0x75, 0x3b5: 0xbe, 0x3b6: 0xbf, + 0x3bd: 0xc0, + // Block 0xf, offset 0x3c0 + 0x3eb: 0xc1, 0x3ec: 0xc2, + 0x3ff: 0xc3, + // Block 0x10, offset 0x400 + 0x432: 0xc4, + // Block 0x11, offset 0x440 + 0x445: 0xc5, 0x446: 0xc6, 0x447: 0xc7, + 0x449: 0xc8, + // Block 0x12, offset 0x480 + 0x480: 0xc9, 0x482: 0xca, 0x484: 0xc2, + 0x48a: 0xcb, 0x48b: 0xcc, + 0x493: 0xcd, + 0x4a3: 0xce, 0x4a5: 0xcf, + // Block 0x13, offset 0x4c0 + 0x4c8: 0xd0, + // Block 0x14, offset 0x500 + 0x520: 0x25, 0x521: 0x26, 0x522: 0x27, 0x523: 0x28, 0x524: 0x29, 0x525: 0x2a, 0x526: 0x2b, 0x527: 0x2c, + 0x528: 0x2d, + // Block 0x15, offset 0x540 + 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, + 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, +} + +// nfcSparseOffset: 163 entries, 326 bytes +var nfcSparseOffset = []uint16{0x0, 0x5, 0x9, 0xb, 0xd, 0x18, 0x28, 0x2a, 0x2f, 0x3a, 0x49, 0x56, 0x5e, 0x63, 0x68, 0x6a, 0x6e, 0x76, 0x7d, 0x80, 0x88, 0x8c, 0x90, 0x92, 0x94, 0x9d, 0xa1, 0xa8, 0xad, 0xb0, 0xba, 0xbd, 0xc4, 0xcc, 0xcf, 0xd1, 0xd4, 0xd6, 0xdb, 0xec, 0xf8, 0xfa, 0x100, 0x102, 0x104, 0x106, 0x108, 0x10a, 0x10c, 0x10f, 0x112, 0x114, 0x117, 0x11a, 0x11e, 0x124, 0x12b, 0x134, 0x136, 0x139, 0x13b, 0x146, 0x14a, 0x158, 0x15b, 0x161, 0x167, 0x172, 0x176, 0x178, 0x17a, 0x17c, 0x17e, 0x180, 0x186, 0x18a, 0x18c, 0x18e, 0x196, 0x19a, 0x19d, 0x19f, 0x1a1, 0x1a4, 0x1a7, 0x1a9, 0x1ab, 0x1ad, 0x1af, 0x1b5, 0x1b8, 0x1ba, 0x1c1, 0x1c7, 0x1cd, 0x1d5, 0x1db, 0x1e1, 0x1e7, 0x1eb, 0x1f9, 0x202, 0x205, 0x208, 0x20a, 0x20d, 0x20f, 0x213, 0x218, 0x21a, 0x21c, 0x221, 0x227, 0x229, 0x22b, 0x22d, 0x233, 0x236, 0x238, 0x23a, 0x23c, 0x242, 0x246, 0x24a, 0x252, 0x259, 0x25c, 0x25f, 0x261, 0x264, 0x26c, 0x270, 0x277, 0x27a, 0x280, 0x282, 0x285, 0x287, 0x28a, 0x28f, 0x291, 0x293, 0x295, 0x297, 0x299, 0x29c, 0x29e, 0x2a0, 0x2a2, 0x2a4, 0x2a6, 0x2a8, 0x2b5, 0x2bf, 0x2c1, 0x2c3, 0x2c9, 0x2cb, 0x2cd, 0x2cf, 0x2d3, 0x2d5, 0x2d8} + +// nfcSparseValues: 730 entries, 2920 bytes +var nfcSparseValues = [730]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0000, lo: 0x04}, + {value: 0xa100, lo: 0xa8, hi: 0xa8}, + {value: 0x8100, lo: 0xaf, hi: 0xaf}, + {value: 0x8100, lo: 0xb4, hi: 0xb4}, + {value: 0x8100, lo: 0xb8, hi: 0xb8}, + // Block 0x1, offset 0x5 + {value: 0x0091, lo: 0x03}, + {value: 0x4823, lo: 0xa0, hi: 0xa1}, + {value: 0x4855, lo: 0xaf, hi: 0xb0}, + {value: 0xa000, lo: 0xb7, hi: 0xb7}, + // Block 0x2, offset 0x9 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + // Block 0x3, offset 0xb + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x98, hi: 0x9d}, + // Block 0x4, offset 0xd + {value: 0x0006, lo: 0x0a}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x85, hi: 0x85}, + {value: 0xa000, lo: 0x89, hi: 0x89}, + {value: 0x4981, lo: 0x8a, hi: 0x8a}, + {value: 0x499f, lo: 0x8b, hi: 0x8b}, + {value: 0x3808, lo: 0x8c, hi: 0x8c}, + {value: 0x3820, lo: 0x8d, hi: 0x8d}, + {value: 0x49b7, lo: 0x8e, hi: 0x8e}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x383e, lo: 0x93, hi: 0x94}, + // Block 0x5, offset 0x18 + {value: 0x0000, lo: 0x0f}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0xa000, lo: 0x8d, hi: 0x8d}, + {value: 0x38e6, lo: 0x90, hi: 0x90}, + {value: 0x38f2, lo: 0x91, hi: 0x91}, + {value: 0x38e0, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x96, hi: 0x96}, + {value: 0x3958, lo: 0x97, hi: 0x97}, + {value: 0x3922, lo: 0x9c, hi: 0x9c}, + {value: 0x390a, lo: 0x9d, hi: 0x9d}, + {value: 0x3934, lo: 0x9e, hi: 0x9e}, + {value: 0xa000, lo: 0xb4, hi: 0xb5}, + {value: 0x395e, lo: 0xb6, hi: 0xb6}, + {value: 0x3964, lo: 0xb7, hi: 0xb7}, + // Block 0x6, offset 0x28 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x83, hi: 0x87}, + // Block 0x7, offset 0x2a + {value: 0x0001, lo: 0x04}, + {value: 0x8114, lo: 0x81, hi: 0x82}, + {value: 0x8133, lo: 0x84, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + {value: 0x810e, lo: 0x87, hi: 0x87}, + // Block 0x8, offset 0x2f + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x97}, + {value: 0x811a, lo: 0x98, hi: 0x98}, + {value: 0x811b, lo: 0x99, hi: 0x99}, + {value: 0x811c, lo: 0x9a, hi: 0x9a}, + {value: 0x3982, lo: 0xa2, hi: 0xa2}, + {value: 0x3988, lo: 0xa3, hi: 0xa3}, + {value: 0x3994, lo: 0xa4, hi: 0xa4}, + {value: 0x398e, lo: 0xa5, hi: 0xa5}, + {value: 0x399a, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xa7, hi: 0xa7}, + // Block 0x9, offset 0x3a + {value: 0x0000, lo: 0x0e}, + {value: 0x39ac, lo: 0x80, hi: 0x80}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0x39a0, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x39a6, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x95, hi: 0x95}, + {value: 0x8133, lo: 0x96, hi: 0x9c}, + {value: 0x8133, lo: 0x9f, hi: 0xa2}, + {value: 0x812e, lo: 0xa3, hi: 0xa3}, + {value: 0x8133, lo: 0xa4, hi: 0xa4}, + {value: 0x8133, lo: 0xa7, hi: 0xa8}, + {value: 0x812e, lo: 0xaa, hi: 0xaa}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + // Block 0xa, offset 0x49 + {value: 0x0000, lo: 0x0c}, + {value: 0x8120, lo: 0x91, hi: 0x91}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x812e, lo: 0xb1, hi: 0xb1}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb5, hi: 0xb6}, + {value: 0x812e, lo: 0xb7, hi: 0xb9}, + {value: 0x8133, lo: 0xba, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbc}, + {value: 0x8133, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbe, hi: 0xbe}, + {value: 0x8133, lo: 0xbf, hi: 0xbf}, + // Block 0xb, offset 0x56 + {value: 0x0005, lo: 0x07}, + {value: 0x8133, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x812e, lo: 0x82, hi: 0x83}, + {value: 0x812e, lo: 0x84, hi: 0x85}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x812e, lo: 0x88, hi: 0x89}, + {value: 0x8133, lo: 0x8a, hi: 0x8a}, + // Block 0xc, offset 0x5e + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0xab, hi: 0xb1}, + {value: 0x812e, lo: 0xb2, hi: 0xb2}, + {value: 0x8133, lo: 0xb3, hi: 0xb3}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0xd, offset 0x63 + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0x96, hi: 0x99}, + {value: 0x8133, lo: 0x9b, hi: 0xa3}, + {value: 0x8133, lo: 0xa5, hi: 0xa7}, + {value: 0x8133, lo: 0xa9, hi: 0xad}, + // Block 0xe, offset 0x68 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + // Block 0xf, offset 0x6a + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0x98, hi: 0x98}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + {value: 0x8133, lo: 0x9c, hi: 0x9f}, + // Block 0x10, offset 0x6e + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0xa8, hi: 0xa8}, + {value: 0x4019, lo: 0xa9, hi: 0xa9}, + {value: 0xa000, lo: 0xb0, hi: 0xb0}, + {value: 0x4021, lo: 0xb1, hi: 0xb1}, + {value: 0xa000, lo: 0xb3, hi: 0xb3}, + {value: 0x4029, lo: 0xb4, hi: 0xb4}, + {value: 0x9903, lo: 0xbc, hi: 0xbc}, + // Block 0x11, offset 0x76 + {value: 0x0008, lo: 0x06}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x91, hi: 0x91}, + {value: 0x812e, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x93, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x94}, + {value: 0x465d, lo: 0x98, hi: 0x9f}, + // Block 0x12, offset 0x7d + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x13, offset 0x80 + {value: 0x0008, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2dd5, lo: 0x8b, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x469d, lo: 0x9c, hi: 0x9d}, + {value: 0x46ad, lo: 0x9f, hi: 0x9f}, + {value: 0x8133, lo: 0xbe, hi: 0xbe}, + // Block 0x14, offset 0x88 + {value: 0x0000, lo: 0x03}, + {value: 0x46d5, lo: 0xb3, hi: 0xb3}, + {value: 0x46dd, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x15, offset 0x8c + {value: 0x0008, lo: 0x03}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x46b5, lo: 0x99, hi: 0x9b}, + {value: 0x46cd, lo: 0x9e, hi: 0x9e}, + // Block 0x16, offset 0x90 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x17, offset 0x92 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + // Block 0x18, offset 0x94 + {value: 0x0000, lo: 0x08}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ded, lo: 0x88, hi: 0x88}, + {value: 0x2de5, lo: 0x8b, hi: 0x8b}, + {value: 0x2df5, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x96, hi: 0x97}, + {value: 0x46e5, lo: 0x9c, hi: 0x9c}, + {value: 0x46ed, lo: 0x9d, hi: 0x9d}, + // Block 0x19, offset 0x9d + {value: 0x0000, lo: 0x03}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x2dfd, lo: 0x94, hi: 0x94}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1a, offset 0xa1 + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e05, lo: 0x8a, hi: 0x8a}, + {value: 0x2e15, lo: 0x8b, hi: 0x8b}, + {value: 0x2e0d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1b, offset 0xa8 + {value: 0x1801, lo: 0x04}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x4031, lo: 0x88, hi: 0x88}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8121, lo: 0x95, hi: 0x96}, + // Block 0x1c, offset 0xad + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0xa000, lo: 0xbf, hi: 0xbf}, + // Block 0x1d, offset 0xb0 + {value: 0x0000, lo: 0x09}, + {value: 0x2e1d, lo: 0x80, hi: 0x80}, + {value: 0x9900, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x2e25, lo: 0x87, hi: 0x87}, + {value: 0x2e2d, lo: 0x88, hi: 0x88}, + {value: 0x3091, lo: 0x8a, hi: 0x8a}, + {value: 0x2f19, lo: 0x8b, hi: 0x8b}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x95, hi: 0x96}, + // Block 0x1e, offset 0xba + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1f, offset 0xbd + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e35, lo: 0x8a, hi: 0x8a}, + {value: 0x2e45, lo: 0x8b, hi: 0x8b}, + {value: 0x2e3d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x20, offset 0xc4 + {value: 0x6ab3, lo: 0x07}, + {value: 0x9905, lo: 0x8a, hi: 0x8a}, + {value: 0x9900, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4039, lo: 0x9a, hi: 0x9a}, + {value: 0x3099, lo: 0x9c, hi: 0x9c}, + {value: 0x2f24, lo: 0x9d, hi: 0x9d}, + {value: 0x2e4d, lo: 0x9e, hi: 0x9f}, + // Block 0x21, offset 0xcc + {value: 0x0000, lo: 0x02}, + {value: 0x8123, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x22, offset 0xcf + {value: 0x0000, lo: 0x01}, + {value: 0x8124, lo: 0x88, hi: 0x8b}, + // Block 0x23, offset 0xd1 + {value: 0x0000, lo: 0x02}, + {value: 0x8125, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x24, offset 0xd4 + {value: 0x0000, lo: 0x01}, + {value: 0x8126, lo: 0x88, hi: 0x8b}, + // Block 0x25, offset 0xd6 + {value: 0x0000, lo: 0x04}, + {value: 0x812e, lo: 0x98, hi: 0x99}, + {value: 0x812e, lo: 0xb5, hi: 0xb5}, + {value: 0x812e, lo: 0xb7, hi: 0xb7}, + {value: 0x812c, lo: 0xb9, hi: 0xb9}, + // Block 0x26, offset 0xdb + {value: 0x0000, lo: 0x10}, + {value: 0x2774, lo: 0x83, hi: 0x83}, + {value: 0x277b, lo: 0x8d, hi: 0x8d}, + {value: 0x2782, lo: 0x92, hi: 0x92}, + {value: 0x2789, lo: 0x97, hi: 0x97}, + {value: 0x2790, lo: 0x9c, hi: 0x9c}, + {value: 0x276d, lo: 0xa9, hi: 0xa9}, + {value: 0x8127, lo: 0xb1, hi: 0xb1}, + {value: 0x8128, lo: 0xb2, hi: 0xb2}, + {value: 0x4bc5, lo: 0xb3, hi: 0xb3}, + {value: 0x8129, lo: 0xb4, hi: 0xb4}, + {value: 0x4bce, lo: 0xb5, hi: 0xb5}, + {value: 0x46f5, lo: 0xb6, hi: 0xb6}, + {value: 0x8200, lo: 0xb7, hi: 0xb7}, + {value: 0x46fd, lo: 0xb8, hi: 0xb8}, + {value: 0x8200, lo: 0xb9, hi: 0xb9}, + {value: 0x8128, lo: 0xba, hi: 0xbd}, + // Block 0x27, offset 0xec + {value: 0x0000, lo: 0x0b}, + {value: 0x8128, lo: 0x80, hi: 0x80}, + {value: 0x4bd7, lo: 0x81, hi: 0x81}, + {value: 0x8133, lo: 0x82, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0x86, hi: 0x87}, + {value: 0x279e, lo: 0x93, hi: 0x93}, + {value: 0x27a5, lo: 0x9d, hi: 0x9d}, + {value: 0x27ac, lo: 0xa2, hi: 0xa2}, + {value: 0x27b3, lo: 0xa7, hi: 0xa7}, + {value: 0x27ba, lo: 0xac, hi: 0xac}, + {value: 0x2797, lo: 0xb9, hi: 0xb9}, + // Block 0x28, offset 0xf8 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x86, hi: 0x86}, + // Block 0x29, offset 0xfa + {value: 0x0000, lo: 0x05}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x2e55, lo: 0xa6, hi: 0xa6}, + {value: 0x9900, lo: 0xae, hi: 0xae}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x2a, offset 0x100 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + // Block 0x2b, offset 0x102 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x80, hi: 0x92}, + // Block 0x2c, offset 0x104 + {value: 0x0000, lo: 0x01}, + {value: 0xb900, lo: 0xa1, hi: 0xb5}, + // Block 0x2d, offset 0x106 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0xa8, hi: 0xbf}, + // Block 0x2e, offset 0x108 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0x80, hi: 0x82}, + // Block 0x2f, offset 0x10a + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9d, hi: 0x9f}, + // Block 0x30, offset 0x10c + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x94, hi: 0x95}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x31, offset 0x10f + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x9d, hi: 0x9d}, + // Block 0x32, offset 0x112 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa9, hi: 0xa9}, + // Block 0x33, offset 0x114 + {value: 0x0004, lo: 0x02}, + {value: 0x812f, lo: 0xb9, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbb}, + // Block 0x34, offset 0x117 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x97, hi: 0x97}, + {value: 0x812e, lo: 0x98, hi: 0x98}, + // Block 0x35, offset 0x11a + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + {value: 0x8133, lo: 0xb5, hi: 0xbc}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x36, offset 0x11e + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + {value: 0x812e, lo: 0xb5, hi: 0xba}, + {value: 0x8133, lo: 0xbb, hi: 0xbc}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x37, offset 0x124 + {value: 0x0000, lo: 0x06}, + {value: 0x812e, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8a}, + {value: 0x8133, lo: 0x8b, hi: 0x8e}, + // Block 0x38, offset 0x12b + {value: 0x0000, lo: 0x08}, + {value: 0x2e9d, lo: 0x80, hi: 0x80}, + {value: 0x2ea5, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x82, hi: 0x82}, + {value: 0x2ead, lo: 0x83, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xab, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xac}, + {value: 0x8133, lo: 0xad, hi: 0xb3}, + // Block 0x39, offset 0x134 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xaa, hi: 0xab}, + // Block 0x3a, offset 0x136 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xa6, hi: 0xa6}, + {value: 0x8105, lo: 0xb2, hi: 0xb3}, + // Block 0x3b, offset 0x139 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x3c, offset 0x13b + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x92}, + {value: 0x8101, lo: 0x94, hi: 0x94}, + {value: 0x812e, lo: 0x95, hi: 0x99}, + {value: 0x8133, lo: 0x9a, hi: 0x9b}, + {value: 0x812e, lo: 0x9c, hi: 0x9f}, + {value: 0x8133, lo: 0xa0, hi: 0xa0}, + {value: 0x8101, lo: 0xa2, hi: 0xa8}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + {value: 0x8133, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb8, hi: 0xb9}, + // Block 0x3d, offset 0x146 + {value: 0x0004, lo: 0x03}, + {value: 0x052a, lo: 0x80, hi: 0x81}, + {value: 0x8100, lo: 0x97, hi: 0x97}, + {value: 0x8100, lo: 0xbe, hi: 0xbe}, + // Block 0x3e, offset 0x14a + {value: 0x0000, lo: 0x0d}, + {value: 0x8133, lo: 0x90, hi: 0x91}, + {value: 0x8101, lo: 0x92, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x97}, + {value: 0x8101, lo: 0x98, hi: 0x9a}, + {value: 0x8133, lo: 0x9b, hi: 0x9c}, + {value: 0x8133, lo: 0xa1, hi: 0xa1}, + {value: 0x8101, lo: 0xa5, hi: 0xa6}, + {value: 0x8133, lo: 0xa7, hi: 0xa7}, + {value: 0x812e, lo: 0xa8, hi: 0xa8}, + {value: 0x8133, lo: 0xa9, hi: 0xa9}, + {value: 0x8101, lo: 0xaa, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xaf}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + // Block 0x3f, offset 0x158 + {value: 0x43bc, lo: 0x02}, + {value: 0x023c, lo: 0xa6, hi: 0xa6}, + {value: 0x0057, lo: 0xaa, hi: 0xab}, + // Block 0x40, offset 0x15b + {value: 0x0007, lo: 0x05}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + {value: 0x3cfa, lo: 0x9a, hi: 0x9b}, + {value: 0x3d08, lo: 0xae, hi: 0xae}, + // Block 0x41, offset 0x161 + {value: 0x000e, lo: 0x05}, + {value: 0x3d0f, lo: 0x8d, hi: 0x8e}, + {value: 0x3d16, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + // Block 0x42, offset 0x167 + {value: 0x62c7, lo: 0x0a}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0x3d24, lo: 0x84, hi: 0x84}, + {value: 0xa000, lo: 0x88, hi: 0x88}, + {value: 0x3d2b, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0x3d32, lo: 0x8c, hi: 0x8c}, + {value: 0xa000, lo: 0xa3, hi: 0xa3}, + {value: 0x3d39, lo: 0xa4, hi: 0xa5}, + {value: 0x3d40, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xbc, hi: 0xbc}, + // Block 0x43, offset 0x172 + {value: 0x0007, lo: 0x03}, + {value: 0x3da9, lo: 0xa0, hi: 0xa1}, + {value: 0x3dd3, lo: 0xa2, hi: 0xa3}, + {value: 0x3dfd, lo: 0xaa, hi: 0xad}, + // Block 0x44, offset 0x176 + {value: 0x0004, lo: 0x01}, + {value: 0x0586, lo: 0xa9, hi: 0xaa}, + // Block 0x45, offset 0x178 + {value: 0x0000, lo: 0x01}, + {value: 0x461e, lo: 0x9c, hi: 0x9c}, + // Block 0x46, offset 0x17a + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xaf, hi: 0xb1}, + // Block 0x47, offset 0x17c + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x48, offset 0x17e + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa0, hi: 0xbf}, + // Block 0x49, offset 0x180 + {value: 0x0000, lo: 0x05}, + {value: 0x812d, lo: 0xaa, hi: 0xaa}, + {value: 0x8132, lo: 0xab, hi: 0xab}, + {value: 0x8134, lo: 0xac, hi: 0xac}, + {value: 0x812f, lo: 0xad, hi: 0xad}, + {value: 0x8130, lo: 0xae, hi: 0xaf}, + // Block 0x4a, offset 0x186 + {value: 0x0000, lo: 0x03}, + {value: 0x4be0, lo: 0xb3, hi: 0xb3}, + {value: 0x4be0, lo: 0xb5, hi: 0xb6}, + {value: 0x4be0, lo: 0xba, hi: 0xbf}, + // Block 0x4b, offset 0x18a + {value: 0x0000, lo: 0x01}, + {value: 0x4be0, lo: 0x8f, hi: 0xa3}, + // Block 0x4c, offset 0x18c + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xae, hi: 0xbe}, + // Block 0x4d, offset 0x18e + {value: 0x0000, lo: 0x07}, + {value: 0x8100, lo: 0x84, hi: 0x84}, + {value: 0x8100, lo: 0x87, hi: 0x87}, + {value: 0x8100, lo: 0x90, hi: 0x90}, + {value: 0x8100, lo: 0x9e, hi: 0x9e}, + {value: 0x8100, lo: 0xa1, hi: 0xa1}, + {value: 0x8100, lo: 0xb2, hi: 0xb2}, + {value: 0x8100, lo: 0xbb, hi: 0xbb}, + // Block 0x4e, offset 0x196 + {value: 0x0000, lo: 0x03}, + {value: 0x8100, lo: 0x80, hi: 0x80}, + {value: 0x8100, lo: 0x8b, hi: 0x8b}, + {value: 0x8100, lo: 0x8e, hi: 0x8e}, + // Block 0x4f, offset 0x19a + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + {value: 0x8133, lo: 0xb4, hi: 0xbd}, + // Block 0x50, offset 0x19d + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9e, hi: 0x9f}, + // Block 0x51, offset 0x19f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb1}, + // Block 0x52, offset 0x1a1 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xac, hi: 0xac}, + // Block 0x53, offset 0x1a4 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xa0, hi: 0xb1}, + // Block 0x54, offset 0x1a7 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xab, hi: 0xad}, + // Block 0x55, offset 0x1a9 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x93, hi: 0x93}, + // Block 0x56, offset 0x1ab + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb3, hi: 0xb3}, + // Block 0x57, offset 0x1ad + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + // Block 0x58, offset 0x1af + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb7, hi: 0xb8}, + {value: 0x8133, lo: 0xbe, hi: 0xbf}, + // Block 0x59, offset 0x1b5 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + // Block 0x5a, offset 0x1b8 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xad, hi: 0xad}, + // Block 0x5b, offset 0x1ba + {value: 0x0000, lo: 0x06}, + {value: 0xe500, lo: 0x80, hi: 0x80}, + {value: 0xc600, lo: 0x81, hi: 0x9b}, + {value: 0xe500, lo: 0x9c, hi: 0x9c}, + {value: 0xc600, lo: 0x9d, hi: 0xb7}, + {value: 0xe500, lo: 0xb8, hi: 0xb8}, + {value: 0xc600, lo: 0xb9, hi: 0xbf}, + // Block 0x5c, offset 0x1c1 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x93}, + {value: 0xe500, lo: 0x94, hi: 0x94}, + {value: 0xc600, lo: 0x95, hi: 0xaf}, + {value: 0xe500, lo: 0xb0, hi: 0xb0}, + {value: 0xc600, lo: 0xb1, hi: 0xbf}, + // Block 0x5d, offset 0x1c7 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8b}, + {value: 0xe500, lo: 0x8c, hi: 0x8c}, + {value: 0xc600, lo: 0x8d, hi: 0xa7}, + {value: 0xe500, lo: 0xa8, hi: 0xa8}, + {value: 0xc600, lo: 0xa9, hi: 0xbf}, + // Block 0x5e, offset 0x1cd + {value: 0x0000, lo: 0x07}, + {value: 0xc600, lo: 0x80, hi: 0x83}, + {value: 0xe500, lo: 0x84, hi: 0x84}, + {value: 0xc600, lo: 0x85, hi: 0x9f}, + {value: 0xe500, lo: 0xa0, hi: 0xa0}, + {value: 0xc600, lo: 0xa1, hi: 0xbb}, + {value: 0xe500, lo: 0xbc, hi: 0xbc}, + {value: 0xc600, lo: 0xbd, hi: 0xbf}, + // Block 0x5f, offset 0x1d5 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x97}, + {value: 0xe500, lo: 0x98, hi: 0x98}, + {value: 0xc600, lo: 0x99, hi: 0xb3}, + {value: 0xe500, lo: 0xb4, hi: 0xb4}, + {value: 0xc600, lo: 0xb5, hi: 0xbf}, + // Block 0x60, offset 0x1db + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8f}, + {value: 0xe500, lo: 0x90, hi: 0x90}, + {value: 0xc600, lo: 0x91, hi: 0xab}, + {value: 0xe500, lo: 0xac, hi: 0xac}, + {value: 0xc600, lo: 0xad, hi: 0xbf}, + // Block 0x61, offset 0x1e1 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + {value: 0xe500, lo: 0xa4, hi: 0xa4}, + {value: 0xc600, lo: 0xa5, hi: 0xbf}, + // Block 0x62, offset 0x1e7 + {value: 0x0000, lo: 0x03}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + // Block 0x63, offset 0x1eb + {value: 0x0006, lo: 0x0d}, + {value: 0x44d1, lo: 0x9d, hi: 0x9d}, + {value: 0x8116, lo: 0x9e, hi: 0x9e}, + {value: 0x4543, lo: 0x9f, hi: 0x9f}, + {value: 0x4531, lo: 0xaa, hi: 0xab}, + {value: 0x4635, lo: 0xac, hi: 0xac}, + {value: 0x463d, lo: 0xad, hi: 0xad}, + {value: 0x4489, lo: 0xae, hi: 0xb1}, + {value: 0x44a7, lo: 0xb2, hi: 0xb4}, + {value: 0x44bf, lo: 0xb5, hi: 0xb6}, + {value: 0x44cb, lo: 0xb8, hi: 0xb8}, + {value: 0x44d7, lo: 0xb9, hi: 0xbb}, + {value: 0x44ef, lo: 0xbc, hi: 0xbc}, + {value: 0x44f5, lo: 0xbe, hi: 0xbe}, + // Block 0x64, offset 0x1f9 + {value: 0x0006, lo: 0x08}, + {value: 0x44fb, lo: 0x80, hi: 0x81}, + {value: 0x4507, lo: 0x83, hi: 0x84}, + {value: 0x4519, lo: 0x86, hi: 0x89}, + {value: 0x453d, lo: 0x8a, hi: 0x8a}, + {value: 0x44b9, lo: 0x8b, hi: 0x8b}, + {value: 0x44a1, lo: 0x8c, hi: 0x8c}, + {value: 0x44e9, lo: 0x8d, hi: 0x8d}, + {value: 0x4513, lo: 0x8e, hi: 0x8e}, + // Block 0x65, offset 0x202 + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0xa4, hi: 0xa5}, + {value: 0x8100, lo: 0xb0, hi: 0xb1}, + // Block 0x66, offset 0x205 + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0x9b, hi: 0x9d}, + {value: 0x8200, lo: 0x9e, hi: 0xa3}, + // Block 0x67, offset 0x208 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x90, hi: 0x90}, + // Block 0x68, offset 0x20a + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0x99, hi: 0x99}, + {value: 0x8200, lo: 0xb2, hi: 0xb4}, + // Block 0x69, offset 0x20d + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xbc, hi: 0xbd}, + // Block 0x6a, offset 0x20f + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0xa0, hi: 0xa6}, + {value: 0x812e, lo: 0xa7, hi: 0xad}, + {value: 0x8133, lo: 0xae, hi: 0xaf}, + // Block 0x6b, offset 0x213 + {value: 0x0000, lo: 0x04}, + {value: 0x8100, lo: 0x89, hi: 0x8c}, + {value: 0x8100, lo: 0xb0, hi: 0xb2}, + {value: 0x8100, lo: 0xb4, hi: 0xb4}, + {value: 0x8100, lo: 0xb6, hi: 0xbf}, + // Block 0x6c, offset 0x218 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x81, hi: 0x8c}, + // Block 0x6d, offset 0x21a + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xb5, hi: 0xba}, + // Block 0x6e, offset 0x21c + {value: 0x0000, lo: 0x04}, + {value: 0x4be0, lo: 0x9e, hi: 0x9f}, + {value: 0x4be0, lo: 0xa3, hi: 0xa3}, + {value: 0x4be0, lo: 0xa5, hi: 0xa6}, + {value: 0x4be0, lo: 0xaa, hi: 0xaf}, + // Block 0x6f, offset 0x221 + {value: 0x0000, lo: 0x05}, + {value: 0x4be0, lo: 0x82, hi: 0x87}, + {value: 0x4be0, lo: 0x8a, hi: 0x8f}, + {value: 0x4be0, lo: 0x92, hi: 0x97}, + {value: 0x4be0, lo: 0x9a, hi: 0x9c}, + {value: 0x8100, lo: 0xa3, hi: 0xa3}, + // Block 0x70, offset 0x227 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0x71, offset 0x229 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xa0, hi: 0xa0}, + // Block 0x72, offset 0x22b + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb6, hi: 0xba}, + // Block 0x73, offset 0x22d + {value: 0x002d, lo: 0x05}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + {value: 0x8133, lo: 0xb8, hi: 0xb8}, + {value: 0x8101, lo: 0xb9, hi: 0xba}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x74, offset 0x233 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xa5, hi: 0xa5}, + {value: 0x812e, lo: 0xa6, hi: 0xa6}, + // Block 0x75, offset 0x236 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa4, hi: 0xa7}, + // Block 0x76, offset 0x238 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + // Block 0x77, offset 0x23a + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbf}, + // Block 0x78, offset 0x23c + {value: 0x0000, lo: 0x05}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x8133, lo: 0x88, hi: 0x8a}, + {value: 0x812e, lo: 0x8b, hi: 0x8b}, + {value: 0x8133, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x8d, hi: 0x90}, + // Block 0x79, offset 0x242 + {value: 0x0005, lo: 0x03}, + {value: 0x8133, lo: 0x82, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + // Block 0x7a, offset 0x246 + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xb0, hi: 0xb0}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x7b, offset 0x24a + {value: 0x17fe, lo: 0x07}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4379, lo: 0x9a, hi: 0x9a}, + {value: 0xa000, lo: 0x9b, hi: 0x9b}, + {value: 0x4383, lo: 0x9c, hi: 0x9c}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x438d, lo: 0xab, hi: 0xab}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x7c, offset 0x252 + {value: 0x0000, lo: 0x06}, + {value: 0x8133, lo: 0x80, hi: 0x82}, + {value: 0x9900, lo: 0xa7, hi: 0xa7}, + {value: 0x2eb5, lo: 0xae, hi: 0xae}, + {value: 0x2ebf, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb1, hi: 0xb2}, + {value: 0x8105, lo: 0xb3, hi: 0xb4}, + // Block 0x7d, offset 0x259 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0x7e, offset 0x25c + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb5, hi: 0xb5}, + {value: 0x8103, lo: 0xb6, hi: 0xb6}, + // Block 0x7f, offset 0x25f + {value: 0x0002, lo: 0x01}, + {value: 0x8103, lo: 0xa9, hi: 0xaa}, + // Block 0x80, offset 0x261 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x81, offset 0x264 + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ec9, lo: 0x8b, hi: 0x8b}, + {value: 0x2ed3, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x8133, lo: 0xa6, hi: 0xac}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + // Block 0x82, offset 0x26c + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x86, hi: 0x86}, + {value: 0x8133, lo: 0x9e, hi: 0x9e}, + // Block 0x83, offset 0x270 + {value: 0x6a23, lo: 0x06}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb9, hi: 0xb9}, + {value: 0x9900, lo: 0xba, hi: 0xba}, + {value: 0x2ee7, lo: 0xbb, hi: 0xbb}, + {value: 0x2edd, lo: 0xbc, hi: 0xbd}, + {value: 0x2ef1, lo: 0xbe, hi: 0xbe}, + // Block 0x84, offset 0x277 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x85, offset 