From 0f2ff61dfa8c62fcb5356bd6f6a3c02880391e7c Mon Sep 17 00:00:00 2001 From: Kubernetes Publisher Date: Thu, 24 Aug 2017 04:38:04 -0700 Subject: [PATCH] Merge pull request #51154 from RenaudWasTaken/gRPC-updated-1-3-0 Automatic merge from submit-queue (batch tested with PRs 51193, 51154, 42689, 51189, 51200) Bumped gRPC version to 1.3.0 **What this PR does / why we need it**: This PR bumps down the version of the vendored version of gRPC from v1.5.1 to v1.3.0 This is needed as part of the Device Plugin API where we expect client and server to use the Keep alive feature in order to detect an error. Unfortunately I had to also bump the version of `golang.org/x/text` and `golang.org/x/net`. - Design document: kubernetes/community#695 - PR tracking: [kubernetes/features#368](https://github.com/kubernetes/features/issues/368#issuecomment-321625420) **Which issue this PR fixes**: fixes #51099 Which was caused by my previous PR updating to 1.5.1 **Special notes for your reviewer**: @vishh @jiayingz @shyamjvs **Release note**: ``` Bumped gRPC to v1.3.0 ``` Kubernetes-commit: 5fb38a325efb343c2a0467a12732829bd5ed3c3c --- vendor/golang.org/x/net/context/context.go | 112 +- vendor/golang.org/x/net/context/go17.go | 4 +- vendor/golang.org/x/net/context/go19.go | 20 + vendor/golang.org/x/net/context/pre_go17.go | 18 +- vendor/golang.org/x/net/context/pre_go19.go | 109 + vendor/golang.org/x/net/http2/ciphers.go | 641 ++ .../x/net/http2/client_conn_pool.go | 2 +- .../x/net/http2/configure_transport.go | 2 +- vendor/golang.org/x/net/http2/databuffer.go | 146 + vendor/golang.org/x/net/http2/errors.go | 13 +- vendor/golang.org/x/net/http2/fixed_buffer.go | 60 - vendor/golang.org/x/net/http2/frame.go | 81 +- vendor/golang.org/x/net/http2/go16.go | 27 - vendor/golang.org/x/net/http2/go18.go | 8 +- vendor/golang.org/x/net/http2/go19.go | 16 + vendor/golang.org/x/net/http2/hpack/encode.go | 29 +- vendor/golang.org/x/net/http2/hpack/hpack.go | 104 +- vendor/golang.org/x/net/http2/hpack/tables.go | 255 +- vendor/golang.org/x/net/http2/http2.go | 8 +- vendor/golang.org/x/net/http2/not_go16.go | 25 - vendor/golang.org/x/net/http2/not_go18.go | 2 + vendor/golang.org/x/net/http2/not_go19.go | 16 + vendor/golang.org/x/net/http2/pipe.go | 18 +- vendor/golang.org/x/net/http2/server.go | 442 +- vendor/golang.org/x/net/http2/transport.go | 256 +- .../x/net/http2/writesched_priority.go | 2 +- vendor/golang.org/x/net/idna/idna.go | 682 ++- vendor/golang.org/x/net/idna/punycode.go | 23 +- vendor/golang.org/x/net/idna/tables.go | 4477 ++++++++++++++ vendor/golang.org/x/net/idna/trie.go | 72 + vendor/golang.org/x/net/idna/trieval.go | 114 + vendor/golang.org/x/text/cases/cases.go | 53 +- vendor/golang.org/x/text/cases/context.go | 101 +- vendor/golang.org/x/text/cases/fold.go | 10 +- vendor/golang.org/x/text/cases/gen.go | 24 +- vendor/golang.org/x/text/cases/gen_trieval.go | 12 +- vendor/golang.org/x/text/cases/icu.go | 61 + vendor/golang.org/x/text/cases/info.go | 15 +- vendor/golang.org/x/text/cases/map.go | 381 +- vendor/golang.org/x/text/cases/tables.go | 390 +- vendor/golang.org/x/text/cases/trieval.go | 14 +- vendor/golang.org/x/text/internal/gen.go | 52 + vendor/golang.org/x/text/internal/internal.go | 51 + vendor/golang.org/x/text/internal/match.go | 67 + vendor/golang.org/x/text/internal/tables.go | 117 + vendor/golang.org/x/text/language/common.go | 2 +- .../x/text/language/{maketables.go => gen.go} | 208 +- vendor/golang.org/x/text/language/index.go | 1505 ++--- vendor/golang.org/x/text/language/language.go | 15 +- vendor/golang.org/x/text/language/match.go | 177 +- vendor/golang.org/x/text/language/tables.go | 5197 ++++++++++------- vendor/golang.org/x/text/runes/cond.go | 77 +- vendor/golang.org/x/text/runes/runes.go | 139 +- .../x/text/secure/bidirule/bidirule.go | 110 +- .../x/text/secure/precis/options.go | 59 +- .../x/text/secure/precis/profile.go | 214 +- .../x/text/secure/precis/profiles.go | 96 +- .../golang.org/x/text/secure/precis/tables.go | 2 +- .../x/text/secure/precis/trieval.go | 2 +- .../golang.org/x/text/transform/transform.go | 52 +- .../golang.org/x/text/unicode/bidi/bracket.go | 42 +- vendor/golang.org/x/text/unicode/bidi/core.go | 5 +- .../golang.org/x/text/unicode/bidi/tables.go | 2 +- .../golang.org/x/text/unicode/bidi/trieval.go | 2 +- .../x/text/unicode/norm/composition.go | 18 +- .../x/text/unicode/norm/forminfo.go | 49 +- .../golang.org/x/text/unicode/norm/input.go | 8 +- vendor/golang.org/x/text/unicode/norm/iter.go | 31 +- .../x/text/unicode/norm/maketables.go | 12 +- .../x/text/unicode/norm/normalize.go | 55 +- .../x/text/unicode/norm/readwriter.go | 1 - .../golang.org/x/text/unicode/norm/tables.go | 1020 ++-- vendor/golang.org/x/text/width/kind_string.go | 2 +- vendor/golang.org/x/text/width/tables.go | 2 +- vendor/golang.org/x/text/width/transform.go | 77 + vendor/golang.org/x/text/width/trieval.go | 2 +- vendor/golang.org/x/text/width/width.go | 9 +- 77 files changed, 13453 insertions(+), 4871 deletions(-) create mode 100644 vendor/golang.org/x/net/context/go19.go create mode 100644 vendor/golang.org/x/net/context/pre_go19.go create mode 100644 vendor/golang.org/x/net/http2/ciphers.go create mode 100644 vendor/golang.org/x/net/http2/databuffer.go delete mode 100644 vendor/golang.org/x/net/http2/fixed_buffer.go create mode 100644 vendor/golang.org/x/net/http2/go19.go create mode 100644 vendor/golang.org/x/net/http2/not_go19.go create mode 100644 vendor/golang.org/x/net/idna/tables.go create mode 100644 vendor/golang.org/x/net/idna/trie.go create mode 100644 vendor/golang.org/x/net/idna/trieval.go create mode 100644 vendor/golang.org/x/text/cases/icu.go create mode 100644 vendor/golang.org/x/text/internal/gen.go create mode 100644 vendor/golang.org/x/text/internal/internal.go create mode 100644 vendor/golang.org/x/text/internal/match.go create mode 100644 vendor/golang.org/x/text/internal/tables.go rename vendor/golang.org/x/text/language/{maketables.go => gen.go} (91%) diff --git a/vendor/golang.org/x/net/context/context.go b/vendor/golang.org/x/net/context/context.go index ea1a7cd..a25301a 100644 --- a/vendor/golang.org/x/net/context/context.go +++ b/vendor/golang.org/x/net/context/context.go @@ -7,7 +7,7 @@ // and between processes. // // Incoming requests to a server should create a Context, and outgoing calls to -// servers should accept a Context. The chain of function calls between must +// servers should accept a Context. The chain of function calls between must // propagate the Context, optionally replacing it with a modified copy created // using WithDeadline, WithTimeout, WithCancel, or WithValue. // @@ -16,14 +16,14 @@ // propagation: // // Do not store Contexts inside a struct type; instead, pass a Context -// explicitly to each function that needs it. The Context should be the first +// explicitly to each function that needs it. The Context should be the first // parameter, typically named ctx: // // func DoSomething(ctx context.Context, arg Arg) error { // // ... use ctx ... // } // -// Do not pass a nil Context, even if a function permits it. Pass context.TODO +// Do not pass a nil Context, even if a function permits it. Pass context.TODO // if you are unsure about which Context to use. // // Use context Values only for request-scoped data that transits processes and @@ -36,112 +36,15 @@ // Contexts. package context -import "time" - -// A Context carries a deadline, a cancelation signal, and other values across -// API boundaries. -// -// Context's methods may be called by multiple goroutines simultaneously. -type Context interface { - // Deadline returns the time when work done on behalf of this context - // should be canceled. Deadline returns ok==false when no deadline is - // set. Successive calls to Deadline return the same results. - Deadline() (deadline time.Time, ok bool) - - // Done returns a channel that's closed when work done on behalf of this - // context should be canceled. Done may return nil if this context can - // never be canceled. Successive calls to Done return the same value. - // - // WithCancel arranges for Done to be closed when cancel is called; - // WithDeadline arranges for Done to be closed when the deadline - // expires; WithTimeout arranges for Done to be closed when the timeout - // elapses. - // - // Done is provided for use in select statements: - // - // // Stream generates values with DoSomething and sends them to out - // // until DoSomething returns an error or ctx.Done is closed. - // func Stream(ctx context.Context, out chan<- Value) error { - // for { - // v, err := DoSomething(ctx) - // if err != nil { - // return err - // } - // select { - // case <-ctx.Done(): - // return ctx.Err() - // case out <- v: - // } - // } - // } - // - // See http://blog.golang.org/pipelines for more examples of how to use - // a Done channel for cancelation. - Done() <-chan struct{} - - // Err returns a non-nil error value after Done is closed. Err returns - // Canceled if the context was canceled or DeadlineExceeded if the - // context's deadline passed. No other values for Err are defined. - // After Done is closed, successive calls to Err return the same value. - Err() error - - // Value returns the value associated with this context for key, or nil - // if no value is associated with key. Successive calls to Value with - // the same key returns the same result. - // - // Use context values only for request-scoped data that transits - // processes and API boundaries, not for passing optional parameters to - // functions. - // - // A key identifies a specific value in a Context. Functions that wish - // to store values in Context typically allocate a key in a global - // variable then use that key as the argument to context.WithValue and - // Context.Value. A key can be any type that supports equality; - // packages should define keys as an unexported type to avoid - // collisions. - // - // Packages that define a Context key should provide type-safe accessors - // for the values stores using that key: - // - // // Package user defines a User type that's stored in Contexts. - // package user - // - // import "golang.org/x/net/context" - // - // // User is the type of value stored in the Contexts. - // type User struct {...} - // - // // key is an unexported type for keys defined in this package. - // // This prevents collisions with keys defined in other packages. - // type key int - // - // // userKey is the key for user.User values in Contexts. It is - // // unexported; clients use user.NewContext and user.FromContext - // // instead of using this key directly. - // var userKey key = 0 - // - // // NewContext returns a new Context that carries value u. - // func NewContext(ctx context.Context, u *User) context.Context { - // return context.WithValue(ctx, userKey, u) - // } - // - // // FromContext returns the User value stored in ctx, if any. - // func FromContext(ctx context.Context) (*User, bool) { - // u, ok := ctx.Value(userKey).(*User) - // return u, ok - // } - Value(key interface{}) interface{} -} - // Background returns a non-nil, empty Context. It is never canceled, has no -// values, and has no deadline. It is typically used by the main function, +// values, and has no deadline. It is typically used by the main function, // initialization, and tests, and as the top-level Context for incoming // requests. func Background() Context { return background } -// TODO returns a non-nil, empty Context. Code should use context.TODO when +// TODO returns a non-nil, empty Context. Code should use context.TODO when // it's unclear which Context to use or it is not yet available (because the // surrounding function has not yet been extended to accept a Context // parameter). TODO is recognized by static analysis tools that determine @@ -149,8 +52,3 @@ func Background() Context { func TODO() Context { return todo } - -// A CancelFunc tells an operation to abandon its work. -// A CancelFunc does not wait for the work to stop. -// After the first call, subsequent calls to a CancelFunc do nothing. -type CancelFunc func() diff --git a/vendor/golang.org/x/net/context/go17.go b/vendor/golang.org/x/net/context/go17.go index f8cda19..d20f52b 100644 --- a/vendor/golang.org/x/net/context/go17.go +++ b/vendor/golang.org/x/net/context/go17.go @@ -35,8 +35,8 @@ func WithCancel(parent Context) (ctx Context, cancel CancelFunc) { } // WithDeadline returns a copy of the parent context with the deadline adjusted -// to be no later than d. If the parent's deadline is already earlier than d, -// WithDeadline(parent, d) is semantically equivalent to parent. The returned +// to be no later than d. If the parent's deadline is already earlier than d, +// WithDeadline(parent, d) is semantically equivalent to parent. The returned // context's Done channel is closed when the deadline expires, when the returned // cancel