0x27a + {value: 0x0000, lo: 0x05}, + {value: 0x9900, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb8, hi: 0xb9}, + {value: 0x2efb, lo: 0xba, hi: 0xba}, + {value: 0x2f05, lo: 0xbb, hi: 0xbb}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x86, offset 0x280 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x80, hi: 0x80}, + // Block 0x87, offset 0x282 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x88, offset 0x285 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xab, hi: 0xab}, + // Block 0x89, offset 0x287 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb9, hi: 0xb9}, + {value: 0x8103, lo: 0xba, hi: 0xba}, + // Block 0x8a, offset 0x28a + {value: 0x0000, lo: 0x04}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb5, hi: 0xb5}, + {value: 0x2f0f, lo: 0xb8, hi: 0xb8}, + {value: 0x8105, lo: 0xbd, hi: 0xbe}, + // Block 0x8b, offset 0x28f + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x8c, offset 0x291 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + // Block 0x8d, offset 0x293 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x8e, offset 0x295 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x87, hi: 0x87}, + // Block 0x8f, offset 0x297 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x99, hi: 0x99}, + // Block 0x90, offset 0x299 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0x82, hi: 0x82}, + {value: 0x8105, lo: 0x84, hi: 0x85}, + // Block 0x91, offset 0x29c + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x97, hi: 0x97}, + // Block 0x92, offset 0x29e + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x81, hi: 0x82}, + // Block 0x93, offset 0x2a0 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0xb0, hi: 0xb4}, + // Block 0x94, offset 0x2a2 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb6}, + // Block 0x95, offset 0x2a4 + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb0, hi: 0xb1}, + // Block 0x96, offset 0x2a6 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0x9e, hi: 0x9e}, + // Block 0x97, offset 0x2a8 + {value: 0x0000, lo: 0x0c}, + {value: 0x470d, lo: 0x9e, hi: 0x9e}, + {value: 0x4717, lo: 0x9f, hi: 0x9f}, + {value: 0x474b, lo: 0xa0, hi: 0xa0}, + {value: 0x4759, lo: 0xa1, hi: 0xa1}, + {value: 0x4767, lo: 0xa2, hi: 0xa2}, + {value: 0x4775, lo: 0xa3, hi: 0xa3}, + {value: 0x4783, lo: 0xa4, hi: 0xa4}, + {value: 0x812c, lo: 0xa5, hi: 0xa6}, + {value: 0x8101, lo: 0xa7, hi: 0xa9}, + {value: 0x8131, lo: 0xad, hi: 0xad}, + {value: 0x812c, lo: 0xae, hi: 0xb2}, + {value: 0x812e, lo: 0xbb, hi: 0xbf}, + // Block 0x98, offset 0x2b5 + {value: 0x0000, lo: 0x09}, + {value: 0x812e, lo: 0x80, hi: 0x82}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8b}, + {value: 0x8133, lo: 0xaa, hi: 0xad}, + {value: 0x4721, lo: 0xbb, hi: 0xbb}, + {value: 0x472b, lo: 0xbc, hi: 0xbc}, + {value: 0x4791, lo: 0xbd, hi: 0xbd}, + {value: 0x47ad, lo: 0xbe, hi: 0xbe}, + {value: 0x479f, lo: 0xbf, hi: 0xbf}, + // Block 0x99, offset 0x2bf + {value: 0x0000, lo: 0x01}, + {value: 0x47bb, lo: 0x80, hi: 0x80}, + // Block 0x9a, offset 0x2c1 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x82, hi: 0x84}, + // Block 0x9b, offset 0x2c3 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0x80, hi: 0x86}, + {value: 0x8133, lo: 0x88, hi: 0x98}, + {value: 0x8133, lo: 0x9b, hi: 0xa1}, + {value: 0x8133, lo: 0xa3, hi: 0xa4}, + {value: 0x8133, lo: 0xa6, hi: 0xaa}, + // Block 0x9c, offset 0x2c9 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + // Block 0x9d, offset 0x2cb + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xae, hi: 0xae}, + // Block 0x9e, offset 0x2cd + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xac, hi: 0xaf}, + // Block 0x9f, offset 0x2cf + {value: 0x0000, lo: 0x03}, + {value: 0x8134, lo: 0xac, hi: 0xad}, + {value: 0x812e, lo: 0xae, hi: 0xae}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + // Block 0xa0, offset 0x2d3 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x90, hi: 0x96}, + // Block 0xa1, offset 0x2d5 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x84, hi: 0x89}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0xa2, offset 0x2d8 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x93, hi: 0x93}, +} + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfkcTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfkcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfkcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfkcTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfkcValues[c0] + } + i := nfkcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfkcTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfkcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfkcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfkcTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfkcValues[c0] + } + i := nfkcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// nfkcTrie. Total size: 19260 bytes (18.81 KiB). Checksum: 1a0bbc4c8c24da49. +type nfkcTrie struct{} + +func newNfkcTrie(i int) *nfkcTrie { + return &nfkcTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *nfkcTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 95: + return uint16(nfkcValues[n<<6+uint32(b)]) + default: + n -= 95 + return uint16(nfkcSparse.lookup(n, b)) + } +} + +// nfkcValues: 97 blocks, 6208 entries, 12416 bytes +// The third block is the zero block. +var nfkcValues = [6208]uint16{ + // Block 0x0, offset 0x0 + 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, + // Block 0x1, offset 0x40 + 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, + 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, + 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, + 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, + 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, + 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, + 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, + 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, + 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, + 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x30b0, 0xc1: 0x30b5, 0xc2: 0x47c9, 0xc3: 0x30ba, 0xc4: 0x47d8, 0xc5: 0x47dd, + 0xc6: 0xa000, 0xc7: 0x47e7, 0xc8: 0x3123, 0xc9: 0x3128, 0xca: 0x47ec, 0xcb: 0x313c, + 0xcc: 0x31af, 0xcd: 0x31b4, 0xce: 0x31b9, 0xcf: 0x4800, 0xd1: 0x3245, + 0xd2: 0x3268, 0xd3: 0x326d, 0xd4: 0x480a, 0xd5: 0x480f, 0xd6: 0x481e, + 0xd8: 0xa000, 0xd9: 0x32f4, 0xda: 0x32f9, 0xdb: 0x32fe, 0xdc: 0x4850, 0xdd: 0x3376, + 0xe0: 0x33bc, 0xe1: 0x33c1, 0xe2: 0x485a, 0xe3: 0x33c6, + 0xe4: 0x4869, 0xe5: 0x486e, 0xe6: 0xa000, 0xe7: 0x4878, 0xe8: 0x342f, 0xe9: 0x3434, + 0xea: 0x487d, 0xeb: 0x3448, 0xec: 0x34c0, 0xed: 0x34c5, 0xee: 0x34ca, 0xef: 0x4891, + 0xf1: 0x3556, 0xf2: 0x3579, 0xf3: 0x357e, 0xf4: 0x489b, 0xf5: 0x48a0, + 0xf6: 0x48af, 0xf8: 0xa000, 0xf9: 0x360a, 0xfa: 0x360f, 0xfb: 0x3614, + 0xfc: 0x48e1, 0xfd: 0x3691, 0xff: 0x36aa, + // Block 0x4, offset 0x100 + 0x100: 0x30bf, 0x101: 0x33cb, 0x102: 0x47ce, 0x103: 0x485f, 0x104: 0x30dd, 0x105: 0x33e9, + 0x106: 0x30f1, 0x107: 0x33fd, 0x108: 0x30f6, 0x109: 0x3402, 0x10a: 0x30fb, 0x10b: 0x3407, + 0x10c: 0x3100, 0x10d: 0x340c, 0x10e: 0x310a, 0x10f: 0x3416, + 0x112: 0x47f1, 0x113: 0x4882, 0x114: 0x3132, 0x115: 0x343e, 0x116: 0x3137, 0x117: 0x3443, + 0x118: 0x3155, 0x119: 0x3461, 0x11a: 0x3146, 0x11b: 0x3452, 0x11c: 0x316e, 0x11d: 0x347a, + 0x11e: 0x3178, 0x11f: 0x3484, 0x120: 0x317d, 0x121: 0x3489, 0x122: 0x3187, 0x123: 0x3493, + 0x124: 0x318c, 0x125: 0x3498, 0x128: 0x31be, 0x129: 0x34cf, + 0x12a: 0x31c3, 0x12b: 0x34d4, 0x12c: 0x31c8, 0x12d: 0x34d9, 0x12e: 0x31eb, 0x12f: 0x34f7, + 0x130: 0x31cd, 0x132: 0x1a8a, 0x133: 0x1b17, 0x134: 0x31f5, 0x135: 0x3501, + 0x136: 0x3209, 0x137: 0x351a, 0x139: 0x3213, 0x13a: 0x3524, 0x13b: 0x321d, + 0x13c: 0x352e, 0x13d: 0x3218, 0x13e: 0x3529, 0x13f: 0x1cdc, + // Block 0x5, offset 0x140 + 0x140: 0x1d64, 0x143: 0x3240, 0x144: 0x3551, 0x145: 0x3259, + 0x146: 0x356a, 0x147: 0x324f, 0x148: 0x3560, 0x149: 0x1d8c, + 0x14c: 0x4814, 0x14d: 0x48a5, 0x14e: 0x3272, 0x14f: 0x3583, 0x150: 0x327c, 0x151: 0x358d, + 0x154: 0x329a, 0x155: 0x35ab, 0x156: 0x32b3, 0x157: 0x35c4, + 0x158: 0x32a4, 0x159: 0x35b5, 0x15a: 0x4837, 0x15b: 0x48c8, 0x15c: 0x32bd, 0x15d: 0x35ce, + 0x15e: 0x32cc, 0x15f: 0x35dd, 0x160: 0x483c, 0x161: 0x48cd, 0x162: 0x32e5, 0x163: 0x35fb, + 0x164: 0x32d6, 0x165: 0x35ec, 0x168: 0x4846, 0x169: 0x48d7, + 0x16a: 0x484b, 0x16b: 0x48dc, 0x16c: 0x3303, 0x16d: 0x3619, 0x16e: 0x330d, 0x16f: 0x3623, + 0x170: 0x3312, 0x171: 0x3628, 0x172: 0x3330, 0x173: 0x3646, 0x174: 0x3353, 0x175: 0x3669, + 0x176: 0x337b, 0x177: 0x3696, 0x178: 0x338f, 0x179: 0x339e, 0x17a: 0x36be, 0x17b: 0x33a8, + 0x17c: 0x36c8, 0x17d: 0x33ad, 0x17e: 0x36cd, 0x17f: 0x00a7, + // Block 0x6, offset 0x180 + 0x184: 0x2f2f, 0x185: 0x2f35, + 0x186: 0x2f3b, 0x187: 0x1a9f, 0x188: 0x1aa2, 0x189: 0x1b38, 0x18a: 0x1ab7, 0x18b: 0x1aba, + 0x18c: 0x1b6e, 0x18d: 0x30c9, 0x18e: 0x33d5, 0x18f: 0x31d7, 0x190: 0x34e3, 0x191: 0x3281, + 0x192: 0x3592, 0x193: 0x3317, 0x194: 0x362d, 0x195: 0x3b10, 0x196: 0x3c9f, 0x197: 0x3b09, + 0x198: 0x3c98, 0x199: 0x3b17, 0x19a: 0x3ca6, 0x19b: 0x3b02, 0x19c: 0x3c91, + 0x19e: 0x39f1, 0x19f: 0x3b80, 0x1a0: 0x39ea, 0x1a1: 0x3b79, 0x1a2: 0x36f4, 0x1a3: 0x3706, + 0x1a6: 0x3182, 0x1a7: 0x348e, 0x1a8: 0x31ff, 0x1a9: 0x3510, + 0x1aa: 0x482d, 0x1ab: 0x48be, 0x1ac: 0x3ad1, 0x1ad: 0x3c60, 0x1ae: 0x3718, 0x1af: 0x371e, + 0x1b0: 0x3506, 0x1b1: 0x1a6f, 0x1b2: 0x1a72, 0x1b3: 0x1aff, 0x1b4: 0x3169, 0x1b5: 0x3475, + 0x1b8: 0x323b, 0x1b9: 0x354c, 0x1ba: 0x39f8, 0x1bb: 0x3b87, + 0x1bc: 0x36ee, 0x1bd: 0x3700, 0x1be: 0x36fa, 0x1bf: 0x370c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x30ce, 0x1c1: 0x33da, 0x1c2: 0x30d3, 0x1c3: 0x33df, 0x1c4: 0x314b, 0x1c5: 0x3457, + 0x1c6: 0x3150, 0x1c7: 0x345c, 0x1c8: 0x31dc, 0x1c9: 0x34e8, 0x1ca: 0x31e1, 0x1cb: 0x34ed, + 0x1cc: 0x3286, 0x1cd: 0x3597, 0x1ce: 0x328b, 0x1cf: 0x359c, 0x1d0: 0x32a9, 0x1d1: 0x35ba, + 0x1d2: 0x32ae, 0x1d3: 0x35bf, 0x1d4: 0x331c, 0x1d5: 0x3632, 0x1d6: 0x3321, 0x1d7: 0x3637, + 0x1d8: 0x32c7, 0x1d9: 0x35d8, 0x1da: 0x32e0, 0x1db: 0x35f6, + 0x1de: 0x319b, 0x1df: 0x34a7, + 0x1e6: 0x47d3, 0x1e7: 0x4864, 0x1e8: 0x47fb, 0x1e9: 0x488c, + 0x1ea: 0x3aa0, 0x1eb: 0x3c2f, 0x1ec: 0x3a7d, 0x1ed: 0x3c0c, 0x1ee: 0x4819, 0x1ef: 0x48aa, + 0x1f0: 0x3a99, 0x1f1: 0x3c28, 0x1f2: 0x3385, 0x1f3: 0x36a0, + // Block 0x8, offset 0x200 + 0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133, + 0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933, + 0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933, + 0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e, + 0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e, + 0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e, + 0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e, + 0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e, + 0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101, + 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e, + 0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133, + // Block 0x9, offset 0x240 + 0x240: 0x4aef, 0x241: 0x4af4, 0x242: 0x9933, 0x243: 0x4af9, 0x244: 0x4bb2, 0x245: 0x9937, + 0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133, + 0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133, + 0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133, + 0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136, + 0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133, + 0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133, + 0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133, + 0x274: 0x01ee, + 0x27a: 0x43e6, + 0x27e: 0x0037, + // Block 0xa, offset 0x280 + 0x284: 0x439b, 0x285: 0x45bc, + 0x286: 0x372a, 0x287: 0x00ce, 0x288: 0x3748, 0x289: 0x3754, 0x28a: 0x3766, + 0x28c: 0x3784, 0x28e: 0x3796, 0x28f: 0x37b4, 0x290: 0x3f49, 0x291: 0xa000, + 0x295: 0xa000, 0x297: 0xa000, + 0x299: 0xa000, + 0x29f: 0xa000, 0x2a1: 0xa000, + 0x2a5: 0xa000, 0x2a9: 0xa000, + 0x2aa: 0x3778, 0x2ab: 0x37a8, 0x2ac: 0x493f, 0x2ad: 0x37d8, 0x2ae: 0x4969, 0x2af: 0x37ea, + 0x2b0: 0x3fb1, 0x2b1: 0xa000, 0x2b5: 0xa000, + 0x2b7: 0xa000, 0x2b9: 0xa000, + 0x2bf: 0xa000, + // Block 0xb, offset 0x2c0 + 0x2c1: 0xa000, 0x2c5: 0xa000, + 0x2c9: 0xa000, 0x2ca: 0x4981, 0x2cb: 0x499f, + 0x2cc: 0x3808, 0x2cd: 0x3820, 0x2ce: 0x49b7, 0x2d0: 0x0242, 0x2d1: 0x0254, + 0x2d2: 0x0230, 0x2d3: 0x444d, 0x2d4: 0x4453, 0x2d5: 0x027e, 0x2d6: 0x026c, + 0x2f0: 0x025a, 0x2f1: 0x026f, 0x2f2: 0x0272, 0x2f4: 0x020c, 0x2f5: 0x024b, + 0x2f9: 0x022a, + // Block 0xc, offset 0x300 + 0x300: 0x3862, 0x301: 0x386e, 0x303: 0x385c, + 0x306: 0xa000, 0x307: 0x384a, + 0x30c: 0x389e, 0x30d: 0x3886, 0x30e: 0x38b0, 0x310: 0xa000, + 0x313: 0xa000, 0x315: 0xa000, 0x316: 0xa000, 0x317: 0xa000, + 0x318: 0xa000, 0x319: 0x3892, 0x31a: 0xa000, + 0x31e: 0xa000, 0x323: 0xa000, + 0x327: 0xa000, + 0x32b: 0xa000, 0x32d: 0xa000, + 0x330: 0xa000, 0x333: 0xa000, 0x335: 0xa000, + 0x336: 0xa000, 0x337: 0xa000, 0x338: 0xa000, 0x339: 0x3916, 0x33a: 0xa000, + 0x33e: 0xa000, + // Block 0xd, offset 0x340 + 0x341: 0x3874, 0x342: 0x38f8, + 0x350: 0x3850, 0x351: 0x38d4, + 0x352: 0x3856, 0x353: 0x38da, 0x356: 0x3868, 0x357: 0x38ec, + 0x358: 0xa000, 0x359: 0xa000, 0x35a: 0x396a, 0x35b: 0x3970, 0x35c: 0x387a, 0x35d: 0x38fe, + 0x35e: 0x3880, 0x35f: 0x3904, 0x362: 0x388c, 0x363: 0x3910, + 0x364: 0x3898, 0x365: 0x391c, 0x366: 0x38a4, 0x367: 0x3928, 0x368: 0xa000, 0x369: 0xa000, + 0x36a: 0x3976, 0x36b: 0x397c, 0x36c: 0x38ce, 0x36d: 0x3952, 0x36e: 0x38aa, 0x36f: 0x392e, + 0x370: 0x38b6, 0x371: 0x393a, 0x372: 0x38bc, 0x373: 0x3940, 0x374: 0x38c2, 0x375: 0x3946, + 0x378: 0x38c8, 0x379: 0x394c, + // Block 0xe, offset 0x380 + 0x387: 0x1e91, + 0x391: 0x812e, + 0x392: 0x8133, 0x393: 0x8133, 0x394: 0x8133, 0x395: 0x8133, 0x396: 0x812e, 0x397: 0x8133, + 0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x812f, 0x39b: 0x812e, 0x39c: 0x8133, 0x39d: 0x8133, + 0x39e: 0x8133, 0x39f: 0x8133, 0x3a0: 0x8133, 0x3a1: 0x8133, 0x3a2: 0x812e, 0x3a3: 0x812e, + 0x3a4: 0x812e, 0x3a5: 0x812e, 0x3a6: 0x812e, 0x3a7: 0x812e, 0x3a8: 0x8133, 0x3a9: 0x8133, + 0x3aa: 0x812e, 0x3ab: 0x8133, 0x3ac: 0x8133, 0x3ad: 0x812f, 0x3ae: 0x8132, 0x3af: 0x8133, + 0x3b0: 0x8106, 0x3b1: 0x8107, 0x3b2: 0x8108, 0x3b3: 0x8109, 0x3b4: 0x810a, 0x3b5: 0x810b, + 0x3b6: 0x810c, 0x3b7: 0x810d, 0x3b8: 0x810e, 0x3b9: 0x810f, 0x3ba: 0x810f, 0x3bb: 0x8110, + 0x3bc: 0x8111, 0x3bd: 0x8112, 0x3bf: 0x8113, + // Block 0xf, offset 0x3c0 + 0x3c8: 0xa000, 0x3ca: 0xa000, 0x3cb: 0x8117, + 0x3cc: 0x8118, 0x3cd: 0x8119, 0x3ce: 0x811a, 0x3cf: 0x811b, 0x3d0: 0x811c, 0x3d1: 0x811d, + 0x3d2: 0x811e, 0x3d3: 0x9933, 0x3d4: 0x9933, 0x3d5: 0x992e, 0x3d6: 0x812e, 0x3d7: 0x8133, + 0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x812e, 0x3dd: 0x8133, + 0x3de: 0x8133, 0x3df: 0x812e, + 0x3f0: 0x811f, 0x3f5: 0x1eb4, + 0x3f6: 0x2143, 0x3f7: 0x217f, 0x3f8: 0x217a, + // Block 0x10, offset 0x400 + 0x40a: 0x8133, 0x40b: 0x8133, + 0x40c: 0x8133, 0x40d: 0x8133, 0x40e: 0x8133, 0x40f: 0x812e, 0x410: 0x812e, 0x411: 0x812e, + 0x412: 0x812e, 0x413: 0x812e, 0x414: 0x8133, 0x415: 0x8133, 0x416: 0x8133, 0x417: 0x8133, + 0x418: 0x8133, 0x419: 0x8133, 0x41a: 0x8133, 0x41b: 0x8133, 0x41c: 0x8133, 0x41d: 0x8133, + 0x41e: 0x8133, 0x41f: 0x8133, 0x420: 0x8133, 0x421: 0x8133, 0x423: 0x812e, + 0x424: 0x8133, 0x425: 0x8133, 0x426: 0x812e, 0x427: 0x8133, 0x428: 0x8133, 0x429: 0x812e, + 0x42a: 0x8133, 0x42b: 0x8133, 0x42c: 0x8133, 0x42d: 0x812e, 0x42e: 0x812e, 0x42f: 0x812e, + 0x430: 0x8117, 0x431: 0x8118, 0x432: 0x8119, 0x433: 0x8133, 0x434: 0x8133, 0x435: 0x8133, + 0x436: 0x812e, 0x437: 0x8133, 0x438: 0x8133, 0x439: 0x812e, 0x43a: 0x812e, 0x43b: 0x8133, + 0x43c: 0x8133, 0x43d: 0x8133, 0x43e: 0x8133, 0x43f: 0x8133, + // Block 0x11, offset 0x440 + 0x445: 0xa000, + 0x446: 0x2e5d, 0x447: 0xa000, 0x448: 0x2e65, 0x449: 0xa000, 0x44a: 0x2e6d, 0x44b: 0xa000, + 0x44c: 0x2e75, 0x44d: 0xa000, 0x44e: 0x2e7d, 0x451: 0xa000, + 0x452: 0x2e85, + 0x474: 0x8103, 0x475: 0x9900, + 0x47a: 0xa000, 0x47b: 0x2e8d, + 0x47c: 0xa000, 0x47d: 0x2e95, 0x47e: 0xa000, 0x47f: 0xa000, + // Block 0x12, offset 0x480 + 0x480: 0x0069, 0x481: 0x006b, 0x482: 0x006f, 0x483: 0x0083, 0x484: 0x0104, 0x485: 0x0107, + 0x486: 0x0506, 0x487: 0x0085, 0x488: 0x0089, 0x489: 0x008b, 0x48a: 0x011f, 0x48b: 0x0122, + 0x48c: 0x0125, 0x48d: 0x008f, 0x48f: 0x0097, 0x490: 0x009b, 0x491: 0x00e6, + 0x492: 0x009f, 0x493: 0x0110, 0x494: 0x050a, 0x495: 0x050e, 0x496: 0x00a1, 0x497: 0x00a9, + 0x498: 0x00ab, 0x499: 0x0516, 0x49a: 0x015b, 0x49b: 0x00ad, 0x49c: 0x051a, 0x49d: 0x0242, + 0x49e: 0x0245, 0x49f: 0x0248, 0x4a0: 0x027e, 0x4a1: 0x0281, 0x4a2: 0x0093, 0x4a3: 0x00a5, + 0x4a4: 0x00ab, 0x4a5: 0x00ad, 0x4a6: 0x0242, 0x4a7: 0x0245, 0x4a8: 0x026f, 0x4a9: 0x027e, + 0x4aa: 0x0281, + 0x4b8: 0x02b4, + // Block 0x13, offset 0x4c0 + 0x4db: 0x010a, 0x4dc: 0x0087, 0x4dd: 0x0113, + 0x4de: 0x00d7, 0x4df: 0x0125, 0x4e0: 0x008d, 0x4e1: 0x012b, 0x4e2: 0x0131, 0x4e3: 0x013d, + 0x4e4: 0x0146, 0x4e5: 0x0149, 0x4e6: 0x014c, 0x4e7: 0x051e, 0x4e8: 0x01c7, 0x4e9: 0x0155, + 0x4ea: 0x0522, 0x4eb: 0x01ca, 0x4ec: 0x0161, 0x4ed: 0x015e, 0x4ee: 0x0164, 0x4ef: 0x0167, + 0x4f0: 0x016a, 0x4f1: 0x016d, 0x4f2: 0x0176, 0x4f3: 0x018e, 0x4f4: 0x0191, 0x4f5: 0x00f2, + 0x4f6: 0x019a, 0x4f7: 0x019d, 0x4f8: 0x0512, 0x4f9: 0x01a0, 0x4fa: 0x01a3, 0x4fb: 0x00b5, + 0x4fc: 0x01af, 0x4fd: 0x01b2, 0x4fe: 0x01b5, 0x4ff: 0x0254, + // Block 0x14, offset 0x500 + 0x500: 0x8133, 0x501: 0x8133, 0x502: 0x812e, 0x503: 0x8133, 0x504: 0x8133, 0x505: 0x8133, + 0x506: 0x8133, 0x507: 0x8133, 0x508: 0x8133, 0x509: 0x8133, 0x50a: 0x812e, 0x50b: 0x8133, + 0x50c: 0x8133, 0x50d: 0x8136, 0x50e: 0x812b, 0x50f: 0x812e, 0x510: 0x812a, 0x511: 0x8133, + 0x512: 0x8133, 0x513: 0x8133, 0x514: 0x8133, 0x515: 0x8133, 0x516: 0x8133, 0x517: 0x8133, + 0x518: 0x8133, 0x519: 0x8133, 0x51a: 0x8133, 0x51b: 0x8133, 0x51c: 0x8133, 0x51d: 0x8133, + 0x51e: 0x8133, 0x51f: 0x8133, 0x520: 0x8133, 0x521: 0x8133, 0x522: 0x8133, 0x523: 0x8133, + 0x524: 0x8133, 0x525: 0x8133, 0x526: 0x8133, 0x527: 0x8133, 0x528: 0x8133, 0x529: 0x8133, + 0x52a: 0x8133, 0x52b: 0x8133, 0x52c: 0x8133, 0x52d: 0x8133, 0x52e: 0x8133, 0x52f: 0x8133, + 0x530: 0x8133, 0x531: 0x8133, 0x532: 0x8133, 0x533: 0x8133, 0x534: 0x8133, 0x535: 0x8133, + 0x536: 0x8134, 0x537: 0x8132, 0x538: 0x8132, 0x539: 0x812e, 0x53a: 0x812d, 0x53b: 0x8133, + 0x53c: 0x8135, 0x53d: 0x812e, 0x53e: 0x8133, 0x53f: 0x812e, + // Block 0x15, offset 0x540 + 0x540: 0x30d8, 0x541: 0x33e4, 0x542: 0x30e2, 0x543: 0x33ee, 0x544: 0x30e7, 0x545: 0x33f3, + 0x546: 0x30ec, 0x547: 0x33f8, 0x548: 0x3a0d, 0x549: 0x3b9c, 0x54a: 0x3105, 0x54b: 0x3411, + 0x54c: 0x310f, 0x54d: 0x341b, 0x54e: 0x311e, 0x54f: 0x342a, 0x550: 0x3114, 0x551: 0x3420, + 0x552: 0x3119, 0x553: 0x3425, 0x554: 0x3a30, 0x555: 0x3bbf, 0x556: 0x3a37, 0x557: 0x3bc6, + 0x558: 0x315a, 0x559: 0x3466, 0x55a: 0x315f, 0x55b: 0x346b, 0x55c: 0x3a45, 0x55d: 0x3bd4, + 0x55e: 0x3164, 0x55f: 0x3470, 0x560: 0x3173, 0x561: 0x347f, 0x562: 0x3191, 0x563: 0x349d, + 0x564: 0x31a0, 0x565: 0x34ac, 0x566: 0x3196, 0x567: 0x34a2, 0x568: 0x31a5, 0x569: 0x34b1, + 0x56a: 0x31aa, 0x56b: 0x34b6, 0x56c: 0x31f0, 0x56d: 0x34fc, 0x56e: 0x3a4c, 0x56f: 0x3bdb, + 0x570: 0x31fa, 0x571: 0x350b, 0x572: 0x3204, 0x573: 0x3515, 0x574: 0x320e, 0x575: 0x351f, + 0x576: 0x4805, 0x577: 0x4896, 0x578: 0x3a53, 0x579: 0x3be2, 0x57a: 0x3227, 0x57b: 0x3538, + 0x57c: 0x3222, 0x57d: 0x3533, 0x57e: 0x322c, 0x57f: 0x353d, + // Block 0x16, offset 0x580 + 0x580: 0x3231, 0x581: 0x3542, 0x582: 0x3236, 0x583: 0x3547, 0x584: 0x324a, 0x585: 0x355b, + 0x586: 0x3254, 0x587: 0x3565, 0x588: 0x3263, 0x589: 0x3574, 0x58a: 0x325e, 0x58b: 0x356f, + 0x58c: 0x3a76, 0x58d: 0x3c05, 0x58e: 0x3a84, 0x58f: 0x3c13, 0x590: 0x3a8b, 0x591: 0x3c1a, + 0x592: 0x3a92, 0x593: 0x3c21, 0x594: 0x3290, 0x595: 0x35a1, 0x596: 0x3295, 0x597: 0x35a6, + 0x598: 0x329f, 0x599: 0x35b0, 0x59a: 0x4832, 0x59b: 0x48c3, 0x59c: 0x3ad8, 0x59d: 0x3c67, + 0x59e: 0x32b8, 0x59f: 0x35c9, 0x5a0: 0x32c2, 0x5a1: 0x35d3, 0x5a2: 0x4841, 0x5a3: 0x48d2, + 0x5a4: 0x3adf, 0x5a5: 0x3c6e, 0x5a6: 0x3ae6, 0x5a7: 0x3c75, 0x5a8: 0x3aed, 0x5a9: 0x3c7c, + 0x5aa: 0x32d1, 0x5ab: 0x35e2, 0x5ac: 0x32db, 0x5ad: 0x35f1, 0x5ae: 0x32ef, 0x5af: 0x3605, + 0x5b0: 0x32ea, 0x5b1: 0x3600, 0x5b2: 0x332b, 0x5b3: 0x3641, 0x5b4: 0x333a, 0x5b5: 0x3650, + 0x5b6: 0x3335, 0x5b7: 0x364b, 0x5b8: 0x3af4, 0x5b9: 0x3c83, 0x5ba: 0x3afb, 0x5bb: 0x3c8a, + 0x5bc: 0x333f, 0x5bd: 0x3655, 0x5be: 0x3344, 0x5bf: 0x365a, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x3349, 0x5c1: 0x365f, 0x5c2: 0x334e, 0x5c3: 0x3664, 0x5c4: 0x335d, 0x5c5: 0x3673, + 0x5c6: 0x3358, 0x5c7: 0x366e, 0x5c8: 0x3362, 0x5c9: 0x367d, 0x5ca: 0x3367, 0x5cb: 0x3682, + 0x5cc: 0x336c, 0x5cd: 0x3687, 0x5ce: 0x338a, 0x5cf: 0x36a5, 0x5d0: 0x33a3, 0x5d1: 0x36c3, + 0x5d2: 0x33b2, 0x5d3: 0x36d2, 0x5d4: 0x33b7, 0x5d5: 0x36d7, 0x5d6: 0x34bb, 0x5d7: 0x35e7, + 0x5d8: 0x3678, 0x5d9: 0x36b4, 0x5da: 0x1d10, 0x5db: 0x4418, + 0x5e0: 0x47e2, 0x5e1: 0x4873, 0x5e2: 0x30c4, 0x5e3: 0x33d0, + 0x5e4: 0x39b9, 0x5e5: 0x3b48, 0x5e6: 0x39b2, 0x5e7: 0x3b41, 0x5e8: 0x39c7, 0x5e9: 0x3b56, + 0x5ea: 0x39c0, 0x5eb: 0x3b4f, 0x5ec: 0x39ff, 0x5ed: 0x3b8e, 0x5ee: 0x39d5, 0x5ef: 0x3b64, + 0x5f0: 0x39ce, 0x5f1: 0x3b5d, 0x5f2: 0x39e3, 0x5f3: 0x3b72, 0x5f4: 0x39dc, 0x5f5: 0x3b6b, + 0x5f6: 0x3a06, 0x5f7: 0x3b95, 0x5f8: 0x47f6, 0x5f9: 0x4887, 0x5fa: 0x3141, 0x5fb: 0x344d, + 0x5fc: 0x312d, 0x5fd: 0x3439, 0x5fe: 0x3a1b, 0x5ff: 0x3baa, + // Block 0x18, offset 0x600 + 0x600: 0x3a14, 0x601: 0x3ba3, 0x602: 0x3a29, 0x603: 0x3bb8, 0x604: 0x3a22, 0x605: 0x3bb1, + 0x606: 0x3a3e, 0x607: 0x3bcd, 0x608: 0x31d2, 0x609: 0x34de, 0x60a: 0x31e6, 0x60b: 0x34f2, + 0x60c: 0x4828, 0x60d: 0x48b9, 0x60e: 0x3277, 0x60f: 0x3588, 0x610: 0x3a61, 0x611: 0x3bf0, + 0x612: 0x3a5a, 0x613: 0x3be9, 0x614: 0x3a6f, 0x615: 0x3bfe, 0x616: 0x3a68, 0x617: 0x3bf7, + 0x618: 0x3aca, 0x619: 0x3c59, 0x61a: 0x3aae, 0x61b: 0x3c3d, 0x61c: 0x3aa7, 0x61d: 0x3c36, + 0x61e: 0x3abc, 0x61f: 0x3c4b, 0x620: 0x3ab5, 0x621: 0x3c44, 0x622: 0x3ac3, 0x623: 0x3c52, + 0x624: 0x3326, 0x625: 0x363c, 0x626: 0x3308, 0x627: 0x361e, 0x628: 0x3b25, 0x629: 0x3cb4, + 0x62a: 0x3b1e, 0x62b: 0x3cad, 0x62c: 0x3b33, 0x62d: 0x3cc2, 0x62e: 0x3b2c, 0x62f: 0x3cbb, + 0x630: 0x3b3a, 0x631: 0x3cc9, 0x632: 0x3371, 0x633: 0x368c, 0x634: 0x3399, 0x635: 0x36b9, + 0x636: 0x3394, 0x637: 0x36af, 0x638: 0x3380, 0x639: 0x369b, + // Block 0x19, offset 0x640 + 0x640: 0x4945, 0x641: 0x494b, 0x642: 0x4a5f, 0x643: 0x4a77, 0x644: 0x4a67, 0x645: 0x4a7f, + 0x646: 0x4a6f, 0x647: 0x4a87, 0x648: 0x48eb, 0x649: 0x48f1, 0x64a: 0x49cf, 0x64b: 0x49e7, + 0x64c: 0x49d7, 0x64d: 0x49ef, 0x64e: 0x49df, 0x64f: 0x49f7, 0x650: 0x4957, 0x651: 0x495d, + 0x652: 0x3ef9, 0x653: 0x3f09, 0x654: 0x3f01, 0x655: 0x3f11, + 0x658: 0x48f7, 0x659: 0x48fd, 0x65a: 0x3e29, 0x65b: 0x3e39, 0x65c: 0x3e31, 0x65d: 0x3e41, + 0x660: 0x496f, 0x661: 0x4975, 0x662: 0x4a8f, 0x663: 0x4aa7, + 0x664: 0x4a97, 0x665: 0x4aaf, 0x666: 0x4a9f, 0x667: 0x4ab7, 0x668: 0x4903, 0x669: 0x4909, + 0x66a: 0x49ff, 0x66b: 0x4a17, 0x66c: 0x4a07, 0x66d: 0x4a1f, 0x66e: 0x4a0f, 0x66f: 0x4a27, + 0x670: 0x4987, 0x671: 0x498d, 0x672: 0x3f59, 0x673: 0x3f71, 0x674: 0x3f61, 0x675: 0x3f79, + 0x676: 0x3f69, 0x677: 0x3f81, 0x678: 0x490f, 0x679: 0x4915, 0x67a: 0x3e59, 0x67b: 0x3e71, + 0x67c: 0x3e61, 0x67d: 0x3e79, 0x67e: 0x3e69, 0x67f: 0x3e81, + // Block 0x1a, offset 0x680 + 0x680: 0x4993, 0x681: 0x4999, 0x682: 0x3f89, 0x683: 0x3f99, 0x684: 0x3f91, 0x685: 0x3fa1, + 0x688: 0x491b, 0x689: 0x4921, 0x68a: 0x3e89, 0x68b: 0x3e99, + 0x68c: 0x3e91, 0x68d: 0x3ea1, 0x690: 0x49a5, 0x691: 0x49ab, + 0x692: 0x3fc1, 0x693: 0x3fd9, 0x694: 0x3fc9, 0x695: 0x3fe1, 0x696: 0x3fd1, 0x697: 0x3fe9, + 0x699: 0x4927, 0x69b: 0x3ea9, 0x69d: 0x3eb1, + 0x69f: 0x3eb9, 0x6a0: 0x49bd, 0x6a1: 0x49c3, 0x6a2: 0x4abf, 0x6a3: 0x4ad7, + 0x6a4: 0x4ac7, 0x6a5: 0x4adf, 0x6a6: 0x4acf, 0x6a7: 0x4ae7, 0x6a8: 0x492d, 0x6a9: 0x4933, + 0x6aa: 0x4a2f, 0x6ab: 0x4a47, 0x6ac: 0x4a37, 0x6ad: 0x4a4f, 0x6ae: 0x4a3f, 0x6af: 0x4a57, + 0x6b0: 0x4939, 0x6b1: 0x445f, 0x6b2: 0x37d2, 0x6b3: 0x4465, 0x6b4: 0x4963, 0x6b5: 0x446b, + 0x6b6: 0x37e4, 0x6b7: 0x4471, 0x6b8: 0x3802, 0x6b9: 0x4477, 0x6ba: 0x381a, 0x6bb: 0x447d, + 0x6bc: 0x49b1, 0x6bd: 0x4483, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x3ee1, 0x6c1: 0x3ee9, 0x6c2: 0x42c5, 0x6c3: 0x42e3, 0x6c4: 0x42cf, 0x6c5: 0x42ed, + 0x6c6: 0x42d9, 0x6c7: 0x42f7, 0x6c8: 0x3e19, 0x6c9: 0x3e21, 0x6ca: 0x4211, 0x6cb: 0x422f, + 0x6cc: 0x421b, 0x6cd: 0x4239, 0x6ce: 0x4225, 0x6cf: 0x4243, 0x6d0: 0x3f29, 0x6d1: 0x3f31, + 0x6d2: 0x4301, 0x6d3: 0x431f, 0x6d4: 0x430b, 0x6d5: 0x4329, 0x6d6: 0x4315, 0x6d7: 0x4333, + 0x6d8: 0x3e49, 0x6d9: 0x3e51, 0x6da: 0x424d, 0x6db: 0x426b, 0x6dc: 0x4257, 0x6dd: 0x4275, + 0x6de: 0x4261, 0x6df: 0x427f, 0x6e0: 0x4001, 0x6e1: 0x4009, 0x6e2: 0x433d, 0x6e3: 0x435b, + 0x6e4: 0x4347, 0x6e5: 0x4365, 0x6e6: 0x4351, 0x6e7: 0x436f, 0x6e8: 0x3ec1, 0x6e9: 0x3ec9, + 0x6ea: 0x4289, 0x6eb: 0x42a7, 0x6ec: 0x4293, 0x6ed: 0x42b1, 0x6ee: 0x429d, 0x6ef: 0x42bb, + 0x6f0: 0x37c6, 0x6f1: 0x37c0, 0x6f2: 0x3ed1, 0x6f3: 0x37cc, 0x6f4: 0x3ed9, + 0x6f6: 0x4951, 0x6f7: 0x3ef1, 0x6f8: 0x3736, 0x6f9: 0x3730, 0x6fa: 0x3724, 0x6fb: 0x442f, + 0x6fc: 0x373c, 0x6fd: 0x43c8, 0x6fe: 0x0257, 0x6ff: 0x43c8, + // Block 0x1c, offset 0x700 + 0x700: 0x43e1, 0x701: 0x45c3, 0x702: 0x3f19, 0x703: 0x37de, 0x704: 0x3f21, + 0x706: 0x497b, 0x707: 0x3f39, 0x708: 0x3742, 0x709: 0x4435, 0x70a: 0x374e, 0x70b: 0x443b, + 0x70c: 0x375a, 0x70d: 0x45ca, 0x70e: 0x45d1, 0x70f: 0x45d8, 0x710: 0x37f6, 0x711: 0x37f0, + 0x712: 0x3f41, 0x713: 0x4625, 0x716: 0x37fc, 0x717: 0x3f51, + 0x718: 0x3772, 0x719: 0x376c, 0x71a: 0x3760, 0x71b: 0x4441, 0x71d: 0x45df, + 0x71e: 0x45e6, 0x71f: 0x45ed, 0x720: 0x382c, 0x721: 0x3826, 0x722: 0x3fa9, 0x723: 0x462d, + 0x724: 0x380e, 0x725: 0x3814, 0x726: 0x3832, 0x727: 0x3fb9, 0x728: 0x37a2, 0x729: 0x379c, + 0x72a: 0x3790, 0x72b: 0x444d, 0x72c: 0x378a, 0x72d: 0x45b5, 0x72e: 0x45bc, 0x72f: 0x0081, + 0x732: 0x3ff1, 0x733: 0x3838, 0x734: 0x3ff9, + 0x736: 0x49c9, 0x737: 0x4011, 0x738: 0x377e, 0x739: 0x4447, 0x73a: 0x37ae, 0x73b: 0x4459, + 0x73c: 0x37ba, 0x73d: 0x439b, 0x73e: 0x43cd, + // Block 0x1d, offset 0x740 + 0x740: 0x1d08, 0x741: 0x1d0c, 0x742: 0x0047, 0x743: 0x1d84, 0x745: 0x1d18, + 0x746: 0x1d1c, 0x747: 0x00ef, 0x749: 0x1d88, 0x74a: 0x008f, 0x74b: 0x0051, + 0x74c: 0x0051, 0x74d: 0x0051, 0x74e: 0x0091, 0x74f: 0x00e0, 0x750: 0x0053, 0x751: 0x0053, + 0x752: 0x0059, 0x753: 0x0099, 0x755: 0x005d, 0x756: 0x1abd, + 0x759: 0x0061, 0x75a: 0x0063, 0x75b: 0x0065, 0x75c: 0x0065, 0x75d: 0x0065, + 0x760: 0x1acf, 0x761: 0x1cf8, 0x762: 0x1ad8, + 0x764: 0x0075, 0x766: 0x023c, 0x768: 0x0075, + 0x76a: 0x0057, 0x76b: 0x4413, 0x76c: 0x0045, 0x76d: 0x0047, 0x76f: 0x008b, + 0x770: 0x004b, 0x771: 0x004d, 0x773: 0x005b, 0x774: 0x009f, 0x775: 0x0308, + 0x776: 0x030b, 0x777: 0x030e, 0x778: 0x0311, 0x779: 0x0093, 0x77b: 0x1cc8, + 0x77c: 0x026c, 0x77d: 0x0245, 0x77e: 0x01fd, 0x77f: 0x0224, + // Block 0x1e, offset 0x780 + 0x780: 0x055a, 0x785: 0x0049, + 0x786: 0x0089, 0x787: 0x008b, 0x788: 0x0093, 0x789: 0x0095, + 0x790: 0x235e, 0x791: 0x236a, + 0x792: 0x241e, 0x793: 0x2346, 0x794: 0x23ca, 0x795: 0x2352, 0x796: 0x23d0, 0x797: 0x23e8, + 0x798: 0x23f4, 0x799: 0x2358, 0x79a: 0x23fa, 0x79b: 0x2364, 0x79c: 0x23ee, 0x79d: 0x2400, + 0x79e: 0x2406, 0x79f: 0x1dec, 0x7a0: 0x0053, 0x7a1: 0x1a87, 0x7a2: 0x1cd4, 0x7a3: 0x1a90, + 0x7a4: 0x006d, 0x7a5: 0x1adb, 0x7a6: 0x1d00, 0x7a7: 0x1e78, 0x7a8: 0x1a93, 0x7a9: 0x0071, + 0x7aa: 0x1ae7, 0x7ab: 0x1d04, 0x7ac: 0x0059, 0x7ad: 0x0047, 0x7ae: 0x0049, 0x7af: 0x005b, + 0x7b0: 0x0093, 0x7b1: 0x1b14, 0x7b2: 0x1d48, 0x7b3: 0x1b1d, 0x7b4: 0x00ad, 0x7b5: 0x1b92, + 0x7b6: 0x1d7c, 0x7b7: 0x1e8c, 0x7b8: 0x1b20, 0x7b9: 0x00b1, 0x7ba: 0x1b95, 0x7bb: 0x1d80, + 0x7bc: 0x0099, 0x7bd: 0x0087, 0x7be: 0x0089, 0x7bf: 0x009b, + // Block 0x1f, offset 0x7c0 + 0x7c1: 0x3d47, 0x7c3: 0xa000, 0x7c4: 0x3d4e, 0x7c5: 0xa000, + 0x7c7: 0x3d55, 0x7c8: 0xa000, 0x7c9: 0x3d5c, + 0x7cd: 0xa000, + 0x7e0: 0x30a6, 0x7e1: 0xa000, 0x7e2: 0x3d6a, + 0x7e4: 0xa000, 0x7e5: 0xa000, + 0x7ed: 0x3d63, 0x7ee: 0x30a1, 0x7ef: 0x30ab, + 0x7f0: 0x3d71, 0x7f1: 0x3d78, 0x7f2: 0xa000, 0x7f3: 0xa000, 0x7f4: 0x3d7f, 0x7f5: 0x3d86, + 0x7f6: 0xa000, 0x7f7: 0xa000, 0x7f8: 0x3d8d, 0x7f9: 0x3d94, 0x7fa: 0xa000, 0x7fb: 0xa000, + 0x7fc: 0xa000, 0x7fd: 0xa000, + // Block 0x20, offset 0x800 + 0x800: 0x3d9b, 0x801: 0x3da2, 0x802: 0xa000, 0x803: 0xa000, 0x804: 0x3db7, 0x805: 0x3dbe, + 0x806: 0xa000, 0x807: 0xa000, 0x808: 0x3dc5, 0x809: 0x3dcc, + 0x811: 0xa000, + 0x812: 0xa000, + 0x822: 0xa000, + 0x828: 0xa000, 0x829: 0xa000, + 0x82b: 0xa000, 0x82c: 0x3de1, 0x82d: 0x3de8, 0x82e: 0x3def, 0x82f: 0x3df6, + 0x832: 0xa000, 0x833: 0xa000, 0x834: 0xa000, 0x835: 0xa000, + // Block 0x21, offset 0x840 + 0x860: 0x0023, 0x861: 0x0025, 0x862: 0x0027, 0x863: 0x0029, + 0x864: 0x002b, 0x865: 0x002d, 0x866: 0x002f, 0x867: 0x0031, 0x868: 0x0033, 0x869: 0x19af, + 0x86a: 0x19b2, 0x86b: 0x19b5, 0x86c: 0x19b8, 0x86d: 0x19bb, 0x86e: 0x19be, 0x86f: 0x19c1, + 0x870: 0x19c4, 0x871: 0x19c7, 0x872: 0x19ca, 0x873: 0x19d3, 0x874: 0x1b98, 0x875: 0x1b9c, + 0x876: 0x1ba0, 0x877: 0x1ba4, 0x878: 0x1ba8, 0x879: 0x1bac, 0x87a: 0x1bb0, 0x87b: 0x1bb4, + 0x87c: 0x1bb8, 0x87d: 0x1db0, 0x87e: 0x1db5, 0x87f: 0x1dba, + // Block 0x22, offset 0x880 + 0x880: 0x1dbf, 0x881: 0x1dc4, 0x882: 0x1dc9, 0x883: 0x1dce, 0x884: 0x1dd3, 0x885: 0x1dd8, + 0x886: 0x1ddd, 0x887: 0x1de2, 0x888: 0x19ac, 0x889: 0x19d0, 0x88a: 0x19f4, 0x88b: 0x1a18, + 0x88c: 0x1a3c, 0x88d: 0x1a45, 0x88e: 0x1a4b, 0x88f: 0x1a51, 0x890: 0x1a57, 0x891: 0x1c90, + 0x892: 0x1c94, 0x893: 0x1c98, 0x894: 0x1c9c, 0x895: 0x1ca0, 0x896: 0x1ca4, 0x897: 0x1ca8, + 0x898: 0x1cac, 0x899: 0x1cb0, 0x89a: 0x1cb4, 0x89b: 0x1cb8, 0x89c: 0x1c24, 0x89d: 0x1c28, + 0x89e: 0x1c2c, 0x89f: 0x1c30, 0x8a0: 0x1c34, 0x8a1: 0x1c38, 0x8a2: 0x1c3c, 0x8a3: 0x1c40, + 0x8a4: 0x1c44, 0x8a5: 0x1c48, 0x8a6: 0x1c4c, 0x8a7: 0x1c50, 0x8a8: 0x1c54, 0x8a9: 0x1c58, + 0x8aa: 0x1c5c, 0x8ab: 0x1c60, 0x8ac: 0x1c64, 0x8ad: 0x1c68, 0x8ae: 0x1c6c, 0x8af: 0x1c70, + 0x8b0: 0x1c74, 0x8b1: 0x1c78, 0x8b2: 0x1c7c, 0x8b3: 0x1c80, 0x8b4: 0x1c84, 0x8b5: 0x1c88, + 0x8b6: 0x0043, 0x8b7: 0x0045, 0x8b8: 0x0047, 0x8b9: 0x0049, 0x8ba: 0x004b, 0x8bb: 0x004d, + 0x8bc: 0x004f, 0x8bd: 0x0051, 0x8be: 0x0053, 0x8bf: 0x0055, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x07ba, 0x8c1: 0x07de, 0x8c2: 0x07ea, 0x8c3: 0x07fa, 0x8c4: 0x0802, 0x8c5: 0x080e, + 0x8c6: 0x0816, 0x8c7: 0x081e, 0x8c8: 0x082a, 0x8c9: 0x087e, 0x8ca: 0x0896, 0x8cb: 0x08a6, + 0x8cc: 0x08b6, 0x8cd: 0x08c6, 0x8ce: 0x08d6, 0x8cf: 0x08f6, 0x8d0: 0x08fa, 0x8d1: 0x08fe, + 0x8d2: 0x0932, 0x8d3: 0x095a, 0x8d4: 0x096a, 0x8d5: 0x0972, 0x8d6: 0x0976, 0x8d7: 0x0982, + 0x8d8: 0x099e, 0x8d9: 0x09a2, 0x8da: 0x09ba, 0x8db: 0x09be, 0x8dc: 0x09c6, 0x8dd: 0x09d6, + 0x8de: 0x0a72, 0x8df: 0x0a86, 0x8e0: 0x0ac6, 0x8e1: 0x0ada, 0x8e2: 0x0ae2, 0x8e3: 0x0ae6, + 0x8e4: 0x0af6, 0x8e5: 0x0b12, 0x8e6: 0x0b3e, 0x8e7: 0x0b4a, 0x8e8: 0x0b6a, 0x8e9: 0x0b76, + 0x8ea: 0x0b7a, 0x8eb: 0x0b7e, 0x8ec: 0x0b96, 0x8ed: 0x0b9a, 0x8ee: 0x0bc6, 0x8ef: 0x0bd2, + 0x8f0: 0x0bda, 0x8f1: 0x0be2, 0x8f2: 0x0bf2, 0x8f3: 0x0bfa, 0x8f4: 0x0c02, 0x8f5: 0x0c2e, + 0x8f6: 0x0c32, 0x8f7: 0x0c3a, 0x8f8: 0x0c3e, 0x8f9: 0x0c46, 0x8fa: 0x0c4e, 0x8fb: 0x0c5e, + 0x8fc: 0x0c7a, 0x8fd: 0x0cf2, 0x8fe: 0x0d06, 0x8ff: 0x0d0a, + // Block 0x24, offset 0x900 + 0x900: 0x0d8a, 0x901: 0x0d8e, 0x902: 0x0da2, 0x903: 0x0da6, 0x904: 0x0dae, 0x905: 0x0db6, + 0x906: 0x0dbe, 0x907: 0x0dca, 0x908: 0x0df2, 0x909: 0x0e02, 0x90a: 0x0e16, 0x90b: 0x0e86, + 0x90c: 0x0e92, 0x90d: 0x0ea2, 0x90e: 0x0eae, 0x90f: 0x0eba, 0x910: 0x0ec2, 0x911: 0x0ec6, + 0x912: 0x0eca, 0x913: 0x0ece, 0x914: 0x0ed2, 0x915: 0x0f8a, 0x916: 0x0fd2, 0x917: 0x0fde, + 0x918: 0x0fe2, 0x919: 0x0fe6, 0x91a: 0x0fea, 0x91b: 0x0ff2, 0x91c: 0x0ff6, 0x91d: 0x100a, + 0x91e: 0x1026, 0x91f: 0x102e, 0x920: 0x106e, 0x921: 0x1072, 0x922: 0x107a, 0x923: 0x107e, + 0x924: 0x1086, 0x925: 0x108a, 0x926: 0x10ae, 0x927: 0x10b2, 0x928: 0x10ce, 0x929: 0x10d2, + 0x92a: 0x10d6, 0x92b: 0x10da, 0x92c: 0x10ee, 0x92d: 0x1112, 0x92e: 0x1116, 0x92f: 0x111a, + 0x930: 0x113e, 0x931: 0x117e, 0x932: 0x1182, 0x933: 0x11a2, 0x934: 0x11b2, 0x935: 0x11ba, + 0x936: 0x11da, 0x937: 0x11fe, 0x938: 0x1242, 0x939: 0x124a, 0x93a: 0x125e, 0x93b: 0x126a, + 0x93c: 0x1272, 0x93d: 0x127a, 0x93e: 0x127e, 0x93f: 0x1282, + // Block 0x25, offset 0x940 + 0x940: 0x129a, 0x941: 0x129e, 0x942: 0x12ba, 0x943: 0x12c2, 0x944: 0x12ca, 0x945: 0x12ce, + 0x946: 0x12da, 0x947: 0x12e2, 0x948: 0x12e6, 0x949: 0x12ea, 0x94a: 0x12f2, 0x94b: 0x12f6, + 0x94c: 0x1396, 0x94d: 0x13aa, 0x94e: 0x13de, 0x94f: 0x13e2, 0x950: 0x13ea, 0x951: 0x1416, + 0x952: 0x141e, 0x953: 0x1426, 0x954: 0x142e, 0x955: 0x146a, 0x956: 0x146e, 0x957: 0x1476, + 0x958: 0x147a, 0x959: 0x147e, 0x95a: 0x14aa, 0x95b: 0x14ae, 0x95c: 0x14b6, 0x95d: 0x14ca, + 0x95e: 0x14ce, 0x95f: 0x14ea, 0x960: 0x14f2, 0x961: 0x14f6, 0x962: 0x151a, 0x963: 0x153a, + 0x964: 0x154e, 0x965: 0x1552, 0x966: 0x155a, 0x967: 0x1586, 0x968: 0x158a, 0x969: 0x159a, + 0x96a: 0x15be, 0x96b: 0x15ca, 0x96c: 0x15da, 0x96d: 0x15f2, 0x96e: 0x15fa, 0x96f: 0x15fe, + 0x970: 0x1602, 0x971: 0x1606, 0x972: 0x1612, 0x973: 0x1616, 0x974: 0x161e, 0x975: 0x163a, + 0x976: 0x163e, 0x977: 0x1642, 0x978: 0x165a, 0x979: 0x165e, 0x97a: 0x1666, 0x97b: 0x167a, + 0x97c: 0x167e, 0x97d: 0x1682, 0x97e: 0x168a, 0x97f: 0x168e, + // Block 0x26, offset 0x980 + 0x986: 0xa000, 0x98b: 0xa000, + 0x98c: 0x4049, 0x98d: 0xa000, 0x98e: 0x4051, 0x98f: 0xa000, 0x990: 0x4059, 0x991: 0xa000, + 0x992: 0x4061, 0x993: 0xa000, 0x994: 0x4069, 0x995: 0xa000, 0x996: 0x4071, 0x997: 0xa000, + 0x998: 0x4079, 0x999: 0xa000, 0x99a: 0x4081, 0x99b: 0xa000, 0x99c: 0x4089, 0x99d: 0xa000, + 0x99e: 0x4091, 0x99f: 0xa000, 0x9a0: 0x4099, 0x9a1: 0xa000, 0x9a2: 0x40a1, + 0x9a4: 0xa000, 0x9a5: 0x40a9, 0x9a6: 0xa000, 0x9a7: 0x40b1, 0x9a8: 0xa000, 0x9a9: 0x40b9, + 0x9af: 0xa000, + 0x9b0: 0x40c1, 0x9b1: 0x40c9, 0x9b2: 0xa000, 0x9b3: 0x40d1, 0x9b4: 0x40d9, 0x9b5: 0xa000, + 0x9b6: 0x40e1, 0x9b7: 0x40e9, 0x9b8: 0xa000, 0x9b9: 0x40f1, 0x9ba: 0x40f9, 0x9bb: 0xa000, + 0x9bc: 0x4101, 0x9bd: 0x4109, + // Block 0x27, offset 0x9c0 + 0x9d4: 0x4041, + 0x9d9: 0x9904, 0x9da: 0x9904, 0x9db: 0x441d, 0x9dc: 0x4423, 0x9dd: 0xa000, + 0x9de: 0x4111, 0x9df: 0x27e4, + 0x9e6: 0xa000, + 0x9eb: 0xa000, 0x9ec: 0x4121, 0x9ed: 0xa000, 0x9ee: 0x4129, 0x9ef: 0xa000, + 0x9f0: 0x4131, 0x9f1: 0xa000, 0x9f2: 0x4139, 0x9f3: 0xa000, 0x9f4: 0x4141, 0x9f5: 0xa000, + 0x9f6: 0x4149, 0x9f7: 0xa000, 0x9f8: 0x4151, 0x9f9: 0xa000, 0x9fa: 0x4159, 0x9fb: 0xa000, + 0x9fc: 0x4161, 0x9fd: 0xa000, 0x9fe: 0x4169, 0x9ff: 0xa000, + // Block 0x28, offset 0xa00 + 0xa00: 0x4171, 0xa01: 0xa000, 0xa02: 0x4179, 0xa04: 0xa000, 0xa05: 0x4181, + 0xa06: 0xa000, 0xa07: 0x4189, 0xa08: 0xa000, 0xa09: 0x4191, + 0xa0f: 0xa000, 0xa10: 0x4199, 0xa11: 0x41a1, + 0xa12: 0xa000, 0xa13: 0x41a9, 0xa14: 0x41b1, 0xa15: 0xa000, 0xa16: 0x41b9, 0xa17: 0x41c1, + 0xa18: 0xa000, 0xa19: 0x41c9, 0xa1a: 0x41d1, 0xa1b: 0xa000, 0xa1c: 0x41d9, 0xa1d: 0x41e1, + 0xa2f: 0xa000, + 0xa30: 0xa000, 0xa31: 0xa000, 0xa32: 0xa000, 0xa34: 0x4119, + 0xa37: 0x41e9, 0xa38: 0x41f1, 0xa39: 0x41f9, 0xa3a: 0x4201, + 0xa3d: 0xa000, 0xa3e: 0x4209, 0xa3f: 0x27f9, + // Block 0x29, offset 0xa40 + 0xa40: 0x045a, 0xa41: 0x041e, 0xa42: 0x0422, 0xa43: 0x0426, 0xa44: 0x046e, 0xa45: 0x042a, + 0xa46: 0x042e, 0xa47: 0x0432, 0xa48: 0x0436, 0xa49: 0x043a, 0xa4a: 0x043e, 0xa4b: 0x0442, + 0xa4c: 0x0446, 0xa4d: 0x044a, 0xa4e: 0x044e, 0xa4f: 0x4afe, 0xa50: 0x4b04, 0xa51: 0x4b0a, + 0xa52: 0x4b10, 0xa53: 0x4b16, 0xa54: 0x4b1c, 0xa55: 0x4b22, 0xa56: 0x4b28, 0xa57: 0x4b2e, + 0xa58: 0x4b34, 0xa59: 0x4b3a, 0xa5a: 0x4b40, 0xa5b: 0x4b46, 0xa5c: 0x4b4c, 0xa5d: 0x4b52, + 0xa5e: 0x4b58, 0xa5f: 0x4b5e, 0xa60: 0x4b64, 0xa61: 0x4b6a, 0xa62: 0x4b70, 0xa63: 0x4b76, + 0xa64: 0x04b6, 0xa65: 0x0452, 0xa66: 0x0456, 0xa67: 0x04da, 0xa68: 0x04de, 0xa69: 0x04e2, + 0xa6a: 0x04e6, 0xa6b: 0x04ea, 0xa6c: 0x04ee, 0xa6d: 0x04f2, 0xa6e: 0x045e, 0xa6f: 0x04f6, + 0xa70: 0x04fa, 0xa71: 0x0462, 0xa72: 0x0466, 0xa73: 0x046a, 0xa74: 0x0472, 0xa75: 0x0476, + 0xa76: 0x047a, 0xa77: 0x047e, 0xa78: 0x0482, 0xa79: 0x0486, 0xa7a: 0x048a, 0xa7b: 0x048e, + 0xa7c: 0x0492, 0xa7d: 0x0496, 0xa7e: 0x049a, 0xa7f: 0x049e, + // Block 0x2a, offset 0xa80 + 0xa80: 0x04a2, 0xa81: 0x04a6, 0xa82: 0x04fe, 0xa83: 0x0502, 0xa84: 0x04aa, 0xa85: 0x04ae, + 0xa86: 0x04b2, 0xa87: 0x04ba, 0xa88: 0x04be, 0xa89: 0x04c2, 0xa8a: 0x04c6, 0xa8b: 0x04ca, + 0xa8c: 0x04ce, 0xa8d: 0x04d2, 0xa8e: 0x04d6, + 0xa92: 0x07ba, 0xa93: 0x0816, 0xa94: 0x07c6, 0xa95: 0x0a76, 0xa96: 0x07ca, 0xa97: 0x07e2, + 0xa98: 0x07ce, 0xa99: 0x108e, 0xa9a: 0x0802, 0xa9b: 0x07d6, 0xa9c: 0x07be, 0xa9d: 0x0afa, + 0xa9e: 0x0a8a, 0xa9f: 0x082a, + // Block 0x2b, offset 0xac0 + 0xac0: 0x2184, 0xac1: 0x218a, 0xac2: 0x2190, 0xac3: 0x2196, 0xac4: 0x219c, 0xac5: 0x21a2, + 0xac6: 0x21a8, 0xac7: 0x21ae, 0xac8: 0x21b4, 0xac9: 0x21ba, 0xaca: 0x21c0, 0xacb: 0x21c6, + 0xacc: 0x21cc, 0xacd: 0x21d2, 0xace: 0x285d, 0xacf: 0x2866, 0xad0: 0x286f, 0xad1: 0x2878, + 0xad2: 0x2881, 0xad3: 0x288a, 0xad4: 0x2893, 0xad5: 0x289c, 0xad6: 0x28a5, 0xad7: 0x28b7, + 0xad8: 0x28c0, 0xad9: 0x28c9, 0xada: 0x28d2, 0xadb: 0x28db, 0xadc: 0x28ae, 0xadd: 0x2ce3, + 0xade: 0x2c24, 0xae0: 0x21d8, 0xae1: 0x21f0, 0xae2: 0x21e4, 0xae3: 0x2238, + 0xae4: 0x21f6, 0xae5: 0x2214, 0xae6: 0x21de, 0xae7: 0x220e, 0xae8: 0x21ea, 0xae9: 0x2220, + 0xaea: 0x2250, 0xaeb: 0x226e, 0xaec: 0x2268, 0xaed: 0x225c, 0xaee: 0x22aa, 0xaef: 0x223e, + 0xaf0: 0x224a, 0xaf1: 0x2262, 0xaf2: 0x2256, 0xaf3: 0x2280, 0xaf4: 0x222c, 0xaf5: 0x2274, + 0xaf6: 0x229e, 0xaf7: 0x2286, 0xaf8: 0x221a, 0xaf9: 0x21fc, 0xafa: 0x2232, 0xafb: 0x2244, + 0xafc: 0x227a, 0xafd: 0x2202, 0xafe: 0x22a4, 0xaff: 0x2226, + // Block 0x2c, offset 0xb00 + 0xb00: 0x228c, 0xb01: 0x2208, 0xb02: 0x2292, 0xb03: 0x2298, 0xb04: 0x0a2a, 0xb05: 0x0bfe, + 0xb06: 0x0da2, 0xb07: 0x11c2, + 0xb10: 0x1cf4, 0xb11: 0x19d6, + 0xb12: 0x19d9, 0xb13: 0x19dc, 0xb14: 0x19df, 0xb15: 0x19e2, 0xb16: 0x19e5, 0xb17: 0x19e8, + 0xb18: 0x19eb, 0xb19: 0x19ee, 0xb1a: 0x19f7, 0xb1b: 0x19fa, 0xb1c: 0x19fd, 0xb1d: 0x1a00, + 0xb1e: 0x1a03, 0xb1f: 0x1a06, 0xb20: 0x0406, 0xb21: 0x040e, 0xb22: 0x0412, 0xb23: 0x041a, + 0xb24: 0x041e, 0xb25: 0x0422, 0xb26: 0x042a, 0xb27: 0x0432, 0xb28: 0x0436, 0xb29: 0x043e, + 0xb2a: 0x0442, 0xb2b: 0x0446, 0xb2c: 0x044a, 0xb2d: 0x044e, 0xb2e: 0x2f59, 0xb2f: 0x2f61, + 0xb30: 0x2f69, 0xb31: 0x2f71, 0xb32: 0x2f79, 0xb33: 0x2f81, 0xb34: 0x2f89, 0xb35: 0x2f91, + 0xb36: 0x2fa1, 0xb37: 0x2fa9, 0xb38: 0x2fb1, 0xb39: 0x2fb9, 0xb3a: 0x2fc1, 0xb3b: 0x2fc9, + 0xb3c: 0x3014, 0xb3d: 0x2fdc, 0xb3e: 0x2f99, + // Block 0x2d, offset 0xb40 + 0xb40: 0x07ba, 0xb41: 0x0816, 0xb42: 0x07c6, 0xb43: 0x0a76, 0xb44: 0x081a, 0xb45: 0x08aa, + 0xb46: 0x07c2, 0xb47: 0x08a6, 0xb48: 0x0806, 0xb49: 0x0982, 0xb4a: 0x0e02, 0xb4b: 0x0f8a, + 0xb4c: 0x0ed2, 0xb4d: 0x0e16, 0xb4e: 0x155a, 0xb4f: 0x0a86, 0xb50: 0x0dca, 0xb51: 0x0e46, + 0xb52: 0x0e06, 0xb53: 0x1146, 0xb54: 0x09f6, 0xb55: 0x0ffe, 0xb56: 0x1482, 0xb57: 0x115a, + 0xb58: 0x093e, 0xb59: 0x118a, 0xb5a: 0x1096, 0xb5b: 0x0b12, 0xb5c: 0x150a, 0xb5d: 0x087a, + 0xb5e: 0x09a6, 0xb5f: 0x0ef2, 0xb60: 0x1622, 0xb61: 0x083e, 0xb62: 0x08ce, 0xb63: 0x0e96, + 0xb64: 0x07ca, 0xb65: 0x07e2, 0xb66: 0x07ce, 0xb67: 0x0bd6, 0xb68: 0x09ea, 0xb69: 0x097a, + 0xb6a: 0x0b52, 0xb6b: 0x0b46, 0xb6c: 0x10e6, 0xb6d: 0x083a, 0xb6e: 0x1496, 0xb6f: 0x0996, + 0xb70: 0x0aee, 0xb71: 0x1a09, 0xb72: 0x1a0c, 0xb73: 0x1a0f, 0xb74: 0x1a12, 0xb75: 0x1a1b, + 0xb76: 0x1a1e, 0xb77: 0x1a21, 0xb78: 0x1a24, 0xb79: 0x1a27, 0xb7a: 0x1a2a, 0xb7b: 0x1a2d, + 0xb7c: 0x1a30, 0xb7d: 0x1a33, 0xb7e: 0x1a36, 0xb7f: 0x1a3f, + // Block 0x2e, offset 0xb80 + 0xb80: 0x1df6, 0xb81: 0x1e05, 0xb82: 0x1e14, 0xb83: 0x1e23, 0xb84: 0x1e32, 0xb85: 0x1e41, + 0xb86: 0x1e50, 0xb87: 0x1e5f, 0xb88: 0x1e6e, 0xb89: 0x22bc, 0xb8a: 0x22ce, 0xb8b: 0x22e0, + 0xb8c: 0x1a81, 0xb8d: 0x1d34, 0xb8e: 0x1b02, 0xb8f: 0x1cd8, 0xb90: 0x05c6, 0xb91: 0x05ce, + 0xb92: 0x05d6, 0xb93: 0x05de, 0xb94: 0x05e6, 0xb95: 0x05ea, 0xb96: 0x05ee, 0xb97: 0x05f2, + 0xb98: 0x05f6, 0xb99: 0x05fa, 0xb9a: 0x05fe, 0xb9b: 0x0602, 0xb9c: 0x0606, 0xb9d: 0x060a, + 0xb9e: 0x060e, 0xb9f: 0x0612, 0xba0: 0x0616, 0xba1: 0x061e, 0xba2: 0x0622, 0xba3: 0x0626, + 0xba4: 0x062a, 0xba5: 0x062e, 0xba6: 0x0632, 0xba7: 0x0636, 0xba8: 0x063a, 0xba9: 0x063e, + 0xbaa: 0x0642, 0xbab: 0x0646, 0xbac: 0x064a, 0xbad: 0x064e, 0xbae: 0x0652, 0xbaf: 0x0656, + 0xbb0: 0x065a, 0xbb1: 0x065e, 0xbb2: 0x0662, 0xbb3: 0x066a, 0xbb4: 0x0672, 0xbb5: 0x067a, + 0xbb6: 0x067e, 0xbb7: 0x0682, 0xbb8: 0x0686, 0xbb9: 0x068a, 0xbba: 0x068e, 0xbbb: 0x0692, + 0xbbc: 0x0696, 0xbbd: 0x069a, 0xbbe: 0x069e, 0xbbf: 0x282a, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x2c43, 0xbc1: 0x2adf, 0xbc2: 0x2c53, 0xbc3: 0x29b7, 0xbc4: 0x3025, 0xbc5: 0x29c1, + 0xbc6: 0x29cb, 0xbc7: 0x3069, 0xbc8: 0x2aec, 0xbc9: 0x29d5, 0xbca: 0x29df, 0xbcb: 0x29e9, + 0xbcc: 0x2b13, 0xbcd: 0x2b20, 0xbce: 0x2af9, 0xbcf: 0x2b06, 0xbd0: 0x2fea, 0xbd1: 0x2b2d, + 0xbd2: 0x2b3a, 0xbd3: 0x2cf5, 0xbd4: 0x27eb, 0xbd5: 0x2d08, 0xbd6: 0x2d1b, 0xbd7: 0x2c63, + 0xbd8: 0x2b47, 0xbd9: 0x2d2e, 0xbda: 0x2d41, 0xbdb: 0x2b54, 0xbdc: 0x29f3, 0xbdd: 0x29fd, + 0xbde: 0x2ff8, 0xbdf: 0x2b61, 0xbe0: 0x2c73, 0xbe1: 0x3036, 0xbe2: 0x2a07, 0xbe3: 0x2a11, + 0xbe4: 0x2b6e, 0xbe5: 0x2a1b, 0xbe6: 0x2a25, 0xbe7: 0x2800, 0xbe8: 0x2807, 0xbe9: 0x2a2f, + 0xbea: 0x2a39, 0xbeb: 0x2d54, 0xbec: 0x2b7b, 0xbed: 0x2c83, 0xbee: 0x2d67, 0xbef: 0x2b88, + 0xbf0: 0x2a4d, 0xbf1: 0x2a43, 0xbf2: 0x307d, 0xbf3: 0x2b95, 0xbf4: 0x2d7a, 0xbf5: 0x2a57, + 0xbf6: 0x2c93, 0xbf7: 0x2a61, 0xbf8: 0x2baf, 0xbf9: 0x2a6b, 0xbfa: 0x2bbc, 0xbfb: 0x3047, + 0xbfc: 0x2ba2, 0xbfd: 0x2ca3, 0xbfe: 0x2bc9, 0xbff: 0x280e, + // Block 0x30, offset 0xc00 + 0xc00: 0x3058, 0xc01: 0x2a75, 0xc02: 0x2a7f, 0xc03: 0x2bd6, 0xc04: 0x2a89, 0xc05: 0x2a93, + 0xc06: 0x2a9d, 0xc07: 0x2cb3, 0xc08: 0x2be3, 0xc09: 0x2815, 0xc0a: 0x2d8d, 0xc0b: 0x2fd1, + 0xc0c: 0x2cc3, 0xc0d: 0x2bf0, 0xc0e: 0x3006, 0xc0f: 0x2aa7, 0xc10: 0x2ab1, 0xc11: 0x2bfd, + 0xc12: 0x281c, 0xc13: 0x2c0a, 0xc14: 0x2cd3, 0xc15: 0x2823, 0xc16: 0x2da0, 0xc17: 0x2abb, + 0xc18: 0x1de7, 0xc19: 0x1dfb, 0xc1a: 0x1e0a, 0xc1b: 0x1e19, 0xc1c: 0x1e28, 0xc1d: 0x1e37, + 0xc1e: 0x1e46, 0xc1f: 0x1e55, 0xc20: 0x1e64, 0xc21: 0x1e73, 0xc22: 0x22c2, 0xc23: 0x22d4, + 0xc24: 0x22e6, 0xc25: 0x22f2, 0xc26: 0x22fe, 0xc27: 0x230a, 0xc28: 0x2316, 0xc29: 0x2322, + 0xc2a: 0x232e, 0xc2b: 0x233a, 0xc2c: 0x2376, 0xc2d: 0x2382, 0xc2e: 0x238e, 0xc2f: 0x239a, + 0xc30: 0x23a6, 0xc31: 0x1d44, 0xc32: 0x1af6, 0xc33: 0x1a63, 0xc34: 0x1d14, 0xc35: 0x1b77, + 0xc36: 0x1b86, 0xc37: 0x1afc, 0xc38: 0x1d2c, 0xc39: 0x1d30, 0xc3a: 0x1a8d, 0xc3b: 0x2838, + 0xc3c: 0x2846, 0xc3d: 0x2831, 0xc3e: 0x283f, 0xc3f: 0x2c17, + // Block 0x31, offset 0xc40 + 0xc40: 0x1b7a, 0xc41: 0x1b62, 0xc42: 0x1d90, 0xc43: 0x1b4a, 0xc44: 0x1b23, 0xc45: 0x1a96, + 0xc46: 0x1aa5, 0xc47: 0x1a75, 0xc48: 0x1d20, 0xc49: 0x1e82, 0xc4a: 0x1b7d, 0xc4b: 0x1b65, + 0xc4c: 0x1d94, 0xc4d: 0x1da0, 0xc4e: 0x1b56, 0xc4f: 0x1b2c, 0xc50: 0x1a84, 0xc51: 0x1d4c, + 0xc52: 0x1ce0, 0xc53: 0x1ccc, 0xc54: 0x1cfc, 0xc55: 0x1da4, 0xc56: 0x1b59, 0xc57: 0x1af9, + 0xc58: 0x1b2f, 0xc59: 0x1b0e, 0xc5a: 0x1b71, 0xc5b: 0x1da8, 0xc5c: 0x1b5c, 0xc5d: 0x1af0, + 0xc5e: 0x1b32, 0xc5f: 0x1d6c, 0xc60: 0x1d24, 0xc61: 0x1b44, 0xc62: 0x1d54, 0xc63: 0x1d70, + 0xc64: 0x1d28, 0xc65: 0x1b47, 0xc66: 0x1d58, 0xc67: 0x2418, 0xc68: 0x242c, 0xc69: 0x1ac6, + 0xc6a: 0x1d50, 0xc6b: 0x1ce4, 0xc6c: 0x1cd0, 0xc6d: 0x1d78, 0xc6e: 0x284d, 0xc6f: 0x28e4, + 0xc70: 0x1b89, 0xc71: 0x1b74, 0xc72: 0x1dac, 0xc73: 0x1b5f, 0xc74: 0x1b80, 0xc75: 0x1b68, + 0xc76: 0x1d98, 0xc77: 0x1b4d, 0xc78: 0x1b26, 0xc79: 0x1ab1, 0xc7a: 0x1b83, 0xc7b: 0x1b6b, + 0xc7c: 0x1d9c, 0xc7d: 0x1b50, 0xc7e: 0x1b29, 0xc7f: 0x1ab4, + // Block 0x32, offset 0xc80 + 0xc80: 0x1d5c, 0xc81: 0x1ce8, 0xc82: 0x1e7d, 0xc83: 0x1a66, 0xc84: 0x1aea, 0xc85: 0x1aed, + 0xc86: 0x2425, 0xc87: 0x1cc4, 0xc88: 0x1af3, 0xc89: 0x1a78, 0xc8a: 0x1b11, 0xc8b: 0x1a7b, + 0xc8c: 0x1b1a, 0xc8d: 0x1a99, 0xc8e: 0x1a9c, 0xc8f: 0x1b35, 0xc90: 0x1b3b, 0xc91: 0x1b3e, + 0xc92: 0x1d60, 0xc93: 0x1b41, 0xc94: 0x1b53, 0xc95: 0x1d68, 0xc96: 0x1d74, 0xc97: 0x1ac0, + 0xc98: 0x1e87, 0xc99: 0x1cec, 0xc9a: 0x1ac3, 0xc9b: 0x1b8c, 0xc9c: 0x1ad5, 0xc9d: 0x1ae4, + 0xc9e: 0x2412, 0xc9f: 0x240c, 0xca0: 0x1df1, 0xca1: 0x1e00, 0xca2: 0x1e0f, 0xca3: 0x1e1e, + 0xca4: 0x1e2d, 0xca5: 0x1e3c, 0xca6: 0x1e4b, 0xca7: 0x1e5a, 0xca8: 0x1e69, 0xca9: 0x22b6, + 0xcaa: 0x22c8, 0xcab: 0x22da, 0xcac: 0x22ec, 0xcad: 0x22f8, 0xcae: 0x2304, 0xcaf: 0x2310, + 0xcb0: 0x231c, 0xcb1: 0x2328, 0xcb2: 0x2334, 0xcb3: 0x2370, 0xcb4: 0x237c, 0xcb5: 0x2388, + 0xcb6: 0x2394, 0xcb7: 0x23a0, 0xcb8: 0x23ac, 0xcb9: 0x23b2, 0xcba: 0x23b8, 0xcbb: 0x23be, + 0xcbc: 0x23c4, 0xcbd: 0x23d6, 0xcbe: 0x23dc, 0xcbf: 0x1d40, + // Block 0x33, offset 0xcc0 + 0xcc0: 0x1472, 0xcc1: 0x0df6, 0xcc2: 0x14ce, 0xcc3: 0x149a, 0xcc4: 0x0f52, 0xcc5: 0x07e6, + 0xcc6: 0x09da, 0xcc7: 0x1726, 0xcc8: 0x1726, 0xcc9: 0x0b06, 0xcca: 0x155a, 0xccb: 0x0a3e, + 0xccc: 0x0b02, 0xccd: 0x0cea, 0xcce: 0x10ca, 0xccf: 0x125a, 0xcd0: 0x1392, 0xcd1: 0x13ce, + 0xcd2: 0x1402, 0xcd3: 0x1516, 0xcd4: 0x0e6e, 0xcd5: 0x0efa, 0xcd6: 0x0fa6, 0xcd7: 0x103e, + 0xcd8: 0x135a, 0xcd9: 0x1542, 0xcda: 0x166e, 0xcdb: 0x080a, 0xcdc: 0x09ae, 0xcdd: 0x0e82, + 0xcde: 0x0fca, 0xcdf: 0x138e, 0xce0: 0x16be, 0xce1: 0x0bae, 0xce2: 0x0f72, 0xce3: 0x137e, + 0xce4: 0x1412, 0xce5: 0x0d1e, 0xce6: 0x12b6, 0xce7: 0x13da, 0xce8: 0x0c1a, 0xce9: 0x0e0a, + 0xcea: 0x0f12, 0xceb: 0x1016, 0xcec: 0x1522, 0xced: 0x084a, 0xcee: 0x08e2, 0xcef: 0x094e, + 0xcf0: 0x0d86, 0xcf1: 0x0e7a, 0xcf2: 0x0fc6, 0xcf3: 0x10ea, 0xcf4: 0x1272, 0xcf5: 0x1386, + 0xcf6: 0x139e, 0xcf7: 0x14c2, 0xcf8: 0x15ea, 0xcf9: 0x169e, 0xcfa: 0x16ba, 0xcfb: 0x1126, + 0xcfc: 0x1166, 0xcfd: 0x121e, 0xcfe: 0x133e, 0xcff: 0x1576, + // Block 0x34, offset 0xd00 + 0xd00: 0x16c6, 0xd01: 0x1446, 0xd02: 0x0ac2, 0xd03: 0x0c36, 0xd04: 0x11d6, 0xd05: 0x1296, + 0xd06: 0x0ffa, 0xd07: 0x112e, 0xd08: 0x1492, 0xd09: 0x15e2, 0xd0a: 0x0abe, 0xd0b: 0x0b8a, + 0xd0c: 0x0e72, 0xd0d: 0x0f26, 0xd0e: 0x0f5a, 0xd0f: 0x120e, 0xd10: 0x1236, 0xd11: 0x15a2, + 0xd12: 0x094a, 0xd13: 0x12a2, 0xd14: 0x08ee, 0xd15: 0x08ea, 0xd16: 0x1192, 0xd17: 0x1222, + 0xd18: 0x1356, 0xd19: 0x15aa, 0xd1a: 0x1462, 0xd1b: 0x0d22, 0xd1c: 0x0e6e, 0xd1d: 0x1452, + 0xd1e: 0x07f2, 0xd1f: 0x0b5e, 0xd20: 0x0c8e, 0xd21: 0x102a, 0xd22: 0x10aa, 0xd23: 0x096e, + 0xd24: 0x1136, 0xd25: 0x085a, 0xd26: 0x0c72, 0xd27: 0x07d2, 0xd28: 0x0ee6, 0xd29: 0x0d9e, + 0xd2a: 0x120a, 0xd2b: 0x09c2, 0xd2c: 0x0aae, 0xd2d: 0x10f6, 0xd2e: 0x135e, 0xd2f: 0x1436, + 0xd30: 0x0eb2, 0xd31: 0x14f2, 0xd32: 0x0ede, 0xd33: 0x0d32, 0xd34: 0x1316, 0xd35: 0x0d52, + 0xd36: 0x10a6, 0xd37: 0x0826, 0xd38: 0x08a2, 0xd39: 0x08e6, 0xd3a: 0x0e4e, 0xd3b: 0x11f6, + 0xd3c: 0x12ee, 0xd3d: 0x1442, 0xd3e: 0x1556, 0xd3f: 0x0956, + // Block 0x35, offset 0xd40 + 0xd40: 0x0a0a, 0xd41: 0x0b12, 0xd42: 0x0c2a, 0xd43: 0x0dba, 0xd44: 0x0f76, 0xd45: 0x113a, + 0xd46: 0x1592, 0xd47: 0x1676, 0xd48: 0x16ca, 0xd49: 0x16e2, 0xd4a: 0x0932, 0xd4b: 0x0dee, + 0xd4c: 0x0e9e, 0xd4d: 0x14e6, 0xd4e: 0x0bf6, 0xd4f: 0x0cd2, 0xd50: 0x0cee, 0xd51: 0x0d7e, + 0xd52: 0x0f66, 0xd53: 0x0fb2, 0xd54: 0x1062, 0xd55: 0x1186, 0xd56: 0x122a, 0xd57: 0x128e, + 0xd58: 0x14d6, 0xd59: 0x1366, 0xd5a: 0x14fe, 0xd5b: 0x157a, 0xd5c: 0x090a, 0xd5d: 0x0936, + 0xd5e: 0x0a1e, 0xd5f: 0x0fa2, 0xd60: 0x13ee, 0xd61: 0x1436, 0xd62: 0x0c16, 0xd63: 0x0c86, + 0xd64: 0x0d4a, 0xd65: 0x0eaa, 0xd66: 0x11d2, 0xd67: 0x101e, 0xd68: 0x0836, 0xd69: 0x0a7a, + 0xd6a: 0x0b5e, 0xd6b: 0x0bc2, 0xd6c: 0x0c92, 0xd6d: 0x103a, 0xd6e: 0x1056, 0xd6f: 0x1266, + 0xd70: 0x1286, 0xd71: 0x155e, 0xd72: 0x15de, 0xd73: 0x15ee, 0xd74: 0x162a, 0xd75: 0x084e, + 0xd76: 0x117a, 0xd77: 0x154a, 0xd78: 0x15c6, 0xd79: 0x0caa, 0xd7a: 0x0812, 0xd7b: 0x0872, + 0xd7c: 0x0b62, 0xd7d: 0x0b82, 0xd7e: 0x0daa, 0xd7f: 0x0e6e, + // Block 0x36, offset 0xd80 + 0xd80: 0x0fbe, 0xd81: 0x10c6, 0xd82: 0x1372, 0xd83: 0x1512, 0xd84: 0x171e, 0xd85: 0x0dde, + 0xd86: 0x159e, 0xd87: 0x092e, 0xd88: 0x0e2a, 0xd89: 0x0e36, 0xd8a: 0x0f0a, 0xd8b: 0x0f42, + 0xd8c: 0x1046, 0xd8d: 0x10a2, 0xd8e: 0x1122, 0xd8f: 0x1206, 0xd90: 0x1636, 0xd91: 0x08aa, + 0xd92: 0x0cfe, 0xd93: 0x15ae, 0xd94: 0x0862, 0xd95: 0x0ba6, 0xd96: 0x0f2a, 0xd97: 0x14da, + 0xd98: 0x0c62, 0xd99: 0x0cb2, 0xd9a: 0x0e3e, 0xd9b: 0x102a, 0xd9c: 0x15b6, 0xd9d: 0x0912, + 0xd9e: 0x09fa, 0xd9f: 0x0b92, 0xda0: 0x0dce, 0xda1: 0x0e1a, 0xda2: 0x0e5a, 0xda3: 0x0eee, + 0xda4: 0x1042, 0xda5: 0x10b6, 0xda6: 0x1252, 0xda7: 0x13f2, 0xda8: 0x13fe, 0xda9: 0x1552, + 0xdaa: 0x15d2, 0xdab: 0x097e, 0xdac: 0x0f46, 0xdad: 0x09fe, 0xdae: 0x0fc2, 0xdaf: 0x1066, + 0xdb0: 0x1382, 0xdb1: 0x15ba, 0xdb2: 0x16a6, 0xdb3: 0x16ce, 0xdb4: 0x0e32, 0xdb5: 0x0f22, + 0xdb6: 0x12be, 0xdb7: 0x11b2, 0xdb8: 0x11be, 0xdb9: 0x11e2, 0xdba: 0x1012, 0xdbb: 0x0f9a, + 0xdbc: 0x145e, 0xdbd: 0x082e, 0xdbe: 0x1326, 0xdbf: 0x0916, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x0906, 0xdc1: 0x0c06, 0xdc2: 0x0d26, 0xdc3: 0x11ee, 0xdc4: 0x0b4e, 0xdc5: 0x0efe, + 0xdc6: 0x0dea, 0xdc7: 0x14e2, 0xdc8: 0x13e2, 0xdc9: 0x15a6, 0xdca: 0x141e, 0xdcb: 0x0c22, + 0xdcc: 0x0882, 0xdcd: 0x0a56, 0xdd0: 0x0aaa, + 0xdd2: 0x0dda, 0xdd5: 0x08f2, 0xdd6: 0x101a, 0xdd7: 0x10de, + 0xdd8: 0x1142, 0xdd9: 0x115e, 0xdda: 0x1162, 0xddb: 0x1176, 0xddc: 0x15f6, 0xddd: 0x11e6, + 0xdde: 0x126a, 0xde0: 0x138a, 0xde2: 0x144e, + 0xde5: 0x1502, 0xde6: 0x152e, + 0xdea: 0x164a, 0xdeb: 0x164e, 0xdec: 0x1652, 0xded: 0x16b6, 0xdee: 0x1526, 0xdef: 0x15c2, + 0xdf0: 0x0852, 0xdf1: 0x0876, 0xdf2: 0x088a, 0xdf3: 0x0946, 0xdf4: 0x0952, 0xdf5: 0x0992, + 0xdf6: 0x0a46, 0xdf7: 0x0a62, 0xdf8: 0x0a6a, 0xdf9: 0x0aa6, 0xdfa: 0x0ab2, 0xdfb: 0x0b8e, + 0xdfc: 0x0b96, 0xdfd: 0x0c9e, 0xdfe: 0x0cc6, 0xdff: 0x0cce, + // Block 0x38, offset 0xe00 + 0xe00: 0x0ce6, 0xe01: 0x0d92, 0xe02: 0x0dc2, 0xe03: 0x0de2, 0xe04: 0x0e52, 0xe05: 0x0f16, + 0xe06: 0x0f32, 0xe07: 0x0f62, 0xe08: 0x0fb6, 0xe09: 0x0fd6, 0xe0a: 0x104a, 0xe0b: 0x112a, + 0xe0c: 0x1146, 0xe0d: 0x114e, 0xe0e: 0x114a, 0xe0f: 0x1152, 0xe10: 0x1156, 0xe11: 0x115a, + 0xe12: 0x116e, 0xe13: 0x1172, 0xe14: 0x1196, 0xe15: 0x11aa, 0xe16: 0x11c6, 0xe17: 0x122a, + 0xe18: 0x1232, 0xe19: 0x123a, 0xe1a: 0x124e, 0xe1b: 0x1276, 0xe1c: 0x12c6, 0xe1d: 0x12fa, + 0xe1e: 0x12fa, 0xe1f: 0x1362, 0xe20: 0x140a, 0xe21: 0x1422, 0xe22: 0x1456, 0xe23: 0x145a, + 0xe24: 0x149e, 0xe25: 0x14a2, 0xe26: 0x14fa, 0xe27: 0x1502, 0xe28: 0x15d6, 0xe29: 0x161a, + 0xe2a: 0x1632, 0xe2b: 0x0c96, 0xe2c: 0x184b, 0xe2d: 0x12de, + 0xe30: 0x07da, 0xe31: 0x08de, 0xe32: 0x089e, 0xe33: 0x0846, 0xe34: 0x0886, 0xe35: 0x08b2, + 0xe36: 0x0942, 0xe37: 0x095e, 0xe38: 0x0a46, 0xe39: 0x0a32, 0xe3a: 0x0a42, 0xe3b: 0x0a5e, + 0xe3c: 0x0aaa, 0xe3d: 0x0aba, 0xe3e: 0x0afe, 0xe3f: 0x0b0a, + // Block 0x39, offset 0xe40 + 0xe40: 0x0b26, 0xe41: 0x0b36, 0xe42: 0x0c1e, 0xe43: 0x0c26, 0xe44: 0x0c56, 0xe45: 0x0c76, + 0xe46: 0x0ca6, 0xe47: 0x0cbe, 0xe48: 0x0cae, 0xe49: 0x0cce, 0xe4a: 0x0cc2, 0xe4b: 0x0ce6, + 0xe4c: 0x0d02, 0xe4d: 0x0d5a, 0xe4e: 0x0d66, 0xe4f: 0x0d6e, 0xe50: 0x0d96, 0xe51: 0x0dda, + 0xe52: 0x0e0a, 0xe53: 0x0e0e, 0xe54: 0x0e22, 0xe55: 0x0ea2, 0xe56: 0x0eb2, 0xe57: 0x0f0a, + 0xe58: 0x0f56, 0xe59: 0x0f4e, 0xe5a: 0x0f62, 0xe5b: 0x0f7e, 0xe5c: 0x0fb6, 0xe5d: 0x110e, + 0xe5e: 0x0fda, 0xe5f: 0x100e, 0xe60: 0x101a, 0xe61: 0x105a, 0xe62: 0x1076, 0xe63: 0x109a, + 0xe64: 0x10be, 0xe65: 0x10c2, 0xe66: 0x10de, 0xe67: 0x10e2, 0xe68: 0x10f2, 0xe69: 0x1106, + 0xe6a: 0x1102, 0xe6b: 0x1132, 0xe6c: 0x11ae, 0xe6d: 0x11c6, 0xe6e: 0x11de, 0xe6f: 0x1216, + 0xe70: 0x122a, 0xe71: 0x1246, 0xe72: 0x1276, 0xe73: 0x132a, 0xe74: 0x1352, 0xe75: 0x13c6, + 0xe76: 0x140e, 0xe77: 0x141a, 0xe78: 0x1422, 0xe79: 0x143a, 0xe7a: 0x144e, 0xe7b: 0x143e, + 0xe7c: 0x1456, 0xe7d: 0x1452, 0xe7e: 0x144a, 0xe7f: 0x145a, + // Block 0x3a, offset 0xe80 + 0xe80: 0x1466, 0xe81: 0x14a2, 0xe82: 0x14de, 0xe83: 0x150e, 0xe84: 0x1546, 0xe85: 0x1566, + 0xe86: 0x15b2, 0xe87: 0x15d6, 0xe88: 0x15f6, 0xe89: 0x160a, 0xe8a: 0x161a, 0xe8b: 0x1626, + 0xe8c: 0x1632, 0xe8d: 0x1686, 0xe8e: 0x1726, 0xe8f: 0x17e2, 0xe90: 0x17dd, 0xe91: 0x180f, + 0xe92: 0x0702, 0xe93: 0x072a, 0xe94: 0x072e, 0xe95: 0x1891, 0xe96: 0x18be, 0xe97: 0x1936, + 0xe98: 0x1712, 0xe99: 0x1722, + // Block 0x3b, offset 0xec0 + 0xec0: 0x1b05, 0xec1: 0x1b08, 0xec2: 0x1b0b, 0xec3: 0x1d38, 0xec4: 0x1d3c, 0xec5: 0x1b8f, + 0xec6: 0x1b8f, + 0xed3: 0x1ea5, 0xed4: 0x1e96, 0xed5: 0x1e9b, 0xed6: 0x1eaa, 0xed7: 0x1ea0, + 0xedd: 0x44d1, + 0xede: 0x8116, 0xedf: 0x4543, 0xee0: 0x0320, 0xee1: 0x0308, 0xee2: 0x0311, 0xee3: 0x0314, + 0xee4: 0x0317, 0xee5: 0x031a, 0xee6: 0x031d, 0xee7: 0x0323, 0xee8: 0x0326, 0xee9: 0x0017, + 0xeea: 0x4531, 0xeeb: 0x4537, 0xeec: 0x4635, 0xeed: 0x463d, 0xeee: 0x4489, 0xeef: 0x448f, + 0xef0: 0x4495, 0xef1: 0x449b, 0xef2: 0x44a7, 0xef3: 0x44ad, 0xef4: 0x44b3, 0xef5: 0x44bf, + 0xef6: 0x44c5, 0xef8: 0x44cb, 0xef9: 0x44d7, 0xefa: 0x44dd, 0xefb: 0x44e3, + 0xefc: 0x44ef, 0xefe: 0x44f5, + // Block 0x3c, offset 0xf00 + 0xf00: 0x44fb, 0xf01: 0x4501, 0xf03: 0x4507, 0xf04: 0x450d, + 0xf06: 0x4519, 0xf07: 0x451f, 0xf08: 0x4525, 0xf09: 0x452b, 0xf0a: 0x453d, 0xf0b: 0x44b9, + 0xf0c: 0x44a1, 0xf0d: 0x44e9, 0xf0e: 0x4513, 0xf0f: 0x1eaf, 0xf10: 0x038c, 0xf11: 0x038c, + 0xf12: 0x0395, 0xf13: 0x0395, 0xf14: 0x0395, 0xf15: 0x0395, 0xf16: 0x0398, 0xf17: 0x0398, + 0xf18: 0x0398, 0xf19: 0x0398, 0xf1a: 0x039e, 0xf1b: 0x039e, 0xf1c: 0x039e, 0xf1d: 0x039e, + 0xf1e: 0x0392, 0xf1f: 0x0392, 0xf20: 0x0392, 0xf21: 0x0392, 0xf22: 0x039b, 0xf23: 0x039b, + 0xf24: 0x039b, 0xf25: 0x039b, 0xf26: 0x038f, 0xf27: 0x038f, 0xf28: 0x038f, 0xf29: 0x038f, + 0xf2a: 0x03c2, 0xf2b: 0x03c2, 0xf2c: 0x03c2, 0xf2d: 0x03c2, 0xf2e: 0x03c5, 0xf2f: 0x03c5, + 0xf30: 0x03c5, 0xf31: 0x03c5, 0xf32: 0x03a4, 0xf33: 0x03a4, 0xf34: 0x03a4, 0xf35: 0x03a4, + 0xf36: 0x03a1, 0xf37: 0x03a1, 0xf38: 0x03a1, 0xf39: 0x03a1, 0xf3a: 0x03a7, 0xf3b: 0x03a7, + 0xf3c: 0x03a7, 0xf3d: 0x03a7, 0xf3e: 0x03aa, 0xf3f: 0x03aa, + // Block 0x3d, offset 0xf40 + 0xf40: 0x03aa, 0xf41: 0x03aa, 0xf42: 0x03b3, 0xf43: 0x03b3, 0xf44: 0x03b0, 0xf45: 0x03b0, + 0xf46: 0x03b6, 0xf47: 0x03b6, 0xf48: 0x03ad, 0xf49: 0x03ad, 0xf4a: 0x03bc, 0xf4b: 0x03bc, + 0xf4c: 0x03b9, 0xf4d: 0x03b9, 0xf4e: 0x03c8, 0xf4f: 0x03c8, 0xf50: 0x03c8, 0xf51: 0x03c8, + 0xf52: 0x03ce, 0xf53: 0x03ce, 0xf54: 0x03ce, 0xf55: 0x03ce, 0xf56: 0x03d4, 0xf57: 0x03d4, + 0xf58: 0x03d4, 0xf59: 0x03d4, 0xf5a: 0x03d1, 0xf5b: 0x03d1, 0xf5c: 0x03d1, 0xf5d: 0x03d1, + 0xf5e: 0x03d7, 0xf5f: 0x03d7, 0xf60: 0x03da, 0xf61: 0x03da, 0xf62: 0x03da, 0xf63: 0x03da, + 0xf64: 0x45af, 0xf65: 0x45af, 0xf66: 0x03e0, 0xf67: 0x03e0, 0xf68: 0x03e0, 0xf69: 0x03e0, + 0xf6a: 0x03dd, 0xf6b: 0x03dd, 0xf6c: 0x03dd, 0xf6d: 0x03dd, 0xf6e: 0x03fb, 0xf6f: 0x03fb, + 0xf70: 0x45a9, 0xf71: 0x45a9, + // Block 0x3e, offset 0xf80 + 0xf93: 0x03cb, 0xf94: 0x03cb, 0xf95: 0x03cb, 0xf96: 0x03cb, 0xf97: 0x03e9, + 0xf98: 0x03e9, 0xf99: 0x03e6, 0xf9a: 0x03e6, 0xf9b: 0x03ec, 0xf9c: 0x03ec, 0xf9d: 0x217f, + 0xf9e: 0x03f2, 0xf9f: 0x03f2, 0xfa0: 0x03e3, 0xfa1: 0x03e3, 0xfa2: 0x03ef, 0xfa3: 0x03ef, + 0xfa4: 0x03f8, 0xfa5: 0x03f8, 0xfa6: 0x03f8, 