function is called, or when the parent context's Done channel is // closed, whichever happens first. diff --git a/vendor/golang.org/x/net/context/go19.go b/vendor/golang.org/x/net/context/go19.go new file mode 100644 index 0000000..d88bd1d --- /dev/null +++ b/vendor/golang.org/x/net/context/go19.go @@ -0,0 +1,20 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build go1.9 + +package context + +import "context" // standard library's context, as of Go 1.7 + +// A Context carries a deadline, a cancelation signal, and other values across +// API boundaries. +// +// Context's methods may be called by multiple goroutines simultaneously. +type Context = context.Context + +// A CancelFunc tells an operation to abandon its work. +// A CancelFunc does not wait for the work to stop. +// After the first call, subsequent calls to a CancelFunc do nothing. +type CancelFunc = context.CancelFunc diff --git a/vendor/golang.org/x/net/context/pre_go17.go b/vendor/golang.org/x/net/context/pre_go17.go index 5a30aca..0f35592 100644 --- a/vendor/golang.org/x/net/context/pre_go17.go +++ b/vendor/golang.org/x/net/context/pre_go17.go @@ -13,7 +13,7 @@ import ( "time" ) -// An emptyCtx is never canceled, has no values, and has no deadline. It is not +// An emptyCtx is never canceled, has no values, and has no deadline. It is not // struct{}, since vars of this type must have distinct addresses. type emptyCtx int @@ -104,7 +104,7 @@ func propagateCancel(parent Context, child canceler) { } // parentCancelCtx follows a chain of parent references until it finds a -// *cancelCtx. This function understands how each of the concrete types in this +// *cancelCtx. This function understands how each of the concrete types in this // package represents its parent. func parentCancelCtx(parent Context) (*cancelCtx, bool) { for { @@ -134,14 +134,14 @@ func removeChild(parent Context, child canceler) { p.mu.Unlock() } -// A canceler is a context type that can be canceled directly. The +// A canceler is a context type that can be canceled directly. The // implementations are *cancelCtx and *timerCtx. type canceler interface { cancel(removeFromParent bool, err error) Done() <-chan struct{} } -// A cancelCtx can be canceled. When canceled, it also cancels any children +// A cancelCtx can be canceled. When canceled, it also cancels any children // that implement canceler. type cancelCtx struct { Context @@ -193,8 +193,8 @@ func (c *cancelCtx) cancel(removeFromParent bool, err error) { } // WithDeadline returns a copy of the parent context with the deadline adjusted -// to be no later than d. If the parent's deadline is already earlier than d, -// WithDeadline(parent, d) is semantically equivalent to parent. The returned +// to be no later than d. If the parent's deadline is already earlier than d, +// WithDeadline(parent, d) is semantically equivalent to parent. The returned // context's Done channel is closed when the deadline expires, when the returned // cancel function is called, or when the parent context's Done channel is // closed, whichever happens first. @@ -226,8 +226,8 @@ func WithDeadline(parent Context, deadline time.Time) (Context, CancelFunc) { return c, func() { c.cancel(true, Canceled) } } -// A timerCtx carries a timer and a deadline. It embeds a cancelCtx to -// implement Done and Err. It implements cancel by stopping its timer then +// A timerCtx carries a timer and a deadline. It embeds a cancelCtx to +// implement Done and Err. It implements cancel by stopping its timer then // delegating to cancelCtx.cancel. type timerCtx struct { *cancelCtx @@ -281,7 +281,7 @@ func WithValue(parent Context, key interface{}, val interface{}) Context { return &valueCtx{parent, key, val} } -// A valueCtx carries a key-value pair. It implements Value for that key and +// A valueCtx carries a key-value pair. It implements Value for that key and // delegates all other calls to the embedded Context. type valueCtx struct { Context diff --git a/vendor/golang.org/x/net/context/pre_go19.go b/vendor/golang.org/x/net/context/pre_go19.go new file mode 100644 index 0000000..b105f80 --- /dev/null +++ b/vendor/golang.org/x/net/context/pre_go19.go @@ -0,0 +1,109 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build !go1.9 + +package context + +import "time" + +// A