0xfa7: 0x03f8, 0xfa8: 0x0380, 0xfa9: 0x0380, + 0xfaa: 0x26da, 0xfab: 0x26da, 0xfac: 0x274a, 0xfad: 0x274a, 0xfae: 0x2719, 0xfaf: 0x2719, + 0xfb0: 0x2735, 0xfb1: 0x2735, 0xfb2: 0x272e, 0xfb3: 0x272e, 0xfb4: 0x273c, 0xfb5: 0x273c, + 0xfb6: 0x2743, 0xfb7: 0x2743, 0xfb8: 0x2743, 0xfb9: 0x2720, 0xfba: 0x2720, 0xfbb: 0x2720, + 0xfbc: 0x03f5, 0xfbd: 0x03f5, 0xfbe: 0x03f5, 0xfbf: 0x03f5, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x26e1, 0xfc1: 0x26e8, 0xfc2: 0x2704, 0xfc3: 0x2720, 0xfc4: 0x2727, 0xfc5: 0x1eb9, + 0xfc6: 0x1ebe, 0xfc7: 0x1ec3, 0xfc8: 0x1ed2, 0xfc9: 0x1ee1, 0xfca: 0x1ee6, 0xfcb: 0x1eeb, + 0xfcc: 0x1ef0, 0xfcd: 0x1ef5, 0xfce: 0x1f04, 0xfcf: 0x1f13, 0xfd0: 0x1f18, 0xfd1: 0x1f1d, + 0xfd2: 0x1f2c, 0xfd3: 0x1f3b, 0xfd4: 0x1f40, 0xfd5: 0x1f45, 0xfd6: 0x1f4a, 0xfd7: 0x1f59, + 0xfd8: 0x1f5e, 0xfd9: 0x1f6d, 0xfda: 0x1f72, 0xfdb: 0x1f77, 0xfdc: 0x1f86, 0xfdd: 0x1f8b, + 0xfde: 0x1f90, 0xfdf: 0x1f9a, 0xfe0: 0x1fd6, 0xfe1: 0x1fe5, 0xfe2: 0x1ff4, 0xfe3: 0x1ff9, + 0xfe4: 0x1ffe, 0xfe5: 0x2008, 0xfe6: 0x2017, 0xfe7: 0x201c, 0xfe8: 0x202b, 0xfe9: 0x2030, + 0xfea: 0x2035, 0xfeb: 0x2044, 0xfec: 0x2049, 0xfed: 0x2058, 0xfee: 0x205d, 0xfef: 0x2062, + 0xff0: 0x2067, 0xff1: 0x206c, 0xff2: 0x2071, 0xff3: 0x2076, 0xff4: 0x207b, 0xff5: 0x2080, + 0xff6: 0x2085, 0xff7: 0x208a, 0xff8: 0x208f, 0xff9: 0x2094, 0xffa: 0x2099, 0xffb: 0x209e, + 0xffc: 0x20a3, 0xffd: 0x20a8, 0xffe: 0x20ad, 0xfff: 0x20b7, + // Block 0x40, offset 0x1000 + 0x1000: 0x20bc, 0x1001: 0x20c1, 0x1002: 0x20c6, 0x1003: 0x20d0, 0x1004: 0x20d5, 0x1005: 0x20df, + 0x1006: 0x20e4, 0x1007: 0x20e9, 0x1008: 0x20ee, 0x1009: 0x20f3, 0x100a: 0x20f8, 0x100b: 0x20fd, + 0x100c: 0x2102, 0x100d: 0x2107, 0x100e: 0x2116, 0x100f: 0x2125, 0x1010: 0x212a, 0x1011: 0x212f, + 0x1012: 0x2134, 0x1013: 0x2139, 0x1014: 0x213e, 0x1015: 0x2148, 0x1016: 0x214d, 0x1017: 0x2152, + 0x1018: 0x2161, 0x1019: 0x2170, 0x101a: 0x2175, 0x101b: 0x4561, 0x101c: 0x4567, 0x101d: 0x459d, + 0x101e: 0x45f4, 0x101f: 0x45fb, 0x1020: 0x4602, 0x1021: 0x4609, 0x1022: 0x4610, 0x1023: 0x4617, + 0x1024: 0x26f6, 0x1025: 0x26fd, 0x1026: 0x2704, 0x1027: 0x270b, 0x1028: 0x2720, 0x1029: 0x2727, + 0x102a: 0x1ec8, 0x102b: 0x1ecd, 0x102c: 0x1ed2, 0x102d: 0x1ed7, 0x102e: 0x1ee1, 0x102f: 0x1ee6, + 0x1030: 0x1efa, 0x1031: 0x1eff, 0x1032: 0x1f04, 0x1033: 0x1f09, 0x1034: 0x1f13, 0x1035: 0x1f18, + 0x1036: 0x1f22, 0x1037: 0x1f27, 0x1038: 0x1f2c, 0x1039: 0x1f31, 0x103a: 0x1f3b, 0x103b: 0x1f40, + 0x103c: 0x206c, 0x103d: 0x2071, 0x103e: 0x2080, 0x103f: 0x2085, + // Block 0x41, offset 0x1040 + 0x1040: 0x208a, 0x1041: 0x209e, 0x1042: 0x20a3, 0x1043: 0x20a8, 0x1044: 0x20ad, 0x1045: 0x20c6, + 0x1046: 0x20d0, 0x1047: 0x20d5, 0x1048: 0x20da, 0x1049: 0x20ee, 0x104a: 0x210c, 0x104b: 0x2111, + 0x104c: 0x2116, 0x104d: 0x211b, 0x104e: 0x2125, 0x104f: 0x212a, 0x1050: 0x459d, 0x1051: 0x2157, + 0x1052: 0x215c, 0x1053: 0x2161, 0x1054: 0x2166, 0x1055: 0x2170, 0x1056: 0x2175, 0x1057: 0x26e1, + 0x1058: 0x26e8, 0x1059: 0x26ef, 0x105a: 0x2704, 0x105b: 0x2712, 0x105c: 0x1eb9, 0x105d: 0x1ebe, + 0x105e: 0x1ec3, 0x105f: 0x1ed2, 0x1060: 0x1edc, 0x1061: 0x1eeb, 0x1062: 0x1ef0, 0x1063: 0x1ef5, + 0x1064: 0x1f04, 0x1065: 0x1f0e, 0x1066: 0x1f2c, 0x1067: 0x1f45, 0x1068: 0x1f4a, 0x1069: 0x1f59, + 0x106a: 0x1f5e, 0x106b: 0x1f6d, 0x106c: 0x1f77, 0x106d: 0x1f86, 0x106e: 0x1f8b, 0x106f: 0x1f90, + 0x1070: 0x1f9a, 0x1071: 0x1fd6, 0x1072: 0x1fdb, 0x1073: 0x1fe5, 0x1074: 0x1ff4, 0x1075: 0x1ff9, + 0x1076: 0x1ffe, 0x1077: 0x2008, 0x1078: 0x2017, 0x1079: 0x202b, 0x107a: 0x2030, 0x107b: 0x2035, + 0x107c: 0x2044, 0x107d: 0x2049, 0x107e: 0x2058, 0x107f: 0x205d, + // Block 0x42, offset 0x1080 + 0x1080: 0x2062, 0x1081: 0x2067, 0x1082: 0x2076, 0x1083: 0x207b, 0x1084: 0x208f, 0x1085: 0x2094, + 0x1086: 0x2099, 0x1087: 0x209e, 0x1088: 0x20a3, 0x1089: 0x20b7, 0x108a: 0x20bc, 0x108b: 0x20c1, + 0x108c: 0x20c6, 0x108d: 0x20cb, 0x108e: 0x20df, 0x108f: 0x20e4, 0x1090: 0x20e9, 0x1091: 0x20ee, + 0x1092: 0x20fd, 0x1093: 0x2102, 0x1094: 0x2107, 0x1095: 0x2116, 0x1096: 0x2120, 0x1097: 0x212f, + 0x1098: 0x2134, 0x1099: 0x4591, 0x109a: 0x2148, 0x109b: 0x214d, 0x109c: 0x2152, 0x109d: 0x2161, + 0x109e: 0x216b, 0x109f: 0x2704, 0x10a0: 0x2712, 0x10a1: 0x1ed2, 0x10a2: 0x1edc, 0x10a3: 0x1f04, + 0x10a4: 0x1f0e, 0x10a5: 0x1f2c, 0x10a6: 0x1f36, 0x10a7: 0x1f9a, 0x10a8: 0x1f9f, 0x10a9: 0x1fc2, + 0x10aa: 0x1fc7, 0x10ab: 0x209e, 0x10ac: 0x20a3, 0x10ad: 0x20c6, 0x10ae: 0x2116, 0x10af: 0x2120, + 0x10b0: 0x2161, 0x10b1: 0x216b, 0x10b2: 0x4645, 0x10b3: 0x464d, 0x10b4: 0x4655, 0x10b5: 0x2021, + 0x10b6: 0x2026, 0x10b7: 0x203a, 0x10b8: 0x203f, 0x10b9: 0x204e, 0x10ba: 0x2053, 0x10bb: 0x1fa4, + 0x10bc: 0x1fa9, 0x10bd: 0x1fcc, 0x10be: 0x1fd1, 0x10bf: 0x1f63, + // Block 0x43, offset 0x10c0 + 0x10c0: 0x1f68, 0x10c1: 0x1f4f, 0x10c2: 0x1f54, 0x10c3: 0x1f7c, 0x10c4: 0x1f81, 0x10c5: 0x1fea, + 0x10c6: 0x1fef, 0x10c7: 0x200d, 0x10c8: 0x2012, 0x10c9: 0x1fae, 0x10ca: 0x1fb3, 0x10cb: 0x1fb8, + 0x10cc: 0x1fc2, 0x10cd: 0x1fbd, 0x10ce: 0x1f95, 0x10cf: 0x1fe0, 0x10d0: 0x2003, 0x10d1: 0x2021, + 0x10d2: 0x2026, 0x10d3: 0x203a, 0x10d4: 0x203f, 0x10d5: 0x204e, 0x10d6: 0x2053, 0x10d7: 0x1fa4, + 0x10d8: 0x1fa9, 0x10d9: 0x1fcc, 0x10da: 0x1fd1, 0x10db: 0x1f63, 0x10dc: 0x1f68, 0x10dd: 0x1f4f, + 0x10de: 0x1f54, 0x10df: 0x1f7c, 0x10e0: 0x1f81, 0x10e1: 0x1fea, 0x10e2: 0x1fef, 0x10e3: 0x200d, + 0x10e4: 0x2012, 0x10e5: 0x1fae, 0x10e6: 0x1fb3, 0x10e7: 0x1fb8, 0x10e8: 0x1fc2, 0x10e9: 0x1fbd, + 0x10ea: 0x1f95, 0x10eb: 0x1fe0, 0x10ec: 0x2003, 0x10ed: 0x1fae, 0x10ee: 0x1fb3, 0x10ef: 0x1fb8, + 0x10f0: 0x1fc2, 0x10f1: 0x1f9f, 0x10f2: 0x1fc7, 0x10f3: 0x201c, 0x10f4: 0x1f86, 0x10f5: 0x1f8b, + 0x10f6: 0x1f90, 0x10f7: 0x1fae, 0x10f8: 0x1fb3, 0x10f9: 0x1fb8, 0x10fa: 0x201c, 0x10fb: 0x202b, + 0x10fc: 0x4549, 0x10fd: 0x4549, + // Block 0x44, offset 0x1100 + 0x1110: 0x2441, 0x1111: 0x2456, + 0x1112: 0x2456, 0x1113: 0x245d, 0x1114: 0x2464, 0x1115: 0x2479, 0x1116: 0x2480, 0x1117: 0x2487, + 0x1118: 0x24aa, 0x1119: 0x24aa, 0x111a: 0x24cd, 0x111b: 0x24c6, 0x111c: 0x24e2, 0x111d: 0x24d4, + 0x111e: 0x24db, 0x111f: 0x24fe, 0x1120: 0x24fe, 0x1121: 0x24f7, 0x1122: 0x2505, 0x1123: 0x2505, + 0x1124: 0x252f, 0x1125: 0x252f, 0x1126: 0x254b, 0x1127: 0x2513, 0x1128: 0x2513, 0x1129: 0x250c, + 0x112a: 0x2521, 0x112b: 0x2521, 0x112c: 0x2528, 0x112d: 0x2528, 0x112e: 0x2552, 0x112f: 0x2560, + 0x1130: 0x2560, 0x1131: 0x2567, 0x1132: 0x2567, 0x1133: 0x256e, 0x1134: 0x2575, 0x1135: 0x257c, + 0x1136: 0x2583, 0x1137: 0x2583, 0x1138: 0x258a, 0x1139: 0x2598, 0x113a: 0x25a6, 0x113b: 0x259f, + 0x113c: 0x25ad, 0x113d: 0x25ad, 0x113e: 0x25c2, 0x113f: 0x25c9, + // Block 0x45, offset 0x1140 + 0x1140: 0x25fa, 0x1141: 0x2608, 0x1142: 0x2601, 0x1143: 0x25e5, 0x1144: 0x25e5, 0x1145: 0x260f, + 0x1146: 0x260f, 0x1147: 0x2616, 0x1148: 0x2616, 0x1149: 0x2640, 0x114a: 0x2647, 0x114b: 0x264e, + 0x114c: 0x2624, 0x114d: 0x2632, 0x114e: 0x2655, 0x114f: 0x265c, + 0x1152: 0x262b, 0x1153: 0x26b0, 0x1154: 0x26b7, 0x1155: 0x268d, 0x1156: 0x2694, 0x1157: 0x2678, + 0x1158: 0x2678, 0x1159: 0x267f, 0x115a: 0x26a9, 0x115b: 0x26a2, 0x115c: 0x26cc, 0x115d: 0x26cc, + 0x115e: 0x243a, 0x115f: 0x244f, 0x1160: 0x2448, 0x1161: 0x2472, 0x1162: 0x246b, 0x1163: 0x2495, + 0x1164: 0x248e, 0x1165: 0x24b8, 0x1166: 0x249c, 0x1167: 0x24b1, 0x1168: 0x24e9, 0x1169: 0x2536, + 0x116a: 0x251a, 0x116b: 0x2559, 0x116c: 0x25f3, 0x116d: 0x261d, 0x116e: 0x26c5, 0x116f: 0x26be, + 0x1170: 0x26d3, 0x1171: 0x266a, 0x1172: 0x25d0, 0x1173: 0x269b, 0x1174: 0x25c2, 0x1175: 0x25fa, + 0x1176: 0x2591, 0x1177: 0x25de, 0x1178: 0x2671, 0x1179: 0x2663, 0x117a: 0x25ec, 0x117b: 0x25d7, + 0x117c: 0x25ec, 0x117d: 0x2671, 0x117e: 0x24a3, 0x117f: 0x24bf, + // Block 0x46, offset 0x1180 + 0x1180: 0x2639, 0x1181: 0x25b4, 0x1182: 0x2433, 0x1183: 0x25d7, 0x1184: 0x257c, 0x1185: 0x254b, + 0x1186: 0x24f0, 0x1187: 0x2686, + 0x11b0: 0x2544, 0x11b1: 0x25bb, 0x11b2: 0x28f6, 0x11b3: 0x28ed, 0x11b4: 0x2923, 0x11b5: 0x2911, + 0x11b6: 0x28ff, 0x11b7: 0x291a, 0x11b8: 0x292c, 0x11b9: 0x253d, 0x11ba: 0x2db3, 0x11bb: 0x2c33, + 0x11bc: 0x2908, + // Block 0x47, offset 0x11c0 + 0x11d0: 0x0019, 0x11d1: 0x057e, + 0x11d2: 0x0582, 0x11d3: 0x0035, 0x11d4: 0x0037, 0x11d5: 0x0003, 0x11d6: 0x003f, 0x11d7: 0x05ba, + 0x11d8: 0x05be, 0x11d9: 0x1c8c, + 0x11e0: 0x8133, 0x11e1: 0x8133, 0x11e2: 0x8133, 0x11e3: 0x8133, + 0x11e4: 0x8133, 0x11e5: 0x8133, 0x11e6: 0x8133, 0x11e7: 0x812e, 0x11e8: 0x812e, 0x11e9: 0x812e, + 0x11ea: 0x812e, 0x11eb: 0x812e, 0x11ec: 0x812e, 0x11ed: 0x812e, 0x11ee: 0x8133, 0x11ef: 0x8133, + 0x11f0: 0x19a0, 0x11f1: 0x053a, 0x11f2: 0x0536, 0x11f3: 0x007f, 0x11f4: 0x007f, 0x11f5: 0x0011, + 0x11f6: 0x0013, 0x11f7: 0x00b7, 0x11f8: 0x00bb, 0x11f9: 0x05b2, 0x11fa: 0x05b6, 0x11fb: 0x05a6, + 0x11fc: 0x05aa, 0x11fd: 0x058e, 0x11fe: 0x0592, 0x11ff: 0x0586, + // Block 0x48, offset 0x1200 + 0x1200: 0x058a, 0x1201: 0x0596, 0x1202: 0x059a, 0x1203: 0x059e, 0x1204: 0x05a2, + 0x1207: 0x0077, 0x1208: 0x007b, 0x1209: 0x43aa, 0x120a: 0x43aa, 0x120b: 0x43aa, + 0x120c: 0x43aa, 0x120d: 0x007f, 0x120e: 0x007f, 0x120f: 0x007f, 0x1210: 0x0019, 0x1211: 0x057e, + 0x1212: 0x001d, 0x1214: 0x0037, 0x1215: 0x0035, 0x1216: 0x003f, 0x1217: 0x0003, + 0x1218: 0x053a, 0x1219: 0x0011, 0x121a: 0x0013, 0x121b: 0x00b7, 0x121c: 0x00bb, 0x121d: 0x05b2, + 0x121e: 0x05b6, 0x121f: 0x0007, 0x1220: 0x000d, 0x1221: 0x0015, 0x1222: 0x0017, 0x1223: 0x001b, + 0x1224: 0x0039, 0x1225: 0x003d, 0x1226: 0x003b, 0x1228: 0x0079, 0x1229: 0x0009, + 0x122a: 0x000b, 0x122b: 0x0041, + 0x1230: 0x43eb, 0x1231: 0x456d, 0x1232: 0x43f0, 0x1234: 0x43f5, + 0x1236: 0x43fa, 0x1237: 0x4573, 0x1238: 0x43ff, 0x1239: 0x4579, 0x123a: 0x4404, 0x123b: 0x457f, + 0x123c: 0x4409, 0x123d: 0x4585, 0x123e: 0x440e, 0x123f: 0x458b, + // Block 0x49, offset 0x1240 + 0x1240: 0x0329, 0x1241: 0x454f, 0x1242: 0x454f, 0x1243: 0x4555, 0x1244: 0x4555, 0x1245: 0x4597, + 0x1246: 0x4597, 0x1247: 0x455b, 0x1248: 0x455b, 0x1249: 0x45a3, 0x124a: 0x45a3, 0x124b: 0x45a3, + 0x124c: 0x45a3, 0x124d: 0x032c, 0x124e: 0x032c, 0x124f: 0x032f, 0x1250: 0x032f, 0x1251: 0x032f, + 0x1252: 0x032f, 0x1253: 0x0332, 0x1254: 0x0332, 0x1255: 0x0335, 0x1256: 0x0335, 0x1257: 0x0335, + 0x1258: 0x0335, 0x1259: 0x0338, 0x125a: 0x0338, 0x125b: 0x0338, 0x125c: 0x0338, 0x125d: 0x033b, + 0x125e: 0x033b, 0x125f: 0x033b, 0x1260: 0x033b, 0x1261: 0x033e, 0x1262: 0x033e, 0x1263: 0x033e, + 0x1264: 0x033e, 0x1265: 0x0341, 0x1266: 0x0341, 0x1267: 0x0341, 0x1268: 0x0341, 0x1269: 0x0344, + 0x126a: 0x0344, 0x126b: 0x0347, 0x126c: 0x0347, 0x126d: 0x034a, 0x126e: 0x034a, 0x126f: 0x034d, + 0x1270: 0x034d, 0x1271: 0x0350, 0x1272: 0x0350, 0x1273: 0x0350, 0x1274: 0x0350, 0x1275: 0x0353, + 0x1276: 0x0353, 0x1277: 0x0353, 0x1278: 0x0353, 0x1279: 0x0356, 0x127a: 0x0356, 0x127b: 0x0356, + 0x127c: 0x0356, 0x127d: 0x0359, 0x127e: 0x0359, 0x127f: 0x0359, + // Block 0x4a, offset 0x1280 + 0x1280: 0x0359, 0x1281: 0x035c, 0x1282: 0x035c, 0x1283: 0x035c, 0x1284: 0x035c, 0x1285: 0x035f, + 0x1286: 0x035f, 0x1287: 0x035f, 0x1288: 0x035f, 0x1289: 0x0362, 0x128a: 0x0362, 0x128b: 0x0362, + 0x128c: 0x0362, 0x128d: 0x0365, 0x128e: 0x0365, 0x128f: 0x0365, 0x1290: 0x0365, 0x1291: 0x0368, + 0x1292: 0x0368, 0x1293: 0x0368, 0x1294: 0x0368, 0x1295: 0x036b, 0x1296: 0x036b, 0x1297: 0x036b, + 0x1298: 0x036b, 0x1299: 0x036e, 0x129a: 0x036e, 0x129b: 0x036e, 0x129c: 0x036e, 0x129d: 0x0371, + 0x129e: 0x0371, 0x129f: 0x0371, 0x12a0: 0x0371, 0x12a1: 0x0374, 0x12a2: 0x0374, 0x12a3: 0x0374, + 0x12a4: 0x0374, 0x12a5: 0x0377, 0x12a6: 0x0377, 0x12a7: 0x0377, 0x12a8: 0x0377, 0x12a9: 0x037a, + 0x12aa: 0x037a, 0x12ab: 0x037a, 0x12ac: 0x037a, 0x12ad: 0x037d, 0x12ae: 0x037d, 0x12af: 0x0380, + 0x12b0: 0x0380, 0x12b1: 0x0383, 0x12b2: 0x0383, 0x12b3: 0x0383, 0x12b4: 0x0383, 0x12b5: 0x2f41, + 0x12b6: 0x2f41, 0x12b7: 0x2f49, 0x12b8: 0x2f49, 0x12b9: 0x2f51, 0x12ba: 0x2f51, 0x12bb: 0x20b2, + 0x12bc: 0x20b2, + // Block 0x4b, offset 0x12c0 + 0x12c0: 0x0081, 0x12c1: 0x0083, 0x12c2: 0x0085, 0x12c3: 0x0087, 0x12c4: 0x0089, 0x12c5: 0x008b, + 0x12c6: 0x008d, 0x12c7: 0x008f, 0x12c8: 0x0091, 0x12c9: 0x0093, 0x12ca: 0x0095, 0x12cb: 0x0097, + 0x12cc: 0x0099, 0x12cd: 0x009b, 0x12ce: 0x009d, 0x12cf: 0x009f, 0x12d0: 0x00a1, 0x12d1: 0x00a3, + 0x12d2: 0x00a5, 0x12d3: 0x00a7, 0x12d4: 0x00a9, 0x12d5: 0x00ab, 0x12d6: 0x00ad, 0x12d7: 0x00af, + 0x12d8: 0x00b1, 0x12d9: 0x00b3, 0x12da: 0x00b5, 0x12db: 0x00b7, 0x12dc: 0x00b9, 0x12dd: 0x00bb, + 0x12de: 0x00bd, 0x12df: 0x056e, 0x12e0: 0x0572, 0x12e1: 0x0582, 0x12e2: 0x0596, 0x12e3: 0x059a, + 0x12e4: 0x057e, 0x12e5: 0x06a6, 0x12e6: 0x069e, 0x12e7: 0x05c2, 0x12e8: 0x05ca, 0x12e9: 0x05d2, + 0x12ea: 0x05da, 0x12eb: 0x05e2, 0x12ec: 0x0666, 0x12ed: 0x066e, 0x12ee: 0x0676, 0x12ef: 0x061a, + 0x12f0: 0x06aa, 0x12f1: 0x05c6, 0x12f2: 0x05ce, 0x12f3: 0x05d6, 0x12f4: 0x05de, 0x12f5: 0x05e6, + 0x12f6: 0x05ea, 0x12f7: 0x05ee, 0x12f8: 0x05f2, 0x12f9: 0x05f6, 0x12fa: 0x05fa, 0x12fb: 0x05fe, + 0x12fc: 0x0602, 0x12fd: 0x0606, 0x12fe: 0x060a, 0x12ff: 0x060e, + // Block 0x4c, offset 0x1300 + 0x1300: 0x0612, 0x1301: 0x0616, 0x1302: 0x061e, 0x1303: 0x0622, 0x1304: 0x0626, 0x1305: 0x062a, + 0x1306: 0x062e, 0x1307: 0x0632, 0x1308: 0x0636, 0x1309: 0x063a, 0x130a: 0x063e, 0x130b: 0x0642, + 0x130c: 0x0646, 0x130d: 0x064a, 0x130e: 0x064e, 0x130f: 0x0652, 0x1310: 0x0656, 0x1311: 0x065a, + 0x1312: 0x065e, 0x1313: 0x0662, 0x1314: 0x066a, 0x1315: 0x0672, 0x1316: 0x067a, 0x1317: 0x067e, + 0x1318: 0x0682, 0x1319: 0x0686, 0x131a: 0x068a, 0x131b: 0x068e, 0x131c: 0x0692, 0x131d: 0x06a2, + 0x131e: 0x4bb9, 0x131f: 0x4bbf, 0x1320: 0x04b6, 0x1321: 0x0406, 0x1322: 0x040a, 0x1323: 0x4b7c, + 0x1324: 0x040e, 0x1325: 0x4b82, 0x1326: 0x4b88, 0x1327: 0x0412, 0x1328: 0x0416, 0x1329: 0x041a, + 0x132a: 0x4b8e, 0x132b: 0x4b94, 0x132c: 0x4b9a, 0x132d: 0x4ba0, 0x132e: 0x4ba6, 0x132f: 0x4bac, + 0x1330: 0x045a, 0x1331: 0x041e, 0x1332: 0x0422, 0x1333: 0x0426, 0x1334: 0x046e, 0x1335: 0x042a, + 0x1336: 0x042e, 0x1337: 0x0432, 0x1338: 0x0436, 0x1339: 0x043a, 0x133a: 0x043e, 0x133b: 0x0442, + 0x133c: 0x0446, 0x133d: 0x044a, 0x133e: 0x044e, + // Block 0x4d, offset 0x1340 + 0x1342: 0x4afe, 0x1343: 0x4b04, 0x1344: 0x4b0a, 0x1345: 0x4b10, + 0x1346: 0x4b16, 0x1347: 0x4b1c, 0x134a: 0x4b22, 0x134b: 0x4b28, + 0x134c: 0x4b2e, 0x134d: 0x4b34, 0x134e: 0x4b3a, 0x134f: 0x4b40, + 0x1352: 0x4b46, 0x1353: 0x4b4c, 0x1354: 0x4b52, 0x1355: 0x4b58, 0x1356: 0x4b5e, 0x1357: 0x4b64, + 0x135a: 0x4b6a, 0x135b: 0x4b70, 0x135c: 0x4b76, + 0x1360: 0x00bf, 0x1361: 0x00c2, 0x1362: 0x00cb, 0x1363: 0x43a5, + 0x1364: 0x00c8, 0x1365: 0x00c5, 0x1366: 0x053e, 0x1368: 0x0562, 0x1369: 0x0542, + 0x136a: 0x0546, 0x136b: 0x054a, 0x136c: 0x054e, 0x136d: 0x0566, 0x136e: 0x056a, + // Block 0x4e, offset 0x1380 + 0x1381: 0x01f1, 0x1382: 0x01f4, 0x1383: 0x00d4, 0x1384: 0x01be, 0x1385: 0x010d, + 0x1387: 0x01d3, 0x1388: 0x174e, 0x1389: 0x01d9, 0x138a: 0x01d6, 0x138b: 0x0116, + 0x138c: 0x0119, 0x138d: 0x0526, 0x138e: 0x011c, 0x138f: 0x0128, 0x1390: 0x01e5, 0x1391: 0x013a, + 0x1392: 0x0134, 0x1393: 0x012e, 0x1394: 0x01c1, 0x1395: 0x00e0, 0x1396: 0x01c4, 0x1397: 0x0143, + 0x1398: 0x0194, 0x1399: 0x01e8, 0x139a: 0x01eb, 0x139b: 0x0152, 0x139c: 0x1756, 0x139d: 0x1742, + 0x139e: 0x0158, 0x139f: 0x175b, 0x13a0: 0x01a9, 0x13a1: 0x1760, 0x13a2: 0x00da, 0x13a3: 0x0170, + 0x13a4: 0x0173, 0x13a5: 0x00a3, 0x13a6: 0x017c, 0x13a7: 0x1765, 0x13a8: 0x0182, 0x13a9: 0x0185, + 0x13aa: 0x0188, 0x13ab: 0x01e2, 0x13ac: 0x01dc, 0x13ad: 0x1752, 0x13ae: 0x01df, 0x13af: 0x0197, + 0x13b0: 0x0576, 0x13b2: 0x01ac, 0x13b3: 0x01cd, 0x13b4: 0x01d0, 0x13b5: 0x01bb, + 0x13b6: 0x00f5, 0x13b7: 0x00f8, 0x13b8: 0x00fb, 0x13b9: 0x176a, 0x13ba: 0x176f, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x0063, 0x13c1: 0x0065, 0x13c2: 0x0067, 0x13c3: 0x0069, 0x13c4: 0x006b, 0x13c5: 0x006d, + 0x13c6: 0x006f, 0x13c7: 0x0071, 0x13c8: 0x0073, 0x13c9: 0x0075, 0x13ca: 0x0083, 0x13cb: 0x0085, + 0x13cc: 0x0087, 0x13cd: 0x0089, 0x13ce: 0x008b, 0x13cf: 0x008d, 0x13d0: 0x008f, 0x13d1: 0x0091, + 0x13d2: 0x0093, 0x13d3: 0x0095, 0x13d4: 0x0097, 0x13d5: 0x0099, 0x13d6: 0x009b, 0x13d7: 0x009d, + 0x13d8: 0x009f, 0x13d9: 0x00a1, 0x13da: 0x00a3, 0x13db: 0x00a5, 0x13dc: 0x00a7, 0x13dd: 0x00a9, + 0x13de: 0x00ab, 0x13df: 0x00ad, 0x13e0: 0x00af, 0x13e1: 0x00b1, 0x13e2: 0x00b3, 0x13e3: 0x00b5, + 0x13e4: 0x00e3, 0x13e5: 0x0101, 0x13e8: 0x01f7, 0x13e9: 0x01fa, + 0x13ea: 0x01fd, 0x13eb: 0x0200, 0x13ec: 0x0203, 0x13ed: 0x0206, 0x13ee: 0x0209, 0x13ef: 0x020c, + 0x13f0: 0x020f, 0x13f1: 0x0212, 0x13f2: 0x0215, 0x13f3: 0x0218, 0x13f4: 0x021b, 0x13f5: 0x021e, + 0x13f6: 0x0221, 0x13f7: 0x0224, 0x13f8: 0x0227, 0x13f9: 0x020c, 0x13fa: 0x022a, 0x13fb: 0x022d, + 0x13fc: 0x0230, 0x13fd: 0x0233, 0x13fe: 0x0236, 0x13ff: 0x0239, + // Block 0x50, offset 0x1400 + 0x1400: 0x0281, 0x1401: 0x0284, 0x1402: 0x0287, 0x1403: 0x0552, 0x1404: 0x024b, 0x1405: 0x0254, + 0x1406: 0x025a, 0x1407: 0x027e, 0x1408: 0x026f, 0x1409: 0x026c, 0x140a: 0x028a, 0x140b: 0x028d, + 0x140e: 0x0021, 0x140f: 0x0023, 0x1410: 0x0025, 0x1411: 0x0027, + 0x1412: 0x0029, 0x1413: 0x002b, 0x1414: 0x002d, 0x1415: 0x002f, 0x1416: 0x0031, 0x1417: 0x0033, + 0x1418: 0x0021, 0x1419: 0x0023, 0x141a: 0x0025, 0x141b: 0x0027, 0x141c: 0x0029, 0x141d: 0x002b, + 0x141e: 0x002d, 0x141f: 0x002f, 0x1420: 0x0031, 0x1421: 0x0033, 0x1422: 0x0021, 0x1423: 0x0023, + 0x1424: 0x0025, 0x1425: 0x0027, 0x1426: 0x0029, 0x1427: 0x002b, 0x1428: 0x002d, 0x1429: 0x002f, + 0x142a: 0x0031, 0x142b: 0x0033, 0x142c: 0x0021, 0x142d: 0x0023, 0x142e: 0x0025, 0x142f: 0x0027, + 0x1430: 0x0029, 0x1431: 0x002b, 0x1432: 0x002d, 0x1433: 0x002f, 0x1434: 0x0031, 0x1435: 0x0033, + 0x1436: 0x0021, 0x1437: 0x0023, 0x1438: 0x0025, 0x1439: 0x0027, 0x143a: 0x0029, 0x143b: 0x002b, + 0x143c: 0x002d, 0x143d: 0x002f, 0x143e: 0x0031, 0x143f: 0x0033, + // Block 0x51, offset 0x1440 + 0x1440: 0x8133, 0x1441: 0x8133, 0x1442: 0x8133, 0x1443: 0x8133, 0x1444: 0x8133, 0x1445: 0x8133, + 0x1446: 0x8133, 0x1448: 0x8133, 0x1449: 0x8133, 0x144a: 0x8133, 0x144b: 0x8133, + 0x144c: 0x8133, 0x144d: 0x8133, 0x144e: 0x8133, 0x144f: 0x8133, 0x1450: 0x8133, 0x1451: 0x8133, + 0x1452: 0x8133, 0x1453: 0x8133, 0x1454: 0x8133, 0x1455: 0x8133, 0x1456: 0x8133, 0x1457: 0x8133, + 0x1458: 0x8133, 0x145b: 0x8133, 0x145c: 0x8133, 0x145d: 0x8133, + 0x145e: 0x8133, 0x145f: 0x8133, 0x1460: 0x8133, 0x1461: 0x8133, 0x1463: 0x8133, + 0x1464: 0x8133, 0x1466: 0x8133, 0x1467: 0x8133, 0x1468: 0x8133, 0x1469: 0x8133, + 0x146a: 0x8133, + 0x1470: 0x0290, 0x1471: 0x0293, 0x1472: 0x0296, 0x1473: 0x0299, 0x1474: 0x029c, 0x1475: 0x029f, + 0x1476: 0x02a2, 0x1477: 0x02a5, 0x1478: 0x02a8, 0x1479: 0x02ab, 0x147a: 0x02ae, 0x147b: 0x02b1, + 0x147c: 0x02b7, 0x147d: 0x02ba, 0x147e: 0x02bd, 0x147f: 0x02c0, + // Block 0x52, offset 0x1480 + 0x1480: 0x02c3, 0x1481: 0x02c6, 0x1482: 0x02c9, 0x1483: 0x02cc, 0x1484: 0x02cf, 0x1485: 0x02d2, + 0x1486: 0x02d5, 0x1487: 0x02db, 0x1488: 0x02e1, 0x1489: 0x02e4, 0x148a: 0x1736, 0x148b: 0x0302, + 0x148c: 0x02ea, 0x148d: 0x02ed, 0x148e: 0x0305, 0x148f: 0x02f9, 0x1490: 0x02ff, 0x1491: 0x0290, + 0x1492: 0x0293, 0x1493: 0x0296, 0x1494: 0x0299, 0x1495: 0x029c, 0x1496: 0x029f, 0x1497: 0x02a2, + 0x1498: 0x02a5, 0x1499: 0x02a8, 0x149a: 0x02ab, 0x149b: 0x02ae, 0x149c: 0x02b7, 0x149d: 0x02ba, + 0x149e: 0x02c0, 0x149f: 0x02c6, 0x14a0: 0x02c9, 0x14a1: 0x02cc, 0x14a2: 0x02cf, 0x14a3: 0x02d2, + 0x14a4: 0x02d5, 0x14a5: 0x02d8, 0x14a6: 0x02db, 0x14a7: 0x02f3, 0x14a8: 0x02ea, 0x14a9: 0x02e7, + 0x14aa: 0x02f0, 0x14ab: 0x02f6, 0x14ac: 0x1732, 0x14ad: 0x02fc, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x032c, 0x14c1: 0x032f, 0x14c2: 0x033b, 0x14c3: 0x0344, 0x14c5: 0x037d, + 0x14c6: 0x034d, 0x14c7: 0x033e, 0x14c8: 0x035c, 0x14c9: 0x0383, 0x14ca: 0x036e, 0x14cb: 0x0371, + 0x14cc: 0x0374, 0x14cd: 0x0377, 0x14ce: 0x0350, 0x14cf: 0x0362, 0x14d0: 0x0368, 0x14d1: 0x0356, + 0x14d2: 0x036b, 0x14d3: 0x034a, 0x14d4: 0x0353, 0x14d5: 0x0335, 0x14d6: 0x0338, 0x14d7: 0x0341, + 0x14d8: 0x0347, 0x14d9: 0x0359, 0x14da: 0x035f, 0x14db: 0x0365, 0x14dc: 0x0386, 0x14dd: 0x03d7, + 0x14de: 0x03bf, 0x14df: 0x0389, 0x14e1: 0x032f, 0x14e2: 0x033b, + 0x14e4: 0x037a, 0x14e7: 0x033e, 0x14e9: 0x0383, + 0x14ea: 0x036e, 0x14eb: 0x0371, 0x14ec: 0x0374, 0x14ed: 0x0377, 0x14ee: 0x0350, 0x14ef: 0x0362, + 0x14f0: 0x0368, 0x14f1: 0x0356, 0x14f2: 0x036b, 0x14f4: 0x0353, 0x14f5: 0x0335, + 0x14f6: 0x0338, 0x14f7: 0x0341, 0x14f9: 0x0359, 0x14fb: 0x0365, + // Block 0x54, offset 0x1500 + 0x1502: 0x033b, + 0x1507: 0x033e, 0x1509: 0x0383, 0x150b: 0x0371, + 0x150d: 0x0377, 0x150e: 0x0350, 0x150f: 0x0362, 0x1511: 0x0356, + 0x1512: 0x036b, 0x1514: 0x0353, 0x1517: 0x0341, + 0x1519: 0x0359, 0x151b: 0x0365, 0x151d: 0x03d7, + 0x151f: 0x0389, 0x1521: 0x032f, 0x1522: 0x033b, + 0x1524: 0x037a, 0x1527: 0x033e, 0x1528: 0x035c, 0x1529: 0x0383, + 0x152a: 0x036e, 0x152c: 0x0374, 0x152d: 0x0377, 0x152e: 0x0350, 0x152f: 0x0362, + 0x1530: 0x0368, 0x1531: 0x0356, 0x1532: 0x036b, 0x1534: 0x0353, 0x1535: 0x0335, + 0x1536: 0x0338, 0x1537: 0x0341, 0x1539: 0x0359, 0x153a: 0x035f, 0x153b: 0x0365, + 0x153c: 0x0386, 0x153e: 0x03bf, + // Block 0x55, offset 0x1540 + 0x1540: 0x032c, 0x1541: 0x032f, 0x1542: 0x033b, 0x1543: 0x0344, 0x1544: 0x037a, 0x1545: 0x037d, + 0x1546: 0x034d, 0x1547: 0x033e, 0x1548: 0x035c, 0x1549: 0x0383, 0x154b: 0x0371, + 0x154c: 0x0374, 0x154d: 0x0377, 0x154e: 0x0350, 0x154f: 0x0362, 0x1550: 0x0368, 0x1551: 0x0356, + 0x1552: 0x036b, 0x1553: 0x034a, 0x1554: 0x0353, 0x1555: 0x0335, 0x1556: 0x0338, 0x1557: 0x0341, + 0x1558: 0x0347, 0x1559: 0x0359, 0x155a: 0x035f, 0x155b: 0x0365, + 0x1561: 0x032f, 0x1562: 0x033b, 0x1563: 0x0344, + 0x1565: 0x037d, 0x1566: 0x034d, 0x1567: 0x033e, 0x1568: 0x035c, 0x1569: 0x0383, + 0x156b: 0x0371, 0x156c: 0x0374, 0x156d: 0x0377, 0x156e: 0x0350, 0x156f: 0x0362, + 0x1570: 0x0368, 0x1571: 0x0356, 0x1572: 0x036b, 0x1573: 0x034a, 0x1574: 0x0353, 0x1575: 0x0335, + 0x1576: 0x0338, 0x1577: 0x0341, 0x1578: 0x0347, 0x1579: 0x0359, 0x157a: 0x035f, 0x157b: 0x0365, + // Block 0x56, offset 0x1580 + 0x1580: 0x19a6, 0x1581: 0x19a3, 0x1582: 0x19a9, 0x1583: 0x19cd, 0x1584: 0x19f1, 0x1585: 0x1a15, + 0x1586: 0x1a39, 0x1587: 0x1a42, 0x1588: 0x1a48, 0x1589: 0x1a4e, 0x158a: 0x1a54, + 0x1590: 0x1bbc, 0x1591: 0x1bc0, + 0x1592: 0x1bc4, 0x1593: 0x1bc8, 0x1594: 0x1bcc, 0x1595: 0x1bd0, 0x1596: 0x1bd4, 0x1597: 0x1bd8, + 0x1598: 0x1bdc, 0x1599: 0x1be0, 0x159a: 0x1be4, 0x159b: 0x1be8, 0x159c: 0x1bec, 0x159d: 0x1bf0, + 0x159e: 0x1bf4, 0x159f: 0x1bf8, 0x15a0: 0x1bfc, 0x15a1: 0x1c00, 0x15a2: 0x1c04, 0x15a3: 0x1c08, + 0x15a4: 0x1c0c, 0x15a5: 0x1c10, 0x15a6: 0x1c14, 0x15a7: 0x1c18, 0x15a8: 0x1c1c, 0x15a9: 0x1c20, + 0x15aa: 0x2855, 0x15ab: 0x0047, 0x15ac: 0x0065, 0x15ad: 0x1a69, 0x15ae: 0x1ae1, + 0x15b0: 0x0043, 0x15b1: 0x0045, 0x15b2: 0x0047, 0x15b3: 0x0049, 0x15b4: 0x004b, 0x15b5: 0x004d, + 0x15b6: 0x004f, 0x15b7: 0x0051, 0x15b8: 0x0053, 0x15b9: 0x0055, 0x15ba: 0x0057, 0x15bb: 0x0059, + 0x15bc: 0x005b, 0x15bd: 0x005d, 0x15be: 0x005f, 0x15bf: 0x0061, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x27dd, 0x15c1: 0x27f2, 0x15c2: 0x05fe, + 0x15d0: 0x0d0a, 0x15d1: 0x0b42, + 0x15d2: 0x09ce, 0x15d3: 0x4705, 0x15d4: 0x0816, 0x15d5: 0x0aea, 0x15d6: 0x142a, 0x15d7: 0x0afa, + 0x15d8: 0x0822, 0x15d9: 0x0dd2, 0x15da: 0x0faa, 0x15db: 0x0daa, 0x15dc: 0x0922, 0x15dd: 0x0c66, + 0x15de: 0x08ba, 0x15df: 0x0db2, 0x15e0: 0x090e, 0x15e1: 0x1212, 0x15e2: 0x107e, 0x15e3: 0x1486, + 0x15e4: 0x0ace, 0x15e5: 0x0a06, 0x15e6: 0x0f5e, 0x15e7: 0x0d16, 0x15e8: 0x0d42, 0x15e9: 0x07ba, + 0x15ea: 0x07c6, 0x15eb: 0x1506, 0x15ec: 0x0bd6, 0x15ed: 0x07e2, 0x15ee: 0x09ea, 0x15ef: 0x0d36, + 0x15f0: 0x14ae, 0x15f1: 0x0d0e, 0x15f2: 0x116a, 0x15f3: 0x11a6, 0x15f4: 0x09f2, 0x15f5: 0x0f3e, + 0x15f6: 0x0e06, 0x15f7: 0x0e02, 0x15f8: 0x1092, 0x15f9: 0x0926, 0x15fa: 0x0a52, 0x15fb: 0x153e, + // Block 0x58, offset 0x1600 + 0x1600: 0x07f6, 0x1601: 0x07ee, 0x1602: 0x07fe, 0x1603: 0x1774, 0x1604: 0x0842, 0x1605: 0x0852, + 0x1606: 0x0856, 0x1607: 0x085e, 0x1608: 0x0866, 0x1609: 0x086a, 0x160a: 0x0876, 0x160b: 0x086e, + 0x160c: 0x06ae, 0x160d: 0x1788, 0x160e: 0x088a, 0x160f: 0x088e, 0x1610: 0x0892, 0x1611: 0x08ae, + 0x1612: 0x1779, 0x1613: 0x06b2, 0x1614: 0x089a, 0x1615: 0x08ba, 0x1616: 0x1783, 0x1617: 0x08ca, + 0x1618: 0x08d2, 0x1619: 0x0832, 0x161a: 0x08da, 0x161b: 0x08de, 0x161c: 0x195e, 0x161d: 0x08fa, + 0x161e: 0x0902, 0x161f: 0x06ba, 0x1620: 0x091a, 0x1621: 0x091e, 0x1622: 0x0926, 0x1623: 0x092a, + 0x1624: 0x06be, 0x1625: 0x0942, 0x1626: 0x0946, 0x1627: 0x0952, 0x1628: 0x095e, 0x1629: 0x0962, + 0x162a: 0x0966, 0x162b: 0x096e, 0x162c: 0x098e, 0x162d: 0x0992, 0x162e: 0x099a, 0x162f: 0x09aa, + 0x1630: 0x09b2, 0x1631: 0x09b6, 0x1632: 0x09b6, 0x1633: 0x09b6, 0x1634: 0x1797, 0x1635: 0x0f8e, + 0x1636: 0x09ca, 0x1637: 0x09d2, 0x1638: 0x179c, 0x1639: 0x09de, 0x163a: 0x09e6, 0x163b: 0x09ee, + 0x163c: 0x0a16, 0x163d: 0x0a02, 0x163e: 0x0a0e, 0x163f: 0x0a12, + // Block 0x59, offset 0x1640 + 0x1640: 0x0a1a, 0x1641: 0x0a22, 0x1642: 0x0a26, 0x1643: 0x0a2e, 0x1644: 0x0a36, 0x1645: 0x0a3a, + 0x1646: 0x0a3a, 0x1647: 0x0a42, 0x1648: 0x0a4a, 0x1649: 0x0a4e, 0x164a: 0x0a5a, 0x164b: 0x0a7e, + 0x164c: 0x0a62, 0x164d: 0x0a82, 0x164e: 0x0a66, 0x164f: 0x0a6e, 0x1650: 0x0906, 0x1651: 0x0aca, + 0x1652: 0x0a92, 0x1653: 0x0a96, 0x1654: 0x0a9a, 0x1655: 0x0a8e, 0x1656: 0x0aa2, 0x1657: 0x0a9e, + 0x1658: 0x0ab6, 0x1659: 0x17a1, 0x165a: 0x0ad2, 0x165b: 0x0ad6, 0x165c: 0x0ade, 0x165d: 0x0aea, + 0x165e: 0x0af2, 0x165f: 0x0b0e, 0x1660: 0x17a6, 0x1661: 0x17ab, 0x1662: 0x0b1a, 0x1663: 0x0b1e, + 0x1664: 0x0b22, 0x1665: 0x0b16, 0x1666: 0x0b2a, 0x1667: 0x06c2, 0x1668: 0x06c6, 0x1669: 0x0b32, + 0x166a: 0x0b3a, 0x166b: 0x0b3a, 0x166c: 0x17b0, 0x166d: 0x0b56, 0x166e: 0x0b5a, 0x166f: 0x0b5e, + 0x1670: 0x0b66, 0x1671: 0x17b5, 0x1672: 0x0b6e, 0x1673: 0x0b72, 0x1674: 0x0c4a, 0x1675: 0x0b7a, + 0x1676: 0x06ca, 0x1677: 0x0b86, 0x1678: 0x0b96, 0x1679: 0x0ba2, 0x167a: 0x0b9e, 0x167b: 0x17bf, + 0x167c: 0x0baa, 0x167d: 0x17c4, 0x167e: 0x0bb6, 0x167f: 0x0bb2, + // Block 0x5a, offset 0x1680 + 0x1680: 0x0bba, 0x1681: 0x0bca, 0x1682: 0x0bce, 0x1683: 0x06ce, 0x1684: 0x0bde, 0x1685: 0x0be6, + 0x1686: 0x0bea, 0x1687: 0x0bee, 0x1688: 0x06d2, 0x1689: 0x17c9, 0x168a: 0x06d6, 0x168b: 0x0c0a, + 0x168c: 0x0c0e, 0x168d: 0x0c12, 0x168e: 0x0c1a, 0x168f: 0x1990, 0x1690: 0x0c32, 0x1691: 0x17d3, + 0x1692: 0x17d3, 0x1693: 0x12d2, 0x1694: 0x0c42, 0x1695: 0x0c42, 0x1696: 0x06da, 0x1697: 0x17f6, + 0x1698: 0x18c8, 0x1699: 0x0c52, 0x169a: 0x0c5a, 0x169b: 0x06de, 0x169c: 0x0c6e, 0x169d: 0x0c7e, + 0x169e: 0x0c82, 0x169f: 0x0c8a, 0x16a0: 0x0c9a, 0x16a1: 0x06e6, 0x16a2: 0x06e2, 0x16a3: 0x0c9e, + 0x16a4: 0x17d8, 0x16a5: 0x0ca2, 0x16a6: 0x0cb6, 0x16a7: 0x0cba, 0x16a8: 0x0cbe, 0x16a9: 0x0cba, + 0x16aa: 0x0cca, 0x16ab: 0x0cce, 0x16ac: 0x0cde, 0x16ad: 0x0cd6, 0x16ae: 0x0cda, 0x16af: 0x0ce2, + 0x16b0: 0x0ce6, 0x16b1: 0x0cea, 0x16b2: 0x0cf6, 0x16b3: 0x0cfa, 0x16b4: 0x0d12, 0x16b5: 0x0d1a, + 0x16b6: 0x0d2a, 0x16b7: 0x0d3e, 0x16b8: 0x17e7, 0x16b9: 0x0d3a, 0x16ba: 0x0d2e, 0x16bb: 0x0d46, + 0x16bc: 0x0d4e, 0x16bd: 0x0d62, 0x16be: 0x17ec, 0x16bf: 0x0d6a, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x0d5e, 0x16c1: 0x0d56, 0x16c2: 0x06ea, 0x16c3: 0x0d72, 0x16c4: 0x0d7a, 0x16c5: 0x0d82, + 0x16c6: 0x0d76, 0x16c7: 0x06ee, 0x16c8: 0x0d92, 0x16c9: 0x0d9a, 0x16ca: 0x17f1, 0x16cb: 0x0dc6, + 0x16cc: 0x0dfa, 0x16cd: 0x0dd6, 0x16ce: 0x06fa, 0x16cf: 0x0de2, 0x16d0: 0x06f6, 0x16d1: 0x06f2, + 0x16d2: 0x08be, 0x16d3: 0x08c2, 0x16d4: 0x0dfe, 0x16d5: 0x0de6, 0x16d6: 0x12a6, 0x16d7: 0x075e, + 0x16d8: 0x0e0a, 0x16d9: 0x0e0e, 0x16da: 0x0e12, 0x16db: 0x0e26, 0x16dc: 0x0e1e, 0x16dd: 0x180a, + 0x16de: 0x06fe, 0x16df: 0x0e3a, 0x16e0: 0x0e2e, 0x16e1: 0x0e4a, 0x16e2: 0x0e52, 0x16e3: 0x1814, + 0x16e4: 0x0e56, 0x16e5: 0x0e42, 0x16e6: 0x0e5e, 0x16e7: 0x0702, 0x16e8: 0x0e62, 0x16e9: 0x0e66, + 0x16ea: 0x0e6a, 0x16eb: 0x0e76, 0x16ec: 0x1819, 0x16ed: 0x0e7e, 0x16ee: 0x0706, 0x16ef: 0x0e8a, + 0x16f0: 0x181e, 0x16f1: 0x0e8e, 0x16f2: 0x070a, 0x16f3: 0x0e9a, 0x16f4: 0x0ea6, 0x16f5: 0x0eb2, + 0x16f6: 0x0eb6, 0x16f7: 0x1823, 0x16f8: 0x17ba, 0x16f9: 0x1828, 0x16fa: 0x0ed6, 0x16fb: 0x182d, + 0x16fc: 0x0ee2, 0x16fd: 0x0eea, 0x16fe: 0x0eda, 0x16ff: 0x0ef6, + // Block 0x5c, offset 0x1700 + 0x1700: 0x0f06, 0x1701: 0x0f16, 0x1702: 0x0f0a, 0x1703: 0x0f0e, 0x1704: 0x0f1a, 0x1705: 0x0f1e, + 0x1706: 0x1832, 0x1707: 0x0f02, 0x1708: 0x0f36, 0x1709: 0x0f3a, 0x170a: 0x070e, 0x170b: 0x0f4e, + 0x170c: 0x0f4a, 0x170d: 0x1837, 0x170e: 0x0f2e, 0x170f: 0x0f6a, 0x1710: 0x183c, 0x1711: 0x1841, + 0x1712: 0x0f6e, 0x1713: 0x0f82, 0x1714: 0x0f7e, 0x1715: 0x0f7a, 0x1716: 0x0712, 0x1717: 0x0f86, + 0x1718: 0x0f96, 0x1719: 0x0f92, 0x171a: 0x0f9e, 0x171b: 0x177e, 0x171c: 0x0fae, 0x171d: 0x1846, + 0x171e: 0x0fba, 0x171f: 0x1850, 0x1720: 0x0fce, 0x1721: 0x0fda, 0x1722: 0x0fee, 0x1723: 0x1855, + 0x1724: 0x1002, 0x1725: 0x1006, 0x1726: 0x185a, 0x1727: 0x185f, 0x1728: 0x1022, 0x1729: 0x1032, + 0x172a: 0x0716, 0x172b: 0x1036, 0x172c: 0x071a, 0x172d: 0x071a, 0x172e: 0x104e, 0x172f: 0x1052, + 0x1730: 0x105a, 0x1731: 0x105e, 0x1732: 0x106a, 0x1733: 0x071e, 0x1734: 0x1082, 0x1735: 0x1864, + 0x1736: 0x109e, 0x1737: 0x1869, 0x1738: 0x10aa, 0x1739: 0x17ce, 0x173a: 0x10ba, 0x173b: 0x186e, + 0x173c: 0x1873, 0x173d: 0x1878, 0x173e: 0x0722, 0x173f: 0x0726, + // Block 0x5d, offset 0x1740 + 0x1740: 0x10f2, 0x1741: 0x1882, 0x1742: 0x187d, 0x1743: 0x1887, 0x1744: 0x188c, 0x1745: 0x10fa, + 0x1746: 0x10fe, 0x1747: 0x10fe, 0x1748: 0x1106, 0x1749: 0x072e, 0x174a: 0x110a, 0x174b: 0x0732, + 0x174c: 0x0736, 0x174d: 0x1896, 0x174e: 0x111e, 0x174f: 0x1126, 0x1750: 0x1132, 0x1751: 0x073a, + 0x1752: 0x189b, 0x1753: 0x1156, 0x1754: 0x18a0, 0x1755: 0x18a5, 0x1756: 0x1176, 0x1757: 0x118e, + 0x1758: 0x073e, 0x1759: 0x1196, 0x175a: 0x119a, 0x175b: 0x119e, 0x175c: 0x18aa, 0x175d: 0x18af, + 0x175e: 0x18af, 0x175f: 0x11b6, 0x1760: 0x0742, 0x1761: 0x18b4, 0x1762: 0x11ca, 0x1763: 0x11ce, + 0x1764: 0x0746, 0x1765: 0x18b9, 0x1766: 0x11ea, 0x1767: 0x074a, 0x1768: 0x11fa, 0x1769: 0x11f2, + 0x176a: 0x1202, 0x176b: 0x18c3, 0x176c: 0x121a, 0x176d: 0x074e, 0x176e: 0x1226, 0x176f: 0x122e, + 0x1770: 0x123e, 0x1771: 0x0752, 0x1772: 0x18cd, 0x1773: 0x18d2, 0x1774: 0x0756, 0x1775: 0x18d7, + 0x1776: 0x1256, 0x1777: 0x18dc, 0x1778: 0x1262, 0x1779: 0x126e, 0x177a: 0x1276, 0x177b: 0x18e1, + 0x177c: 0x18e6, 0x177d: 0x128a, 0x177e: 0x18eb, 0x177f: 0x1292, + // Block 0x5e, offset 0x1780 + 0x1780: 0x17fb, 0x1781: 0x075a, 0x1782: 0x12aa, 0x1783: 0x12ae, 0x1784: 0x0762, 0x1785: 0x12b2, + 0x1786: 0x0b2e, 0x1787: 0x18f0, 0x1788: 0x18f5, 0x1789: 0x1800, 0x178a: 0x1805, 0x178b: 0x12d2, + 0x178c: 0x12d6, 0x178d: 0x14ee, 0x178e: 0x0766, 0x178f: 0x1302, 0x1790: 0x12fe, 0x1791: 0x1306, + 0x1792: 0x093a, 0x1793: 0x130a, 0x1794: 0x130e, 0x1795: 0x1312, 0x1796: 0x131a, 0x1797: 0x18fa, + 0x1798: 0x1316, 0x1799: 0x131e, 0x179a: 0x1332, 0x179b: 0x1336, 0x179c: 0x1322, 0x179d: 0x133a, + 0x179e: 0x134e, 0x179f: 0x1362, 0x17a0: 0x132e, 0x17a1: 0x1342, 0x17a2: 0x1346, 0x17a3: 0x134a, + 0x17a4: 0x18ff, 0x17a5: 0x1909, 0x17a6: 0x1904, 0x17a7: 0x076a, 0x17a8: 0x136a, 0x17a9: 0x136e, + 0x17aa: 0x1376, 0x17ab: 0x191d, 0x17ac: 0x137a, 0x17ad: 0x190e, 0x17ae: 0x076e, 0x17af: 0x0772, + 0x17b0: 0x1913, 0x17b1: 0x1918, 0x17b2: 0x0776, 0x17b3: 0x139a, 0x17b4: 0x139e, 0x17b5: 0x13a2, + 0x17b6: 0x13a6, 0x17b7: 0x13b2, 0x17b8: 0x13ae, 0x17b9: 0x13ba, 0x17ba: 0x13b6, 0x17bb: 0x13c6, + 0x17bc: 0x13be, 0x17bd: 0x13c2, 0x17be: 0x13ca, 0x17bf: 0x077a, + // Block 0x5f, offset 0x17c0 + 0x17c0: 0x13d2, 0x17c1: 0x13d6, 0x17c2: 0x077e, 0x17c3: 0x13e6, 0x17c4: 0x13ea, 0x17c5: 0x1922, + 0x17c6: 0x13f6, 0x17c7: 0x13fa, 0x17c8: 0x0782, 0x17c9: 0x1406, 0x17ca: 0x06b6, 0x17cb: 0x1927, + 0x17cc: 0x192c, 0x17cd: 0x0786, 0x17ce: 0x078a, 0x17cf: 0x1432, 0x17d0: 0x144a, 0x17d1: 0x1466, + 0x17d2: 0x1476, 0x17d3: 0x1931, 0x17d4: 0x148a, 0x17d5: 0x148e, 0x17d6: 0x14a6, 0x17d7: 0x14b2, + 0x17d8: 0x193b, 0x17d9: 0x178d, 0x17da: 0x14be, 0x17db: 0x14ba, 0x17dc: 0x14c6, 0x17dd: 0x1792, + 0x17de: 0x14d2, 0x17df: 0x14de, 0x17e0: 0x1940, 0x17e1: 0x1945, 0x17e2: 0x151e, 0x17e3: 0x152a, + 0x17e4: 0x1532, 0x17e5: 0x194a, 0x17e6: 0x1536, 0x17e7: 0x1562, 0x17e8: 0x156e, 0x17e9: 0x1572, + 0x17ea: 0x156a, 0x17eb: 0x157e, 0x17ec: 0x1582, 0x17ed: 0x194f, 0x17ee: 0x158e, 0x17ef: 0x078e, + 0x17f0: 0x1596, 0x17f1: 0x1954, 0x17f2: 0x0792, 0x17f3: 0x15ce, 0x17f4: 0x0bbe, 0x17f5: 0x15e6, + 0x17f6: 0x1959, 0x17f7: 0x1963, 0x17f8: 0x0796, 0x17f9: 0x079a, 0x17fa: 0x160e, 0x17fb: 0x1968, + 0x17fc: 0x079e, 0x17fd: 0x196d, 0x17fe: 0x1626, 0x17ff: 0x1626, + // Block 0x60, offset 0x1800 + 0x1800: 0x162e, 0x1801: 0x1972, 0x1802: 0x1646, 0x1803: 0x07a2, 0x1804: 0x1656, 0x1805: 0x1662, + 0x1806: 0x166a, 0x1807: 0x1672, 0x1808: 0x07a6, 0x1809: 0x1977, 0x180a: 0x1686, 0x180b: 0x16a2, + 0x180c: 0x16ae, 0x180d: 0x07aa, 0x180e: 0x07ae, 0x180f: 0x16b2, 0x1810: 0x197c, 0x1811: 0x07b2, + 0x1812: 0x1981, 0x1813: 0x1986, 0x1814: 0x198b, 0x1815: 0x16d6, 0x1816: 0x07b6, 0x1817: 0x16ea, + 0x1818: 0x16f2, 0x1819: 0x16f6, 0x181a: 0x16fe, 0x181b: 0x1706, 0x181c: 0x170e, 0x181d: 0x1995, +} + +// nfkcIndex: 22 blocks, 1408 entries, 2816 bytes +// Block 0 is the zero block. +var nfkcIndex = [1408]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x5f, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x60, 0xc7: 0x04, + 0xc8: 0x05, 0xca: 0x61, 0xcb: 0x62, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x09, + 0xd0: 0x0a, 0xd1: 0x63, 0xd2: 0x64, 0xd3: 0x0b, 0xd6: 0x0c, 0xd7: 0x65, + 0xd8: 0x66, 0xd9: 0x0d, 0xdb: 0x67, 0xdc: 0x68, 0xdd: 0x69, 0xdf: 0x6a, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, + 0xf0: 0x13, + // Block 0x4, offset 0x100 + 0x120: 0x6b, 0x121: 0x6c, 0x122: 0x6d, 0x123: 0x0e, 0x124: 0x6e, 0x125: 0x6f, 0x126: 0x70, 0x127: 0x71, + 0x128: 0x72, 0x129: 0x73, 0x12a: 0x74, 0x12b: 0x75, 0x12c: 0x70, 0x12d: 0x76, 0x12e: 0x77, 0x12f: 0x78, + 0x130: 0x74, 0x131: 0x79, 0x132: 0x7a, 0x133: 0x7b, 0x134: 0x7c, 0x135: 0x7d, 0x137: 0x7e, + 0x138: 0x7f, 0x139: 0x80, 0x13a: 0x81, 0x13b: 0x82, 0x13c: 0x83, 0x13d: 0x84, 0x13e: 0x85, 0x13f: 0x86, + // Block 0x5, offset 0x140 + 0x140: 0x87, 0x142: 0x88, 0x143: 0x89, 0x144: 0x8a, 0x145: 0x8b, 0x146: 0x8c, 0x147: 0x8d, + 0x14d: 0x8e, + 0x15c: 0x8f, 0x15f: 0x90, + 0x162: 0x91, 0x164: 0x92, + 0x168: 0x93, 0x169: 0x94, 0x16a: 0x95, 0x16b: 0x96, 0x16c: 0x0f, 0x16d: 0x97, 0x16e: 0x98, 0x16f: 0x99, + 0x170: 0x9a, 0x173: 0x9b, 0x174: 0x9c, 0x175: 0x10, 0x176: 0x11, 0x177: 0x12, + 0x178: 0x13, 0x179: 0x14, 0x17a: 0x15, 0x17b: 0x16, 0x17c: 0x17, 0x17d: 0x18, 0x17e: 0x19, 0x17f: 0x1a, + // Block 0x6, offset 0x180 + 0x180: 0x9d, 0x181: 0x9e, 0x182: 0x9f, 0x183: 0xa0, 0x184: 0x1b, 0x185: 0x1c, 0x186: 0xa1, 0x187: 0xa2, + 0x188: 0xa3, 0x189: 0x1d, 0x18a: 0x1e, 0x18b: 0xa4, 0x18c: 0xa5, + 0x191: 0x1f, 0x192: 0x20, 0x193: 0xa6, + 0x1a8: 0xa7, 0x1a9: 0xa8, 0x1ab: 0xa9, + 0x1b1: 0xaa, 0x1b3: 0xab, 0x1b5: 0xac, 0x1b7: 0xad, + 0x1ba: 0xae, 0x1bb: 0xaf, 0x1bc: 0x21, 0x1bd: 0x22, 0x1be: 0x23, 0x1bf: 0xb0, + // Block 0x7, offset 0x1c0 + 0x1c0: 0xb1, 0x1c1: 0x24, 0x1c2: 0x25, 0x1c3: 0x26, 0x1c4: 0xb2, 0x1c5: 0x27, 0x1c6: 0x28, + 0x1c8: 0x29, 0x1c9: 0x2a, 0x1ca: 0x2b, 0x1cb: 0x2c, 0x1cc: 0x2d, 0x1cd: 0x2e, 0x1ce: 0x2f, 0x1cf: 0x30, + // Block 0x8, offset 0x200 + 0x219: 0xb3, 0x21a: 0xb4, 0x21b: 0xb5, 0x21d: 0xb6, 0x21f: 0xb7, + 0x220: 0xb8, 0x223: 0xb9, 0x224: 0xba, 0x225: 0xbb, 0x226: 0xbc, 0x227: 0xbd, + 0x22a: 0xbe, 0x22b: 0xbf, 0x22d: 0xc0, 0x22f: 0xc1, + 0x230: 0xc2, 0x231: 0xc3, 0x232: 0xc4, 0x233: 0xc5, 0x234: 0xc6, 0x235: 0xc7, 0x236: 0xc8, 0x237: 0xc2, + 0x238: 0xc3, 0x239: 0xc4, 0x23a: 0xc5, 0x23b: 0xc6, 0x23c: 0xc7, 0x23d: 0xc8, 0x23e: 0xc2, 0x23f: 0xc3, + // Block 0x9, offset 0x240 + 0x240: 0xc4, 0x241: 0xc5, 0x242: 0xc6, 0x243: 0xc7, 0x244: 0xc8, 0x245: 0xc2, 0x246: 0xc3, 0x247: 0xc4, + 0x248: 0xc5, 0x249: 0xc6, 0x24a: 0xc7, 0x24b: 0xc8, 0x24c: 0xc2, 0x24d: 0xc3, 0x24e: 0xc4, 0x24f: 0xc5, + 0x250: 0xc6, 0x251: 0xc7, 0x252: 0xc8, 0x253: 0xc2, 0x254: 0xc3, 0x255: 0xc4, 0x256: 0xc5, 0x257: 0xc6, + 0x258: 0xc7, 0x259: 0xc8, 0x25a: 0xc2, 0x25b: 0xc3, 0x25c: 0xc4, 0x25d: 0xc5, 0x25e: 0xc6, 0x25f: 0xc7, + 0x260: 0xc8, 0x261: 0xc2, 0x262: 0xc3, 0x263: 0xc4, 0x264: 0xc5, 0x265: 0xc6, 0x266: 0xc7, 0x267: 0xc8, + 0x268: 0xc2, 0x269: 0xc3, 0x26a: 0xc4, 0x26b: 0xc5, 0x26c: 0xc6, 0x26d: 0xc7, 0x26e: 0xc8, 0x26f: 0xc2, + 0x270: 0xc3, 0x271: 0xc4, 0x272: 0xc5, 0x273: 0xc6, 0x274: 0xc7, 0x275: 0xc8, 0x276: 0xc2, 0x277: 0xc3, + 0x278: 0xc4, 0x279: 0xc5, 0x27a: 0xc6, 0x27b: 0xc7, 0x27c: 0xc8, 0x27d: 0xc2, 0x27e: 0xc3, 0x27f: 0xc4, + // Block 0xa, offset 0x280 + 0x280: 0xc5, 0x281: 0xc6, 0x282: 0xc7, 0x283: 0xc8, 0x284: 0xc2, 0x285: 0xc3, 0x286: 0xc4, 0x287: 0xc5, + 0x288: 0xc6, 0x289: 0xc7, 0x28a: 0xc8, 0x28b: 0xc2, 0x28c: 0xc3, 0x28d: 0xc4, 0x28e: 0xc5, 0x28f: 0xc6, + 0x290: 0xc7, 0x291: 0xc8, 0x292: 0xc2, 0x293: 0xc3, 0x294: 0xc4, 0x295: 0xc5, 0x296: 0xc6, 0x297: 0xc7, + 0x298: 0xc8, 0x299: 0xc2, 0x29a: 0xc3, 0x29b: 0xc4, 0x29c: 0xc5, 0x29d: 0xc6, 0x29e: 0xc7, 0x29f: 0xc8, + 0x2a0: 0xc2, 0x2a1: 0xc3, 0x2a2: 0xc4, 0x2a3: 0xc5, 0x2a4: 0xc6, 0x2a5: 0xc7, 0x2a6: 0xc8, 0x2a7: 0xc2, + 0x2a8: 0xc3, 0x2a9: 0xc4, 0x2aa: 0xc5, 0x2ab: 0xc6, 0x2ac: 0xc7, 0x2ad: 0xc8, 0x2ae: 0xc2, 0x2af: 0xc3, + 0x2b0: 0xc4, 0x2b1: 0xc5, 0x2b2: 0xc6, 0x2b3: 0xc7, 0x2b4: 0xc8, 0x2b5: 0xc2, 0x2b6: 0xc3, 0x2b7: 0xc4, + 0x2b8: 0xc5, 0x2b9: 0xc6, 0x2ba: 0xc7, 0x2bb: 0xc8, 0x2bc: 0xc2, 0x2bd: 0xc3, 0x2be: 0xc4, 0x2bf: 0xc5, + // Block 0xb, offset 0x2c0 + 0x2c0: 0xc6, 0x2c1: 0xc7, 0x2c2: 0xc8, 0x2c3: 0xc2, 0x2c4: 0xc3, 0x2c5: 0xc4, 0x2c6: 0xc5, 0x2c7: 0xc6, + 0x2c8: 0xc7, 0x2c9: 0xc8, 0x2ca: 0xc2, 0x2cb: 0xc3, 0x2cc: 0xc4, 0x2cd: 0xc5, 0x2ce: 0xc6, 0x2cf: 0xc7, + 0x2d0: 0xc8, 0x2d1: 0xc2, 0x2d2: 0xc3, 0x2d3: 0xc4, 0x2d4: 0xc5, 0x2d5: 0xc6, 0x2d6: 0xc7, 0x2d7: 0xc8, + 0x2d8: 0xc2, 0x2d9: 0xc3, 0x2da: 0xc4, 0x2db: 0xc5, 0x2dc: 0xc6, 0x2dd: 0xc7, 0x2de: 0xc9, + // Block 0xc, offset 0x300 + 0x324: 0x31, 0x325: 0x32, 0x326: 0x33, 0x327: 0x34, + 0x328: 0x35, 0x329: 0x36, 0x32a: 0x37, 0x32b: 0x38, 0x32c: 0x39, 0x32d: 0x3a, 0x32e: 0x3b, 0x32f: 0x3c, + 0x330: 0x3d, 0x331: 0x3e, 0x332: 0x3f, 0x333: 0x40, 0x334: 0x41, 0x335: 0x42, 0x336: 0x43, 0x337: 0x44, + 0x338: 0x45, 0x339: 0x46, 0x33a: 0x47, 0x33b: 0x48, 0x33c: 0xca, 0x33d: 0x49, 0x33e: 0x4a, 0x33f: 0x4b, + // Block 0xd, offset 0x340 + 0x347: 0xcb, + 0x34b: 0xcc, 0x34d: 0xcd, + 0x35e: 0x4c, + 0x368: 0xce, 0x36b: 0xcf, + 0x374: 0xd0, + 0x37a: 0xd1, 0x37b: 0xd2, 0x37d: 0xd3, 0x37e: 0xd4, + // Block 0xe, offset 0x380 + 0x381: 0xd5, 0x382: 0xd6, 0x384: 0xd7, 0x385: 0xbc, 0x387: 0xd8, + 0x388: 0xd9, 0x38b: 0xda, 0x38c: 0xdb, 0x38d: 0xdc, + 0x391: 0xdd, 0x392: 0xde, 0x393: 0xdf, 0x396: 0xe0, 0x397: 0xe1, + 0x398: 0xe2, 0x39a: 0xe3, 0x39c: 0xe4, + 0x3a0: 0xe5, 0x3a4: 0xe6, 0x3a5: 0xe7, 0x3a7: 0xe8, + 0x3a8: 0xe9, 0x3a9: 0xea, 0x3aa: 0xeb, + 0x3b0: 0xe2, 0x3b5: 0xec, 0x3b6: 0xed, + 0x3bd: 0xee, + // Block 0xf, offset 0x3c0 + 0x3eb: 0xef, 0x3ec: 0xf0, + 0x3ff: 0xf1, + // Block 0x10, offset 0x400 + 0x432: 0xf2, + // Block 0x11, offset 0x440 + 0x445: 0xf3, 0x446: 0xf4, 0x447: 0xf5, + 0x449: 0xf6, + 0x450: 0xf7, 0x451: 0xf8, 0x452: 0xf9, 0x453: 0xfa, 0x454: 0xfb, 0x455: 0xfc, 0x456: 0xfd, 0x457: 0xfe, + 0x458: 0xff, 0x459: 0x100, 0x45a: 0x4d, 0x45b: 0x101, 0x45c: 0x102, 0x45d: 0x103, 0x45e: 0x104, 0x45f: 0x4e, + // Block 0x12, offset 0x480 + 0x480: 0x4f, 0x481: 0x50, 0x482: 0x105, 0x484: 0xf0, + 0x48a: 0x106, 0x48b: 0x107, + 0x493: 0x108, + 0x4a3: 0x109, 0x4a5: 0x10a, + 0x4b8: 0x51, 0x4b9: 0x52, 0x4ba: 0x53, + // Block 0x13, offset 0x4c0 + 0x4c4: 0x54, 0x4c5: 0x10b, 0x4c6: 0x10c, + 0x4c8: 0x55, 0x4c9: 0x10d, + 0x4ef: 0x10e, + // Block 0x14, offset 0x500 + 0x520: 0x56, 0x521: 0x57, 0x522: 0x58, 0x523: 0x59, 0x524: 0x5a, 0x525: 0x5b, 0x526: 0x5c, 0x527: 0x5d, + 0x528: 0x5e, + // Block 0x15, offset 0x540 + 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, + 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, +} + +// nfkcSparseOffset: 176 entries, 352 bytes +var nfkcSparseOffset = []uint16{0x0, 0xe, 0x12, 0x1c, 0x26, 0x36, 0x38, 0x3d, 0x48, 0x57, 0x64, 0x6c, 0x71, 0x76, 0x78, 0x7c, 0x84, 0x8b, 0x8e, 0x96, 0x9a, 0x9e, 0xa0, 0xa2, 0xab, 0xaf, 0xb6, 0xbb, 0xbe, 0xc8, 0xcb, 0xd2, 0xda, 0xde, 0xe0, 0xe4, 0xe8, 0xee, 0xff, 0x10b, 0x10d, 0x113, 0x115, 0x117, 0x119, 0x11b, 0x11d, 0x11f, 0x121, 0x124, 0x127, 0x129, 0x12c, 0x12f, 0x133, 0x139, 0x140, 0x149, 0x14b, 0x14e, 0x150, 0x15b, 0x166, 0x174, 0x182, 0x192, 0x1a0, 0x1a7, 0x1ad, 0x1bc, 0x1c0, 0x1c2, 0x1c6, 0x1c8, 0x1cb, 0x1cd, 0x1d0, 0x1d2, 0x1d5, 0x1d7, 0x1d9, 0x1db, 0x1e7, 0x1f1, 0x1fb, 0x1fe, 0x202, 0x204, 0x206, 0x20b, 0x20e, 0x211, 0x213, 0x215, 0x217, 0x219, 0x21f, 0x222, 0x227, 0x229, 0x230, 0x236, 0x23c, 0x244, 0x24a, 0x250, 0x256, 0x25a, 0x25c, 0x25e, 0x260, 0x262, 0x268, 0x26b, 0x26d, 0x26f, 0x271, 0x277, 0x27b, 0x27f, 0x287, 0x28e, 0x291, 0x294, 0x296, 0x299, 0x2a1, 0x2a5, 0x2ac, 0x2af, 0x2b5, 0x2b7, 0x2b9, 0x2bc, 0x2be, 0x2c1, 0x2c6, 0x2c8, 0x2ca, 0x2cc, 0x2ce, 0x2d0, 0x2d3, 0x2d5, 0x2d7, 0x2d9, 0x2db, 0x2dd, 0x2df, 0x2ec, 0x2f6, 0x2f8, 0x2fa, 0x2fe, 0x303, 0x30f, 0x314, 0x31d, 0x323, 0x328, 0x32c, 0x331, 0x335, 0x345, 0x353, 0x361, 0x36f, 0x371, 0x373, 0x375, 0x379, 0x37b, 0x37e, 0x389, 0x38b, 0x395} + +// nfkcSparseValues: 919 entries, 3676 bytes +var nfkcSparseValues = [919]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0002, lo: 0x0d}, + {value: 0x0001, lo: 0xa0, hi: 0xa0}, + {value: 0x43b9, lo: 0xa8, hi: 0xa8}, + {value: 0x0083, lo: 0xaa, hi: 0xaa}, + {value: 0x43a5, lo: 0xaf, hi: 0xaf}, + {value: 0x0025, lo: 0xb2, hi: 0xb3}, + {value: 0x439b, lo: 0xb4, hi: 0xb4}, + {value: 0x0260, lo: 0xb5, hi: 0xb5}, + {value: 0x43d2, lo: 0xb8, hi: 0xb8}, + {value: 0x0023, lo: 0xb9, hi: 0xb9}, + {value: 0x009f, lo: 0xba, hi: 0xba}, + {value: 0x234c, lo: 0xbc, hi: 0xbc}, + {value: 0x2340, lo: 0xbd, hi: 0xbd}, + {value: 0x23e2, lo: 0xbe, hi: 0xbe}, + // Block 0x1, offset 0xe + {value: 0x0091, lo: 0x03}, + {value: 0x4823, lo: 0xa0, hi: 0xa1}, + {value: 0x4855, lo: 0xaf, hi: 0xb0}, + {value: 0xa000, lo: 0xb7, hi: 0xb7}, + // Block 0x2, offset 0x12 + {value: 0x0004, lo: 0x09}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x0091, lo: 0xb0, hi: 0xb0}, + {value: 0x0140, lo: 0xb1, hi: 0xb1}, + {value: 0x0095, lo: 0xb2, hi: 0xb2}, + {value: 0x00a5, lo: 0xb3, hi: 0xb3}, + {value: 0x0179, lo: 0xb4, hi: 0xb4}, + {value: 0x017f, lo: 0xb5, hi: 0xb5}, + {value: 0x018b, lo: 0xb6, hi: 0xb6}, + {value: 0x00af, lo: 0xb7, hi: 0xb8}, + // Block 0x3, offset 0x1c + {value: 0x000a, lo: 0x09}, + {value: 0x43af, lo: 0x98, hi: 0x98}, + {value: 0x43b4, lo: 0x99, hi: 0x9a}, + {value: 0x43d7, lo: 0x9b, hi: 0x9b}, + {value: 0x43a0, lo: 0x9c, hi: 0x9c}, + {value: 0x43c3, lo: 0x9d, hi: 0x9d}, + {value: 0x0137, lo: 0xa0, hi: 0xa0}, + {value: 0x0099, lo: 0xa1, hi: 0xa1}, + {value: 0x00a7, lo: 0xa2, hi: 0xa3}, + {value: 0x01b8, lo: 0xa4, hi: 0xa4}, + // Block 0x4, offset 0x26 + {value: 0x0000, lo: 0x0f}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0xa000, lo: 0x8d, hi: 0x8d}, + {value: 0x38e6, lo: 0x90, hi: 0x90}, + {value: 0x38f2, lo: 0x91, hi: 0x91}, + {value: 0x38e0, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x96, hi: 0x96}, + {value: 0x3958, lo: 0x97, hi: 0x97}, + {value: 0x3922, lo: 0x9c, hi: 0x9c}, + {value: 0x390a, lo: 0x9d, hi: 0x9d}, + {value: 0x3934, lo: 0x9e, hi: 0x9e}, + {value: 0xa000, lo: 0xb4, hi: 0xb5}, + {value: 0x395e, lo: 0xb6, hi: 0xb6}, + {value: 0x3964, lo: 0xb7, hi: 0xb7}, + // Block 0x5, offset 0x36 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x83, hi: 0x87}, + // Block 0x6, offset 0x38 + {value: 0x0001, lo: 0x04}, + {value: 0x8114, lo: 0x81, hi: 0x82}, + {value: 0x8133, lo: 0x84, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + {value: 0x810e, lo: 0x87, hi: 0x87}, + // Block 0x7, offset 0x3d + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x97}, + {value: 0x811a, lo: 0x98, hi: 0x98}, + {value: 0x811b, lo: 0x99, hi: 0x99}, + {value: 0x811c, lo: 0x9a, hi: 0x9a}, + {value: 0x3982, lo: 0xa2, hi: 0xa2}, + {value: 0x3988, lo: 0xa3, hi: 0xa3}, + {value: 0x3994, lo: 0xa4, hi: 0xa4}, + {value: 0x398e, lo: 0xa5, hi: 0xa5}, + {value: 0x399a, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xa7, hi: 0xa7}, + // Block 0x8, offset 0x48 + {value: 0x0000, lo: 0x0e}, + {value: 0x39ac, lo: 0x80, hi: 0x80}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0x39a0, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x39a6, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x95, hi: 0x95}, + {value: 0x8133, lo: 0x96, hi: 0x9c}, + {value: 0x8133, lo: 0x9f, hi: 0xa2}, + {value: 0x812e, lo: 0xa3, hi: 0xa3}, + {value: 0x8133, lo: 0xa4, hi: 0xa4}, + {value: 0x8133, lo: 0xa7, hi: 0xa8}, + {value: 0x812e, lo: 0xaa, hi: 0xaa}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + // Block 0x9, offset 0x57 + {value: 0x0000, lo: 0x0c}, + {value: 0x8120, lo: 0x91, hi: 0x91}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x812e, lo: 0xb1, hi: 0xb1}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb5, hi: 0xb6}, + {value: 0x812e, lo: 0xb7, hi: 0xb9}, + {value: 0x8133, lo: 0xba, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbc}, + {value: 0x8133, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbe, hi: 0xbe}, + {value: 0x8133, lo: 0xbf, hi: 0xbf}, + // Block 0xa, offset 0x64 + {value: 0x0005, lo: 0x07}, + {value: 0x8133, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x812e, lo: 0x82, hi: 0x83}, + {value: 0x812e, lo: 0x84, hi: 0x85}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x812e, lo: 0x88, hi: 0x89}, + {value: 0x8133, lo: 0x8a, hi: 0x8a}, + // Block 0xb, offset 0x6c + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0xab, hi: 0xb1}, + {value: 0x812e, lo: 0xb2, hi: 0xb2}, + {value: 0x8133, lo: 0xb3, hi: 0xb3}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0xc, offset 0x71 + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0x96, hi: 0x99}, + {value: 0x8133, lo: 0x9b, hi: 0xa3}, + {value: 0x8133, lo: 0xa5, hi: 0xa7}, + {value: 0x8133, lo: 0xa9, hi: 0xad}, + // Block 0xd, offset 0x76 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + // Block 0xe, offset 0x78 + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0x98, hi: 0x98}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + {value: 0x8133, lo: 0x9c, hi: 0x9f}, + // Block 0xf, offset 0x7c + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0xa8, hi: 0xa8}, + {value: 0x4019, lo: 0xa9, hi: 0xa9}, + {value: 0xa000, lo: 0xb0, hi: 0xb0}, + {value: 0x4021, lo: 0xb1, hi: 0xb1}, + {value: 0xa000, lo: 0xb3, hi: 0xb3}, + {value: 0x4029, lo: 0xb4, hi: 0xb4}, + {value: 0x9903, lo: 0xbc, hi: 0xbc}, + // Block 0x10, offset 0x84 + {value: 0x0008, lo: 0x06}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x91, hi: 0x91}, + {value: 0x812e, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x93, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x94}, + {value: 0x465d, lo: 0x98, hi: 0x9f}, + // Block 0x11, offset 0x8b + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x12, offset 0x8e + {value: 0x0008, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2dd5, lo: 0x8b, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x469d, lo: 0x9c, hi: 0x9d}, + {value: 0x46ad, lo: 0x9f, hi: 0x9f}, + {value: 0x8133, lo: 0xbe, hi: 0xbe}, + // Block 0x13, offset 0x96 + {value: 0x0000, lo: 0x03}, + {value: 0x46d5, lo: 0xb3, hi: 0xb3}, + {value: 0x46dd, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x14, offset 0x9a + {value: 0x0008, lo: 0x03}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x46b5, lo: 0x99, hi: 0x9b}, + {value: 0x46cd, lo: 0x9e, hi: 0x9e}, + // Block 0x15, offset 0x9e + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x16, offset 0xa0 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + // Block 0x17, offset 0xa2 + {value: 0x0000, lo: 0x08}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ded, lo: 0x88, hi: 0x88}, + {value: 0x2de5, lo: 0x8b, hi: 0x8b}, + {value: 0x2df5, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x96, hi: 0x97}, + {value: 0x46e5, lo: 0x9c, hi: 0x9c}, + {value: 0x46ed, lo: 0x9d, hi: 0x9d}, + // Block 0x18, offset 0xab + {value: 0x0000, lo: 0x03}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x2dfd, lo: 0x94, hi: 0x94}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x19, offset 0xaf + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e05, lo: 0x8a, hi: 0x8a}, + {value: 0x2e15, lo: 0x8b, hi: 0x8b}, + {value: 0x2e0d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1a, offset 0xb6 + {value: 0x1801, lo: 0x04}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x4031, lo: 0x88, hi: 0x88}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8121, lo: 0x95, hi: 0x96}, + // Block 0x1b, offset 0xbb + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0xa000, lo: 0xbf, hi: 0xbf}, + // Block 0x1c, offset 0xbe + {value: 0x0000, lo: 0x09}, + {value: 0x2e1d, lo: 0x80, hi: 0x80}, + {value: 0x9900, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x2e25, lo: 0x87, hi: 0x87}, + {value: 0x2e2d, lo: 0x88, hi: 0x88}, + {value: 0x3091, lo: 0x8a, hi: 0x8a}, + {value: 0x2f19, lo: 0x8b, hi: 0x8b}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x95, hi: 0x96}, + // Block 0x1d, offset 0xc8 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xcb + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e35, lo: 0x8a, hi: 0x8a}, + {value: 0x2e45, lo: 0x8b, hi: 0x8b}, + {value: 0x2e3d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1f, offset 0xd2 + {value: 0x6ab3, lo: 0x07}, + {value: 0x9905, lo: 0x8a, hi: 0x8a}, + {value: 0x9900, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4039, lo: 0x9a, hi: 0x9a}, + {value: 0x3099, lo: 0x9c, hi: 0x9c}, + {value: 0x2f24, lo: 0x9d, hi: 0x9d}, + {value: 0x2e4d, lo: 0x9e, hi: 0x9f}, + // Block 0x20, offset 0xda + {value: 0x0000, lo: 0x03}, + {value: 0x2751, lo: 0xb3, hi: 0xb3}, + {value: 0x8123, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x21, offset 0xde + {value: 0x0000, lo: 0x01}, + {value: 0x8124, lo: 0x88, hi: 0x8b}, + // Block 0x22, offset 0xe0 + {value: 0x0000, lo: 0x03}, + {value: 0x2766, lo: 0xb3, hi: 0xb3}, + {value: 0x8125, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x23, offset 0xe4 + {value: 0x0000, lo: 0x03}, + {value: 0x8126, lo: 0x88, hi: 0x8b}, + {value: 0x2758, lo: 0x9c, hi: 0x9c}, + {value: 0x275f, lo: 0x9d, hi: 0x9d}, + // Block 0x24, offset 0xe8 + {value: 0x0000, lo: 0x05}, + {value: 0x03fe, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x98, hi: 0x99}, + {value: 0x812e, lo: 0xb5, hi: 0xb5}, + {value: 0x812e, lo: 0xb7, hi: 0xb7}, + {value: 0x812c, lo: 0xb9, hi: 0xb9}, + // Block 0x25, offset 0xee + {value: 0x0000, lo: 0x10}, + {value: 0x2774, lo: 0x83, hi: 0x83}, + {value: 0x277b, lo: 0x8d, hi: 0x8d}, + {value: 0x2782, lo: 0x92, hi: 0x92}, + {value: 0x2789, lo: 0x97, hi: 0x97}, + {value: 0x2790, lo: 0x9c, hi: 0x9c}, + {value: 0x276d, lo: 0xa9, hi: 0xa9}, + {value: 0x8127, lo: 0xb1, hi: 0xb1}, + {value: 0x8128, lo: 0xb2, hi: 0xb2}, + {value: 0x4bc5, lo: 0xb3, hi: 0xb3}, + {value: 0x8129, lo: 0xb4, hi: 0xb4}, + {value: 0x4bce, lo: 0xb5, hi: 0xb5}, + {value: 0x46f5, lo: 0xb6, hi: 0xb6}, + {value: 0x4735, lo: 0xb7, hi: 0xb7}, + {value: 0x46fd, lo: 0xb8, hi: 0xb8}, + {value: 0x4740, lo: 0xb9, hi: 0xb9}, + {value: 0x8128, lo: 0xba, hi: 0xbd}, + // Block 0x26, offset 0xff + {value: 0x0000, lo: 0x0b}, + {value: 0x8128, lo: 0x80, hi: 0x80}, + {value: 0x4bd7, lo: 0x81, hi: 0x81}, + {value: 0x8133, lo: 0x82, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0x86, hi: 0x87}, + {value: 0x279e, lo: 0x93, hi: 0x93}, + {value: 0x27a5, lo: 0x9d, hi: 0x9d}, + {value: 0x27ac, lo: 0xa2, hi: 0xa2}, + {value: 0x27b3, lo: 0xa7, hi: 0xa7}, + {value: 0x27ba, lo: 0xac, hi: 0xac}, + {value: 0x2797, lo: 0xb9, hi: 0xb9}, + // Block 0x27, offset 0x10b + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x86, hi: 0x86}, + // Block 0x28, offset 0x10d + {value: 0x0000, lo: 0x05}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x2e55, lo: 0xa6, hi: 0xa6}, + {value: 0x9900, lo: 0xae, hi: 0xae}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x29, offset 0x113 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + // Block 0x2a, offset 0x115 + {value: 0x0000, lo: 0x01}, + {value: 0x0402, lo: 0xbc, hi: 0xbc}, + // Block 0x2b, offset 0x117 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x80, hi: 0x92}, + // Block 0x2c, offset 0x119 + {value: 0x0000, lo: 0x01}, + {value: 0xb900, lo: 0xa1, hi: 0xb5}, + // Block 0x2d, offset 0x11b + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0xa8, hi: 0xbf}, + // Block 0x2e, offset 0x11d + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0x80, hi: 0x82}, + // Block 0x2f, offset 0x11f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9d, hi: 0x9f}, + // Block 0x30, offset 0x121 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x94, hi: 0x95}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x31, offset 0x124 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x9d, hi: 0x9d}, + // Block 0x32, offset 0x127 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa9, hi: 0xa9}, + // Block 0x33, offset 0x129 + {value: 0x0004, lo: 0x02}, + {value: 0x812f, lo: 0xb9, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbb}, + // Block 0x34, offset 0x12c + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x97, hi: 0x97}, + {value: 0x812e, lo: 0x98, hi: 0x98}, + // Block 0x35, offset 0x12f + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + {value: 0x8133, lo: 0xb5, hi: 0xbc}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x36, offset 0x133 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + {value: 0x812e, lo: 0xb5, hi: 0xba}, + {value: 0x8133, lo: 0xbb, hi: 0xbc}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x37, offset 0x139 + {value: 0x0000, lo: 0x06}, + {value: 0x812e, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8a}, + {value: 0x8133, lo: 0x8b, hi: 0x8e}, + // Block 0x38, offset 0x140 + {value: 0x0000, lo: 0x08}, + {value: 0x2e9d, lo: 0x80, hi: 0x80}, + {value: 0x2ea5, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x82, hi: 0x82}, + {value: 0x2ead, lo: 0x83, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xab, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xac}, + {value: 0x8133, lo: 0xad, hi: 0xb3}, + // Block 0x39, offset 0x149 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xaa, hi: 0xab}, + // Block 0x3a, offset 0x14b + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xa6, hi: 0xa6}, + {value: 0x8105, lo: 0xb2, hi: 0xb3}, + // Block 0x3b, offset 0x14e + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x3c, offset 0x150 + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x92}, + {value: 0x8101, lo: 0x94, hi: 0x94}, + {value: 0x812e, lo: 0x95, hi: 0x99}, + {value: 0x8133, lo: 0x9a, hi: 0x9b}, + {value: 0x812e, lo: 0x9c, hi: 0x9f}, + {value: 0x8133, lo: 0xa0, hi: 0xa0}, + {value: 0x8101, lo: 0xa2, hi: 0xa8}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + {value: 0x8133, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb8, hi: 0xb9}, + // Block 0x3d, offset 0x15b + {value: 0x0002, lo: 0x0a}, + {value: 0x0043, lo: 0xac, hi: 0xac}, + {value: 0x00d1, lo: 0xad, hi: 0xad}, + {value: 0x0045, lo: 0xae, hi: 0xae}, + {value: 0x0049, lo: 0xb0, hi: 0xb1}, + {value: 0x00ec, lo: 0xb2, hi: 0xb2}, + {value: 0x004f, lo: 0xb3, hi: 0xba}, + {value: 0x005f, lo: 0xbc, hi: 0xbc}, + {value: 0x00fe, lo: 0xbd, hi: 0xbd}, + {value: 0x0061, lo: 0xbe, hi: 0xbe}, + {value: 0x0065, lo: 0xbf, hi: 0xbf}, + // Block 0x3e, offset 0x166 + {value: 0x0000, lo: 0x0d}, + {value: 0x0001, lo: 0x80, hi: 0x8a}, + {value: 0x0532, lo: 0x91, hi: 0x91}, + {value: 0x43dc, lo: 0x97, hi: 0x97}, + {value: 0x001d, lo: 0xa4, hi: 0xa4}, + {value: 0x19a0, lo: 0xa5, hi: 0xa5}, + {value: 0x1c8c, lo: 0xa6, hi: 0xa6}, + {value: 0x0001, lo: 0xaf, hi: 0xaf}, + {value: 0x27c1, lo: 0xb3, hi: 0xb3}, + {value: 0x2935, lo: 0xb4, hi: 0xb4}, + {value: 0x27c8, lo: 0xb6, hi: 0xb6}, + {value: 0x293f, lo: 0xb7, hi: 0xb7}, + {value: 0x199a, lo: 0xbc, hi: 0xbc}, + {value: 0x43aa, lo: 0xbe, hi: 0xbe}, + // Block 0x3f, offset 0x174 + {value: 0x0002, lo: 0x0d}, + {value: 0x1a60, lo: 0x87, hi: 0x87}, + {value: 0x1a5d, lo: 0x88, hi: 0x88}, + {value: 0x199d, lo: 0x89, hi: 0x89}, + {value: 0x2ac5, lo: 0x97, hi: 0x97}, + {value: 0x0001, lo: 0x9f, hi: 0x9f}, + {value: 0x0021, lo: 0xb0, hi: 0xb0}, + {value: 0x0093, lo: 0xb1, hi: 0xb1}, + {value: 0x0029, lo: 0xb4, hi: 0xb9}, + {value: 0x0017, lo: 0xba, hi: 0xba}, + {value: 0x055e, lo: 0xbb, hi: 0xbb}, + {value: 0x003b, lo: 0xbc, hi: 0xbc}, + {value: 0x0011, lo: 0xbd, hi: 0xbe}, + {value: 0x009d, lo: 0xbf, hi: 0xbf}, + // Block 0x40, offset 0x182 + {value: 0x0002, lo: 0x0f}, + {value: 0x0021, lo: 0x80, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8a}, + {value: 0x055e, lo: 0x8b, hi: 0x8b}, + {value: 0x003b, lo: 0x8c, hi: 0x8c}, + {value: 0x0011, lo: 0x8d, hi: 0x8e}, + {value: 0x0083, lo: 0x90, hi: 0x90}, + {value: 0x008b, lo: 0x91, hi: 0x91}, + {value: 0x009f, lo: 0x92, hi: 0x92}, + {value: 0x00b1, lo: 0x93, hi: 0x93}, + {value: 0x011f, lo: 0x94, hi: 0x94}, + {value: 0x0091, lo: 0x95, hi: 0x95}, + {value: 0x0097, lo: 0x96, hi: 0x99}, + {value: 0x00a1, lo: 0x9a, hi: 0x9a}, + {value: 0x00a7, lo: 0x9b, hi: 0x9c}, + {value: 0x1ac9, lo: 0xa8, hi: 0xa8}, + // Block 0x41, offset 0x192 + {value: 0x0000, lo: 0x0d}, + {value: 0x8133, lo: 0x90, hi: 0x91}, + {value: 0x8101, lo: 0x92, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x97}, + {value: 0x8101, lo: 0x98, hi: 0x9a}, + {value: 0x8133, lo: 0x9b, hi: 0x9c}, + {value: 0x8133, lo: 0xa1, hi: 0xa1}, + {value: 0x8101, lo: 0xa5, hi: 0xa6}, + {value: 0x8133, lo: 0xa7, hi: 0xa7}, + {value: 0x812e, lo: 0xa8, hi: 0xa8}, + {value: 0x8133, lo: 0xa9, hi: 0xa9}, + {value: 0x8101, lo: 0xaa, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xaf}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + // Block 0x42, offset 0x1a0 + {value: 0x0007, lo: 0x06}, + {value: 0x22b0, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + {value: 0x3cfa, lo: 0x9a, hi: 0x9b}, + {value: 0x3d08, lo: 0xae, hi: 0xae}, + // Block 0x43, offset 0x1a7 + {value: 0x000e, lo: 0x05}, + {value: 0x3d0f, lo: 0x8d, hi: 0x8e}, + {value: 0x3d16, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + // Block 0x44, offset 0x1ad + {value: 0x017a, lo: 0x0e}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0x3d24, lo: 0x84, hi: 0x84}, + {value: 0xa000, lo: 0x88, hi: 0x88}, + {value: 0x3d2b, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0x3d32, lo: 0x8c, hi: 0x8c}, + {value: 0xa000, lo: 0xa3, hi: 0xa3}, + {value: 0x3d39, lo: 0xa4, hi: 0xa4}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x3d40, lo: 0xa6, hi: 0xa6}, + {value: 0x27cf, lo: 0xac, hi: 0xad}, + {value: 0x27d6, lo: 0xaf, hi: 0xaf}, + {value: 0x2953, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xbc, hi: 0xbc}, + // Block 0x45, offset 0x1bc + {value: 0x0007, lo: 0x03}, + {value: 0x3da9, lo: 0xa0, hi: 0xa1}, + {value: 0x3dd3, lo: 0xa2, hi: 0xa3}, + {value: 0x3dfd, lo: 0xaa, hi: 0xad}, + // Block 0x46, offset 0x1c0 + {value: 0x0004, lo: 0x01}, + {value: 0x0586, lo: 0xa9, hi: 0xaa}, + // Block 0x47, offset 0x1c2 + {value: 0x0002, lo: 0x03}, + {value: 0x0057, lo: 0x80, hi: 0x8f}, + {value: 0x0083, lo: 0x90, hi: 0xa9}, + {value: 0x0021, lo: 0xaa, hi: 0xaa}, + // Block 0x48, offset 0x1c6 + {value: 0x0000, lo: 0x01}, + {value: 0x2ad2, lo: 0x8c, hi: 0x8c}, + // Block 0x49, offset 0x1c8 + {value: 0x0266, lo: 0x02}, + {value: 0x1cbc, lo: 0xb4, hi: 0xb4}, + {value: 0x1a5a, lo: 0xb5, hi: 0xb6}, + // Block 0x4a, offset 0x1cb + {value: 0x0000, lo: 0x01}, + {value: 0x461e, lo: 0x9c, hi: 0x9c}, + // Block 0x4b, offset 0x1cd + {value: 0x0000, lo: 0x02}, + {value: 0x0095, lo: 0xbc, hi: 0xbc}, + {value: 0x006d, lo: 0xbd, hi: 0xbd}, + // Block 0x4c, offset 0x1d0 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xaf, hi: 0xb1}, + // Block 0x4d, offset 0x1d2 + {value: 0x0000, lo: 0x02}, + {value: 0x057a, lo: 0xaf, hi: 0xaf}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x4e, offset 0x1d5 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa0, hi: 0xbf}, + // Block 0x4f, offset 0x1d7 + {value: 0x0000, lo: 0x01}, + {value: 0x0ebe, lo: 0x9f, hi: 0x9f}, + // Block 0x50, offset 0x1d9 + {value: 0x0000, lo: 0x01}, + {value: 0x172a, lo: 0xb3, hi: 0xb3}, + // Block 0x51, offset 0x1db + {value: 0x0004, lo: 0x0b}, + {value: 0x1692, lo: 0x80, hi: 0x82}, + {value: 0x16aa, lo: 0x83, hi: 0x83}, + {value: 0x16c2, lo: 0x84, hi: 0x85}, + {value: 0x16d2, lo: 0x86, hi: 0x89}, + {value: 0x16e6, lo: 0x8a, hi: 0x8c}, + {value: 0x16fa, lo: 0x8d, hi: 0x8d}, + {value: 0x1702, lo: 0x8e, hi: 0x8e}, + {value: 0x170a, lo: 0x8f, hi: 0x90}, + {value: 0x1716, lo: 0x91, hi: 0x93}, + {value: 0x1726, lo: 0x94, hi: 0x94}, + {value: 0x172e, lo: 0x95, hi: 0x95}, + // Block 0x52, offset 0x1e7 + {value: 0x0004, lo: 0x09}, + {value: 0x0001, lo: 0x80, hi: 0x80}, + {value: 0x812d, lo: 0xaa, hi: 0xaa}, + {value: 0x8132, lo: 0xab, hi: 0xab}, + {value: 0x8134, lo: 0xac, hi: 0xac}, + {value: 0x812f, lo: 0xad, hi: 0xad}, + {value: 0x8130, lo: 0xae, hi: 0xae}, + {value: 0x8130, lo: 0xaf, hi: 0xaf}, + {value: 0x05ae, lo: 0xb6, hi: 0xb6}, + {value: 0x0982, lo: 0xb8, hi: 0xba}, + // Block 0x53, offset 0x1f1 + {value: 0x0006, lo: 0x09}, + {value: 0x0406, lo: 0xb1, hi: 0xb1}, + {value: 0x040a, lo: 0xb2, hi: 0xb2}, + {value: 0x4b7c, lo: 0xb3, hi: 0xb3}, + {value: 0x040e, lo: 0xb4, hi: 0xb4}, + {value: 0x4b82, lo: 0xb5, hi: 0xb6}, + {value: 0x0412, lo: 0xb7, hi: 0xb7}, + {value: 0x0416, lo: 0xb8, hi: 0xb8}, + {value: 0x041a, lo: 0xb9, hi: 0xb9}, + {value: 0x4b8e, lo: 0xba, hi: 0xbf}, + // Block 0x54, offset 0x1fb + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + {value: 0x8133, lo: 0xb4, hi: 0xbd}, + // Block 0x55, offset 0x1fe + {value: 0x0000, lo: 0x03}, + {value: 0x02d8, lo: 0x9c, hi: 0x9c}, + {value: 0x02de, lo: 0x9d, hi: 0x9d}, + {value: 0x8133, lo: 0x9e, hi: 0x9f}, + // Block 0x56, offset 0x202 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb1}, + // Block 0x57, offset 0x204 + {value: 0x0000, lo: 0x01}, + {value: 0x173e, lo: 0xb0, hi: 0xb0}, + // Block 0x58, offset 0x206 + {value: 0x0006, lo: 0x04}, + {value: 0x0047, lo: 0xb2, hi: 0xb3}, + {value: 0x0063, lo: 0xb4, hi: 0xb4}, + {value: 0x00dd, lo: 0xb8, hi: 0xb8}, + {value: 0x00e9, lo: 0xb9, hi: 0xb9}, + // Block 0x59, offset 0x20b + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xac, hi: 0xac}, + // Block 0x5a, offset 0x20e + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xa0, hi: 0xb1}, + // Block 0x5b, offset 0x211 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xab, hi: 0xad}, + // Block 0x5c, offset 0x213 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x93, hi: 0x93}, + // Block 0x5d, offset 0x215 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb3, hi: 0xb3}, + // Block 0x5e, offset 0x217 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + // Block 0x5f, offset 0x219 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb7, hi: 0xb8}, + {value: 0x8133, lo: 0xbe, hi: 0xbf}, + // Block 0x60, offset 0x21f + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + // Block 0x61, offset 0x222 + {value: 0x000c, lo: 0x04}, + {value: 0x173a, lo: 0x9c, hi: 0x9d}, + {value: 0x014f, lo: 0x9e, hi: 0x9e}, + {value: 0x174a, lo: 0x9f, hi: 0x9f}, + {value: 0x01a6, lo: 0xa9, hi: 0xa9}, + // Block 0x62, offset 0x227 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xad, hi: 0xad}, + // Block 0x63, offset 0x229 + {value: 0x0000, lo: 0x06}, + {value: 0xe500, lo: 0x80, hi: 0x80}, + {value: 0xc600, lo: 0x81, hi: 0x9b}, + {value: 0xe500, lo: 0x9c, hi: 0x9c}, + {value: 0xc600, lo: 0x9d, hi: 0xb7}, + {value: 0xe500, lo: 0xb8, hi: 0xb8}, + {value: 0xc600, lo: 0xb9, hi: 0xbf}, + // Block 0x64, offset 0x230 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x93}, + {value: 0xe500, lo: 0x94, hi: 0x94}, + {value: 0xc600, lo: 0x95, hi: 0xaf}, + {value: 0xe500, lo: 0xb0, hi: 0xb0}, + {value: 0xc600, lo: 0xb1, hi: 0xbf}, + // Block 0x65, offset 0x236 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8b}, + {value: 0xe500, lo: 0x8c, hi: 0x8c}, + {value: 0xc600, lo: 0x8d, hi: 0xa7}, + {value: 0xe500, lo: 0xa8, hi: 0xa8}, + {value: 0xc600, lo: 0xa9, hi: 0xbf}, + // Block 0x66, offset 0x23c + {value: 0x0000, lo: 0x07}, + {value: 0xc600, lo: 0x80, hi: 0x83}, + {value: 0xe500, lo: 0x84, hi: 0x84}, + {value: 0xc600, lo: 0x85, hi: 0x9f}, + {value: 0xe500, lo: 0xa0, hi: 0xa0}, + {value: 0xc600, lo: 0xa1, hi: 0xbb}, + {value: 0xe500, lo: 0xbc, hi: 0xbc}, + {value: 0xc600, lo: 0xbd, hi: 0xbf}, + // Block 0x67, offset 0x244 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x97}, + {value: 0xe500, lo: 0x98, hi: 0x98}, + {value: 0xc600, lo: 0x99, hi: 0xb3}, + {value: 0xe500, lo: 0xb4, hi: 0xb4}, + {value: 0xc600, lo: 0xb5, hi: 0xbf}, + // Block 0x68, offset 0x24a + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8f}, + {value: 0xe500, lo: 0x90, hi: 0x90}, + {value: 0xc600, lo: 0x91, hi: 0xab}, + {value: 0xe500, lo: 0xac, hi: 0xac}, + {value: 0xc600, lo: 0xad, hi: 0xbf}, + // Block 0x69, offset 0x250 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + {value: 0xe500, lo: 0xa4, hi: 0xa4}, + {value: 0xc600, lo: 0xa5, hi: 0xbf}, + // Block 0x6a, offset 0x256 + {value: 0x0000, lo: 0x03}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + // Block 0x6b, offset 0x25a + {value: 0x0002, lo: 0x01}, + {value: 0x0003, lo: 0x81, hi: 0xbf}, + // Block 0x6c, offset 0x25c + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0x6d, offset 0x25e + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xa0, hi: 0xa0}, + // Block 0x6e, offset 0x260 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb6, hi: 0xba}, + // Block 0x6f, offset 0x262 + {value: 0x002d, lo: 0x05}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + {value: 0x8133, lo: 0xb8, hi: 0xb8}, + {value: 0x8101, lo: 0xb9, hi: 0xba}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x70, offset 0x268 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xa5, hi: 0xa5}, + {value: 0x812e, lo: 0xa6, hi: 0xa6}, + // Block 0x71, offset 0x26b + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa4, hi: 0xa7}, + // Block 0x72, offset 0x26d + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + // Block 0x73, offset 0x26f + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbf}, + // Block 0x74, offset 0x271 + {value: 0x0000, lo: 0x05}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x8133, lo: 0x88, hi: 0x8a}, + {value: 0x812e, lo: 0x8b, hi: 0x8b}, + {value: 0x8133, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x8d, hi: 0x90}, + // Block 0x75, offset 0x277 + {value: 0x0005, lo: 0x03}, + {value: 0x8133, lo: 0x82, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + // Block 0x76, offset 0x27b + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xb0, hi: 0xb0}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x77, offset 0x27f + {value: 0x17fe, lo: 0x07}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4379, lo: 0x9a, hi: 0x9a}, + {value: 0xa000, lo: 0x9b, hi: 0x9b}, + {value: 0x4383, lo: 0x9c, hi: 0x9c}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x438d, lo: 0xab, hi: 0xab}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x78, offset 0x287 + {value: 0x0000, lo: 0x06}, + {value: 0x8133, lo: 0x80, hi: 0x82}, + {value: 0x9900, lo: 0xa7, hi: 0xa7}, + {value: 0x2eb5, lo: 0xae, hi: 0xae}, + {value: 0x2ebf, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb1, hi: 0xb2}, + {value: 0x8105, lo: 0xb3, hi: 0xb4}, + // Block 0x79, offset 0x28e + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0x7a, offset 0x291 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb5, hi: 0xb5}, + {value: 0x8103, lo: 0xb6, hi: 0xb6}, + // Block 0x7b, offset 0x294 + {value: 0x0002, lo: 0x01}, + {value: 0x8103, lo: 0xa9, hi: 0xaa}, + // Block 0x7c, offset 0x296 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x7d, offset 0x299 + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ec9, lo: 0x8b, hi: 0x8b}, + {value: 0x2ed3, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x8133, lo: 0xa6, hi: 0xac}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + // Block 0x7e, offset 0x2a1 + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x86, hi: 0x86}, + {value: 0x8133, lo: 0x9e, hi: 0x9e}, + // Block 0x7f, offset 0x2a5 + {value: 0x6a23, lo: 0x06}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb9, hi: 0xb9}, + {value: 0x9900, lo: 0xba, hi: 0xba}, + {value: 0x2ee7, lo: 0xbb, hi: 0xbb}, + {value: 0x2edd, lo: 0xbc, hi: 0xbd}, + {value: 0x2ef1, lo: 0xbe, hi: 0xbe}, + // Block 0x80, offset 0x2ac + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x81, offset 0x2af + {value: 0x0000, lo: 0x05}, + {value: 0x9900, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb8, hi: 0xb9}, + {value: 0x2efb, lo: 0xba, hi: 0xba}, + {value: 0x2f05, lo: 0xbb, hi: 0xbb}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x82, offset 0x2b5 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x80, hi: 0x80}, + // Block 0x83, offset 0x2b7 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x84, offset 0x2b9 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x85, offset 0x2bc + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xab, hi: 0xab}, + // Block 0x86, offset 0x2be + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb9, hi: 0xb9}, + {value: 0x8103, lo: 0xba, hi: 0xba}, + // Block 0x87, offset 0x2c1 + {value: 0x0000, lo: 0x04}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb5, hi: 0xb5}, + {value: 0x2f0f, lo: 0xb8, hi: 0xb8}, + {value: 0x8105, lo: 0xbd, hi: 0xbe}, + // Block 0x88, offset 0x2c6 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x89, offset 0x2c8 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + // Block 0x8a, offset 0x2ca + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x8b, offset 0x2cc + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x87, hi: 0x87}, + // Block 0x8c, offset 0x2ce + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x99, hi: 0x99}, + // Block 0x8d, offset 0x2d0 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0x82, hi: 0x82}, + {value: 0x8105, lo: 0x84, hi: 0x85}, + // Block 0x8e, offset 0x2d3 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x97, hi: 0x97}, + // Block 0x8f, offset 0x2d5 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x81, hi: 0x82}, + // Block 0x90, offset 0x2d7 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0xb0, hi: 0xb4}, + // Block 0x91, offset 0x2d9 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb6}, + // Block 0x92, offset 0x2db + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb0, hi: 0xb1}, + // Block 0x93, offset 0x2dd + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0x9e, hi: 0x9e}, + // Block 0x94, offset 0x2df + {value: 0x0000, lo: 0x0c}, + {value: 0x470d, lo: 0x9e, hi: 0x9e}, + {value: 0x4717, lo: 0x9f, hi: 0x9f}, + {value: 0x474b, lo: 0xa0, hi: 0xa0}, + {value: 0x4759, lo: 0xa1, hi: 0xa1}, + {value: 0x4767, lo: 0xa2, hi: 0xa2}, + {value: 0x4775, lo: 0xa3, hi: 0xa3}, + {value: 0x4783, lo: 0xa4, hi: 0xa4}, + {value: 0x812c, lo: 0xa5, hi: 0xa6}, + {value: 0x8101, lo: 0xa7, hi: 0xa9}, + {value: 0x8131, lo: 0xad, hi: 0xad}, + {value: 0x812c, lo: 0xae, hi: 0xb2}, + {value: 0x812e, lo: 0xbb, hi: 0xbf}, + // Block 0x95, offset 0x2ec + {value: 0x0000, lo: 0x09}, + {value: 0x812e, lo: 0x80, hi: 0x82}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8b}, + {value: 0x8133, lo: 0xaa, hi: 0xad}, + {value: 0x4721, lo: 0xbb, hi: 0xbb}, + {value: 0x472b, lo: 0xbc, hi: 0xbc}, + {value: 0x4791, lo: 0xbd, hi: 0xbd}, + {value: 0x47ad, lo: 0xbe, hi: 0xbe}, + {value: 0x479f, lo: 0xbf, hi: 0xbf}, + // Block 0x96, offset 0x2f6 + {value: 0x0000, lo: 0x01}, + {value: 0x47bb, lo: 0x80, hi: 0x80}, + // Block 0x97, offset 0x2f8 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x82, hi: 0x84}, + // Block 0x98, offset 0x2fa + {value: 0x0002, lo: 0x03}, + {value: 0x0043, lo: 0x80, hi: 0x99}, + {value: 0x0083, lo: 0x9a, hi: 0xb3}, + {value: 0x0043, lo: 0xb4, hi: 0xbf}, + // Block 0x99, offset 0x2fe + {value: 0x0002, lo: 0x04}, + {value: 0x005b, lo: 0x80, hi: 0x8d}, + {value: 0x0083, lo: 0x8e, hi: 0x94}, + {value: 0x0093, lo: 0x96, hi: 0xa7}, + {value: 0x0043, lo: 0xa8, hi: 0xbf}, + // Block 0x9a, offset 0x303 + {value: 0x0002, lo: 0x0b}, + {value: 0x0073, lo: 0x80, hi: 0x81}, + {value: 0x0083, lo: 0x82, hi: 0x9b}, + {value: 0x0043, lo: 0x9c, hi: 0x9c}, + {value: 0x0047, lo: 0x9e, hi: 0x9f}, + {value: 0x004f, lo: 0xa2, hi: 0xa2}, + {value: 0x0055, lo: 0xa5, hi: 0xa6}, + {value: 0x005d, lo: 0xa9, hi: 0xac}, + {value: 0x0067, lo: 0xae, hi: 0xb5}, + {value: 0x0083, lo: 0xb6, hi: 0xb9}, + {value: 0x008d, lo: 0xbb, hi: 0xbb}, + {value: 0x0091, lo: 0xbd, hi: 0xbf}, + // Block 0x9b, offset 0x30f + {value: 0x0002, lo: 0x04}, + {value: 0x0097, lo: 0x80, hi: 0x83}, + {value: 0x00a1, lo: 0x85, hi: 0x8f}, + {value: 0x0043, lo: 0x90, hi: 0xa9}, + {value: 0x0083, lo: 0xaa, hi: 0xbf}, + // Block 0x9c, offset 0x314 + {value: 0x0002, lo: 0x08}, + {value: 0x00af, lo: 0x80, hi: 0x83}, + {value: 0x0043, lo: 0x84, hi: 0x85}, + {value: 0x0049, lo: 0x87, hi: 0x8a}, + {value: 0x0055, lo: 0x8d, hi: 0x94}, + {value: 0x0067, lo: 0x96, hi: 0x9c}, + {value: 0x0083, lo: 0x9e, hi: 0xb7}, + {value: 0x0043, lo: 0xb8, hi: 0xb9}, + {value: 0x0049, lo: 0xbb, hi: 0xbe}, + // Block 0x9d, offset 0x31d + {value: 0x0002, lo: 0x05}, + {value: 0x0053, lo: 0x80, hi: 0x84}, + {value: 0x005f, lo: 0x86, hi: 0x86}, + {value: 0x0067, lo: 0x8a, hi: 0x90}, + {value: 0x0083, lo: 0x92, hi: 0xab}, + {value: 0x0043, lo: 0xac, hi: 0xbf}, + // Block 0x9e, offset 0x323 + {value: 0x0002, lo: 0x04}, + {value: 0x006b, lo: 0x80, hi: 0x85}, + {value: 0x0083, lo: 0x86, hi: 0x9f}, + {value: 0x0043, lo: 0xa0, hi: 0xb9}, + {value: 0x0083, lo: 0xba, hi: 0xbf}, + // Block 0x9f, offset 0x328 + {value: 0x0002, lo: 0x03}, + {value: 0x008f, lo: 0x80, hi: 0x93}, + {value: 0x0043, lo: 0x94, hi: 0xad}, + {value: 0x0083, lo: 0xae, hi: 0xbf}, + // Block 0xa0, offset 0x32c + {value: 0x0002, lo: 0x04}, + {value: 0x00a7, lo: 0x80, hi: 0x87}, + {value: 0x0043, lo: 0x88, hi: 0xa1}, + {value: 0x0083, lo: 0xa2, hi: 0xbb}, + {value: 0x0043, lo: 0xbc, hi: 0xbf}, + // Block 0xa1, offset 0x331 + {value: 0x0002, lo: 0x03}, + {value: 0x004b, lo: 0x80, hi: 0x95}, + {value: 0x0083, lo: 0x96, hi: 0xaf}, + {value: 0x0043, lo: 0xb0, hi: 0xbf}, + // Block 0xa2, offset 0x335 + {value: 0x0003, lo: 0x0f}, + {value: 0x023c, lo: 0x80, hi: 0x80}, + {value: 0x0556, lo: 0x81, hi: 0x81}, + {value: 0x023f, lo: 0x82, hi: 0x9a}, + {value: 0x0552, lo: 0x9b, hi: 0x9b}, + {value: 0x024b, lo: 0x9c, hi: 0x9c}, + {value: 0x0254, lo: 0x9d, hi: 0x9d}, + {value: 0x025a, lo: 0x9e, hi: 0x9e}, + {value: 0x027e, lo: 0x9f, hi: 0x9f}, + {value: 0x026f, lo: 0xa0, hi: 0xa0}, + {value: 0x026c, lo: 0xa1, hi: 0xa1}, + {value: 0x01f7, lo: 0xa2, hi: 0xb2}, + {value: 0x020c, lo: 0xb3, hi: 0xb3}, + {value: 0x022a, lo: 0xb4, hi: 0xba}, + {value: 0x0556, lo: 0xbb, hi: 0xbb}, + {value: 0x023f, lo: 0xbc, hi: 0xbf}, + // Block 0xa3, offset 0x345 + {value: 0x0003, lo: 0x0d}, + {value: 0x024b, lo: 0x80, hi: 0x94}, + {value: 0x0552, lo: 0x95, hi: 0x95}, + {value: 0x024b, lo: 0x96, hi: 0x96}, + {value: 0x0254, lo: 0x97, hi: 0x97}, + {value: 0x025a, lo: 0x98, hi: 0x98}, + {value: 0x027e, lo: 0x99, hi: 0x99}, + {value: 0x026f, lo: 0x9a, hi: 0x9a}, + {value: 0x026c, lo: 0x9b, hi: 0x9b}, + {value: 0x01f7, lo: 0x9c, hi: 0xac}, + {value: 0x020c, lo: 0xad, hi: 0xad}, + {value: 0x022a, lo: 0xae, hi: 0xb4}, + {value: 0x0556, lo: 0xb5, hi: 0xb5}, + {value: 0x023f, lo: 0xb6, hi: 0xbf}, + // Block 0xa4, offset 0x353 + {value: 0x0003, lo: 0x0d}, + {value: 0x025d, lo: 0x80, hi: 0x8e}, + {value: 0x0552, lo: 0x8f, hi: 0x8f}, + {value: 0x024b, lo: 0x90, hi: 0x90}, + {value: 0x0254, lo: 0x91, hi: 0x91}, + {value: 0x025a, lo: 0x92, hi: 0x92}, + {value: 0x027e, lo: 0x93, hi: 0x93}, + {value: 0x026f, lo: 0x94, hi: 0x94}, + {value: 0x026c, lo: 0x95, hi: 0x95}, + {value: 0x01f7, lo: 0x96, hi: 0xa6}, + {value: 0x020c, lo: 0xa7, hi: 0xa7}, + {value: 0x022a, lo: 0xa8, hi: 0xae}, + {value: 0x0556, lo: 0xaf, hi: 0xaf}, + {value: 0x023f, lo: 0xb0, hi: 0xbf}, + // Block 0xa5, offset 0x361 + {value: 0x0003, lo: 0x0d}, + {value: 0x026f, lo: 0x80, hi: 0x88}, + {value: 0x0552, lo: 0x89, hi: 0x89}, + {value: 0x024b, lo: 0x8a, hi: 0x8a}, + {value: 0x0254, lo: 0x8b, hi: 0x8b}, + {value: 0x025a, lo: 0x8c, hi: 0x8c}, + {value: 0x027e, lo: 0x8d, hi: 0x8d}, + {value: 0x026f, lo: 0x8e, hi: 0x8e}, + {value: 0x026c, lo: 0x8f, hi: 0x8f}, + {value: 0x01f7, lo: 0x90, hi: 0xa0}, + {value: 0x020c, lo: 0xa1, hi: 0xa1}, + {value: 0x022a, lo: 0xa2, hi: 0xa8}, + {value: 0x0556, lo: 0xa9, hi: 0xa9}, + {value: 0x023f, lo: 0xaa, hi: 0xbf}, + // Block 0xa6, offset 0x36f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + // Block 0xa7, offset 0x371 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xae, hi: 0xae}, + // Block 0xa8, offset 0x373 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xac, hi: 0xaf}, + // Block 0xa9, offset 0x375 + {value: 0x0000, lo: 0x03}, + {value: 0x8134, lo: 0xac, hi: 0xad}, + {value: 0x812e, lo: 0xae, hi: 0xae}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + // Block 0xaa, offset 0x379 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x90, hi: 0x96}, + // Block 0xab, offset 0x37b + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x84, hi: 0x89}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0xac, offset 0x37e + {value: 0x0002, lo: 0x0a}, + {value: 0x0063, lo: 0x80, hi: 0x89}, + {value: 0x1a7e, lo: 0x8a, hi: 0x8a}, + {value: 0x1ab1, lo: 0x8b, hi: 0x8b}, + {value: 0x1acc, lo: 0x8c, hi: 0x8c}, + {value: 0x1ad2, lo: 0x8d, hi: 0x8d}, + {value: 0x1cf0, lo: 0x8e, hi: 0x8e}, + {value: 0x1ade, lo: 0x8f, hi: 0x8f}, + {value: 0x1aa8, lo: 0xaa, hi: 0xaa}, + {value: 0x1aab, lo: 0xab, hi: 0xab}, + {value: 0x1aae, lo: 0xac, hi: 0xac}, + // Block 0xad, offset 0x389 + {value: 0x0000, lo: 0x01}, + {value: 0x1a6c, lo: 0x90, hi: 0x90}, + // Block 0xae, offset 0x38b + {value: 0x0028, lo: 0x09}, + {value: 0x2999, lo: 0x80, hi: 0x80}, + {value: 0x295d, lo: 0x81, hi: 0x81}, + {value: 0x2967, lo: 0x82, hi: 0x82}, + {value: 0x297b, lo: 0x83, hi: 0x84}, + {value: 0x2985, lo: 0x85, hi: 0x86}, + {value: 0x2971, lo: 0x87, hi: 0x87}, + {value: 0x298f, lo: 0x88, hi: 0x88}, + {value: 0x0c6a, lo: 0x90, hi: 0x90}, + {value: 0x09e2, lo: 0x91, hi: 0x91}, + // Block 0xaf, offset 0x395 + {value: 0x0002, lo: 0x01}, + {value: 0x0021, lo: 0xb0, hi: 0xb9}, +} + +// recompMap: 7528 bytes (entries only) +var recompMap map[uint32]rune +var recompMapOnce sync.Once + +const recompMapPacked = "" + + "\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0 + "\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1 + "\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2 + "\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3 + "\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4 + "\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5 + "\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7 + "\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8 + "\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9 + "\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA + "\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB + "\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC + "\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD + "\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE + "\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF + "\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1 + "\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2 + "\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3 + "\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4 + "\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5 + "\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6 + "\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9 + "\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA + "\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB + "\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC + "\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD + "\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0 + "\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1 + "\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2 + "\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3 + "\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4 + "\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5 + "\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7 + "\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8 + "\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9 + "\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA + "\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB + "\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC + "\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED + "\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE + "\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF + "\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1 + "\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2 + "\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3 + "\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4 + "\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5 + "\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6 + "\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9 + "\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA + "\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB + "\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC + "\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD + "\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF + "\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100 + "\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101 + "\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102 + "\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103 + "\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104 + "\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105 + "\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106 + "\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107 + "\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108 + "\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109 + "\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A + "\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B + "\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C + "\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D + "\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E + "\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F + "\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112 + "\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113 + "\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114 + "\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115 + "\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116 + "\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117 + "\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118 + "\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119 + "\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A + "\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B + "\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C + "\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D + "\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E + "\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F + "\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120 + "\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121 + "\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122 + "\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123 + "\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124 + "\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125 + "\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128 + "\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129 + "\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A + "\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B + "\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C + "\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D + "\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E + "\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F + "\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130 + "\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134 + "\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135 + "\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136 + "\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137 + "\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139 + "\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A + "\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B + "\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C + "\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D + "\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E + "\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143 + "\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144 + "\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145 + "\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146 + "\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147 + "\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148 + "\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C + "\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D + "\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E + "\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F + "\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150 + "\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151 + "\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154 + "\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155 + "\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156 + "\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157 + "\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158 + "\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159 + "\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A + "\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B + "\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C + "\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D + "\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E + "\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F + "\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160 + "\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161 + "\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162 + "\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163 + "\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164 + "\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165 + "\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168 + "\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169 + "\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A + "\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B + "\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C + "\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D + "\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E + "\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F + "\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170 + "\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171 + "\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172 + "\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173 + "\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174 + "\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175 + "\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176 + "\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177 + "\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178 + "\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179 + "\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A + "\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B + "\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C + "\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D + "\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E + "\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0 + "\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1 + "\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF + "\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0 + "\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD + "\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE + "\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF + "\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0 + "\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1 + "\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2 + "\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3 + "\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4 + "\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5 + "\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6 + "\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7 + "\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8 + "\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9 + "\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA + "\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB + "\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC + "\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE + "\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF + "\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0 + "\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1 + "\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2 + "\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3 + "\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6 + "\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7 + "\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8 + "\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9 + "\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA + "\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB + "\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC + "\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED + "\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE + "\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF + "\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0 + "\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4 + "\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5 + "\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8 + "\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9 + "\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA + "\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB + "\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC + "\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD + "\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE + "\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF + "\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200 + "\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201 + "\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202 + "\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203 + "\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204 + "\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205 + "\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206 + "\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207 + "\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208 + "\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209 + "\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A + "\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B + "\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C + "\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D + "\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E + "\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F + "\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210 + "\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211 + "\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212 + "\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213 + "\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214 + "\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215 + "\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216 + "\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217 + "\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218 + "\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219 + "\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A + "\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B + "\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E + "\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F + "\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226 + "\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227 + "\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228 + "\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229 + "\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A + "\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B + "\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C + "\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D + "\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E + "\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F + "\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230 + "\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231 + "\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232 + "\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233 + "\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385 + "\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386 + "\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388 + "\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389 + "\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A + "\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C + "\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E + "\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F + "\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390 + "\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA + "\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB + "\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC + "\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD + "\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE + "\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF + "\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0 + "\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA + "\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB + "\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC + "\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD + "\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE + "\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3 + "\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4 + "\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400 + "\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401 + "\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403 + "\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407 + "\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C + "\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D + "\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E + "\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419 + "\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439 + "\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450 + "\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451 + "\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453 + "\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457 + "\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C + "\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D + "\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E + "\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476 + "\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477 + "\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1 + "\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2 + "\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0 + "\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1 + "\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2 + "\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3 + "\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6 + "\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7 + "\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA + "\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB + "\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC + "\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD + "\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE + "\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF + "\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2 + "\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3 + "\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4 + "\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5 + "\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6 + "\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7 + "\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA + "\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB + "\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC + "\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED + "\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE + "\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF + "\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0 + "\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1 + "\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2 + "\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3 + "\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4 + "\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5 + "\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8 + "\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9 + "\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622 + "\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623 + "\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624 + "\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625 + "\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626 + "\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0 + "\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2 + "\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3 + "\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929 + "\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931 + "\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934 + "\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB + "\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC + "\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48 + "\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B + "\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C + "\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94 + "\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA + "\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB + "\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC + "\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48 + "\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0 + "\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7 + "\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8 + "\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA + "\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB + "\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A + "\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B + "\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C + "\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA + "\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC + "\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD + "\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE + "\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026 + "\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06 + "\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08 + "\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A + "\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C + "\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E + "\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12 + "\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B + "\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D + "\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40 + "\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41 + "\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43 + "\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00 + "\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01 + "\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02 + "\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03 + "\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04 + "\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05 + "\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06 + "\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07 + "\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08 + "\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09 + "\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A + "\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B + "\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C + "\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D + "\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E + "\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F + "\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10 + "\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11 + "\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12 + "\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13 + "\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14 + "\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15 + "\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16 + "\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17 + "\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18 + "\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19 + "\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A + "\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B + "\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C + "\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D + "\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E + "\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F + "\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20 + "\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21 + "\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22 + "\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23 + "\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24 + "\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25 + "\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26 + "\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27 + "\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28 + "\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29 + "\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A + "\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B + "\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C + "\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D + "\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E + "\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F + "\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30 + "\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31 + "\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32 + "\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33 + "\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34 + "\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35 + "\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36 + "\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37 + "\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38 + "\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39 + "\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A + "\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B + "\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C + "\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D + "\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E + "\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F + "\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40 + "\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41 + "\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42 + "\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43 + "\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44 + "\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45 + "\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46 + "\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47 + "\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48 + "\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49 + "\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A + "\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B + "\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C + "\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D + "\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E + "\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F + "\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50 + "\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51 + "\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52 + "\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53 + "\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54 + "\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55 + "\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56 + "\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57 + "\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58 + "\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59 + "\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A + "\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B + "\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C + "\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D + "\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E + "\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F + "\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60 + "\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61 + "\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62 + "\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63 + "\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64 + "\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65 + "\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66 + "\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67 + "\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68 + "\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69 + "\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A + "\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B + "\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C + "\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D + "\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E + "\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F + "\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70 + "\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71 + "\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72 + "\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73 + "\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74 + "\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75 + "\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76 + "\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77 + "\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78 + "\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79 + "\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A + "\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B + "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C + "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D + "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E + "\x00v\x03#\x00\x00\x1e\x7f" + // 0x00760323: 0x00001E7F + "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80 + "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81 + "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82 + "\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83 + "\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84 + "\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85 + "\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86 + "\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87 + "\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88 + "\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89 + "\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A + "\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B + "\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C + "\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D + "\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E + "\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F + "\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90 + "\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91 + "\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92 + "\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93 + "\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94 + "\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95 + "\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96 + "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97 + "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98 + "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99 + "\x01\x7f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B + "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0 + "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1 + "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2 + "\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3 + "\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4 + "\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5 + "\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6 + "\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7 + "\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8 + "\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9 + "\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA + "\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB + "\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC + "\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD + "\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE + "\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF + "\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0 + "\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1 + "\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2 + "\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3 + "\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4 + "\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5 + "\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6 + "\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7 + "\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8 + "\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9 + "\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA + "\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB + "\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC + "\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD + "\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE + "\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF + "\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0 + "\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1 + "\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2 + "\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3 + "\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4 + "\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5 + "\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6 + "\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7 + "\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8 + "\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9 + "\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA + "\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB + "\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC + "\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD + "\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE + "\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF + "\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0 + "\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1 + "\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2 + "\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3 + "\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4 + "\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5 + "\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6 + "\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7 + "\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8 + "\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9 + "\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA + "\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB + "\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC + "\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD + "\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE + "\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF + "\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0 + "\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1 + "\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2 + "\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3 + "\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4 + "\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5 + "\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6 + "\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7 + "\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8 + "\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9 + "\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA + "\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB + "\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC + "\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED + "\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE + "\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF + "\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0 + "\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1 + "\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2 + "\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3 + "\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4 + "\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5 + "\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6 + "\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7 + "\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8 + "\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9 + "\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00 + "\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01 + "\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02 + "\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03 + "\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04 + "\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05 + "\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06 + "\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07 + "\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08 + "\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09 + "\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A + "\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B + "\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C + "\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D + "\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E + "\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F + "\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10 + "\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11 + "\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12 + "\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13 + "\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14 + "\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15 + "\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18 + "\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19 + "\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A + "\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B + "\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C + "\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D + "\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20 + "\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21 + "\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22 + "\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23 + "\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24 + "\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25 + "\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26 + "\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27 + "\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28 + "\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29 + "\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A + "\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B + "\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C + "\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D + "\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E + "\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F + "\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30 + "\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31 + "\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32 + "\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33 + "\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34 + "\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35 + "\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36 + "\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37 + "\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38 + "\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39 + "\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A + "\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B + "\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C + "\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D + "\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E + "\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F + "\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40 + "\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41 + "\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42 + "\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43 + "\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44 + "\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45 + "\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48 + "\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49 + "\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A + "\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B + "\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C + "\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D + "\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50 + "\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51 + "\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52 + "\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53 + "\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54 + "\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55 + "\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56 + "\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57 + "\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59 + "\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B + "\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D + "\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F + "\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60 + "\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61 + "\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62 + "\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63 + "\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64 + "\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65 + "\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66 + "\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67 + "\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68 + "\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69 + "\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A + "\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B + "\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C + "\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D + "\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E + "\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F + "\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70 + "\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72 + "\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74 + "\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76 + "\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78 + "\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A + "\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C + "\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80 + "\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81 + "\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82 + "\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83 + "\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84 + "\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85 + "\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86 + "\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87 + "\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88 + "\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89 + "\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A + "\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B + "\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C + "\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D + "\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E + "\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F + "\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90 + "\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91 + "\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92 + "\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93 + "\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94 + "\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95 + "\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96 + "\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97 + "\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98 + "\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99 + "\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A + "\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B + "\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C + "\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D + "\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E + "\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F + "\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0 + "\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1 + "\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2 + "\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3 + "\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4 + "\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5 + "\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6 + "\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7 + "\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8 + "\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9 + "\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA + "\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB + "\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC + "\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD + "\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE + "\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF + "\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0 + "\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1 + "\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2 + "\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3 + "\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4 + "\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6 + "\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7 + "\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8 + "\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9 + "\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA + "\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC + "\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1 + "\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2 + "\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3 + "\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4 + "\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6 + "\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7 + "\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8 + "\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA + "\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC + "\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD + "\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE + "\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF + "\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0 + "\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1 + "\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2 + "\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6 + "\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7 + "\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8 + "\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9 + "\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA + "\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD + "\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE + "\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF + "\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0 + "\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1 + "\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2 + "\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4 + "\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5 + "\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6 + "\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7 + "\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8 + "\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9 + "\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA + "\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC + "\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED + "\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2 + "\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3 + "\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4 + "\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6 + "\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7 + "\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8 + "\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA + "\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC + "!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A + "!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B + "!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE + "!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD + "!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE + "!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF + "\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204 + "\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209 + "\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C + "\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224 + "\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226 + "\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241 + "\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244 + "\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247 + "\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249 + "\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260 + "\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262 + "\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D + "\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E + "\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F + "\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270 + "\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271 + "\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274 + "\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275 + "\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278 + "\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279 + "\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280 + "\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281 + "\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284 + "\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285 + "\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288 + "\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289 + "\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC + "\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD + "\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE + "\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF + "\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0 + "\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1 + "\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2 + "\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3 + "\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA + "\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB + "\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC + "\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED + "0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C + "0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E + "0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050 + "0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052 + "0S0\x99\x00\x000T" + // 0x30533099: 0x00003054 + "0U0\x99\x00\x000V" + // 0x30553099: 0x00003056 + "0W0\x99\x00\x000X" + // 0x30573099: 0x00003058 + "0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A + "0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C + "0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E + "0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060 + "0a0\x99\x00\x000b" + // 0x30613099: 0x00003062 + "0d0\x99\x00\x000e" + // 0x30643099: 0x00003065 + "0f0\x99\x00\x000g" + // 0x30663099: 0x00003067 + "0h0\x99\x00\x000i" + // 0x30683099: 0x00003069 + "0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070 + "0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071 + "0r0\x99\x00\x000s" + // 0x30723099: 0x00003073 + "0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074 + "0u0\x99\x00\x000v" + // 0x30753099: 0x00003076 + "0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077 + "0x0\x99\x00\x000y" + // 0x30783099: 0x00003079 + "0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A + "0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C + "0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D + "0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094 + "0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E + "0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC + "0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE + "0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0 + "0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2 + "0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4 + "0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6 + "0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8 + "0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA + "0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC + "0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE + "0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0 + "0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2 + "0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5 + "0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7 + "0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9 + "0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0 + "0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1 + "0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3 + "0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4 + "0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6 + "0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7 + "0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9 + "0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA + "0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC + "0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD + "0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4 + "0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7 + "0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8 + "0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9 + "0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA + "0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE + "\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A + "\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C + "\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB + "\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E + "\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F + "\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B + "\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C + "\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB + "\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC + "\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE + "\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA + "\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB + "\x195\x190\x00\x01\x198" + // 0x19351930: 0x00011938 + "" + // Total size of tables: 56KB (57068 bytes) diff --git a/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go index 0175eae5..bf65457d 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go @@ -1,7 +1,6 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. //go:build !go1.10 -// +build !go1.10 package norm diff --git a/vendor/golang.org/x/text/unicode/norm/trie.go b/vendor/golang.org/x/text/unicode/norm/trie.go index 423386bf..e4250ae2 100644 --- a/vendor/golang.org/x/text/unicode/norm/trie.go +++ b/vendor/golang.org/x/text/unicode/norm/trie.go @@ -29,7 +29,7 @@ var ( nfkcData = newNfkcTrie(0) ) -// lookupValue determines the type of block n and looks up the value for b. +// lookup determines the type of block n and looks up the value for b. // For n < t.cutoff, the block is a simple lookup table. Otherwise, the block // is a list of ranges with an accompanying value. Given a matching range r, // the value for b is by r.value + (b - r.lo) * stride. diff --git a/vendor/modules.txt b/vendor/modules.txt index 9272f12d..d2f38372 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -355,8 +355,8 @@ github.com/spf13/pflag # github.com/xanzy/ssh-agent v0.3.0 ## explicit github.com/xanzy/ssh-agent -# golang.org/x/crypto v0.6.0 -## explicit; go 1.17 +# golang.org/x/crypto v0.17.0 +## explicit; go 1.18 golang.org/x/crypto/blowfish golang.org/x/crypto/cast5 golang.org/x/crypto/chacha20 @@ -373,7 +373,7 @@ golang.org/x/crypto/ssh/knownhosts ## explicit; go 1.11 golang.org/x/lint golang.org/x/lint/golint -# golang.org/x/net v0.8.0 +# golang.org/x/net v0.10.0 ## explicit; go 1.17 golang.org/x/net/context golang.org/x/net/context/ctxhttp @@ -390,19 +390,18 @@ golang.org/x/net/proxy ## explicit; go 1.11 golang.org/x/oauth2 golang.org/x/oauth2/internal -# golang.org/x/sys v0.6.0 -## explicit; go 1.17 +# golang.org/x/sys v0.15.0 +## explicit; go 1.18 golang.org/x/sys/cpu golang.org/x/sys/execabs -golang.org/x/sys/internal/unsafeheader golang.org/x/sys/plan9 golang.org/x/sys/unix golang.org/x/sys/windows -# golang.org/x/term v0.6.0 -## explicit; go 1.17 +# golang.org/x/term v0.15.0 +## explicit; go 1.18 golang.org/x/term -# golang.org/x/text v0.8.0 -## explicit; go 1.17 +# golang.org/x/text v0.14.0 +## explicit; go 1.18 golang.org/x/text/encoding golang.org/x/text/encoding/charmap golang.org/x/text/encoding/htmlindex