Context carries a deadline, a cancelation signal, and other values across +// API boundaries. +// +// Context's methods may be called by multiple goroutines simultaneously. +type Context interface { + // Deadline returns the time when work done on behalf of this context + // should be canceled. Deadline returns ok==false when no deadline is + // set. Successive calls to Deadline return the same results. + Deadline() (deadline time.Time, ok bool) + + // Done returns a channel that's closed when work done on behalf of this + // context should be canceled. Done may return nil if this context can + // never be canceled. Successive calls to Done return the same value. + // + // WithCancel arranges for Done to be closed when cancel is called; + // WithDeadline arranges for Done to be closed when the deadline + // expires; WithTimeout arranges for Done to be closed when the timeout + // elapses. + // + // Done is provided for use in select statements: + // + // // Stream generates values with DoSomething and sends them to out + // // until DoSomething returns an error or ctx.Done is closed. + // func Stream(ctx context.Context, out chan<- Value) error { + // for { + // v, err := DoSomething(ctx) + // if err != nil { + // return err + // } + // select { + // case <-ctx.Done(): + // return ctx.Err() + // case out <- v: + // } + // } + // } + // + // See http://blog.golang.org/pipelines for more examples of how to use + // a Done channel for cancelation. + Done() <-chan struct{} + + // Err returns a non-nil error value after Done is closed. Err returns + // Canceled if the context was canceled or DeadlineExceeded if the + // context's deadline passed. No other values for Err are defined. + // After Done is closed, successive calls to Err return the same value. + Err() error + + // Value returns the value associated with this context for key, or nil + // if no value is associated with key. Successive calls to Value with + // the same key returns the same result. + // + // Use context values only for request-scoped data that transits + // processes and API boundaries, not for passing optional parameters to + // functions. + // + // A key identifies a specific value in a Context. Functions that wish + // to store values in Context typically allocate a key in a global + // variable then use that key as the argument to context.WithValue and + // Context.Value. A key can be any type that supports equality; + // packages should define keys as an unexported type to avoid + // collisions. + // + // Packages that define a Context key should provide type-safe accessors + // for the values stores using that key: + // + // // Package user defines a User type that's stored in Contexts. + // package user + // + // import "golang.org/x/net/context" + // + // // User is the type of value stored in the Contexts. + // type User struct {...} + // + // // key is an unexported type for keys defined in this package. + // // This prevents collisions with keys defined in other packages. + // type key int + // + // // userKey is the key for user.User values in Contexts. It is + // // unexported; clients use user.NewContext and user.FromContext + // // instead of using this key directly. + // var userKey key = 0 + // + // // NewContext returns a new Context that carries value u. + // func NewContext(ctx context.Context, u *User) context.Context { + // return context.WithValue(ctx, userKey, u) + // } + // + // // FromContext returns the User value stored in ctx, if any. + // func FromContext(ctx context.Context) (*User, bool) { + // u, ok := ctx.Value(userKey).(*User) + // return u, ok + // } + Value(key interface{}) interface{} +} + +// A CancelFunc tells an operation to abandon its work. +// A CancelFunc does not wait for the work to stop. +// After the first call, subsequent calls to a CancelFunc do nothing. +type CancelFunc func() diff --git a/vendor/golang.org/x/net/http2/ciphers.go b/vendor/golang.org/x/net/http2/ciphers.go new file mode 100644 index 0000000..698860b --- /dev/null +++ b/vendor/golang.org/x/net/http2/ciphers.go @@ -0,0 +1,641 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package http2 + +// A list of the possible cipher suite ids. Taken from +// http://www.iana.org/assignments/tls-parameters/tls-parameters.txt + +const ( + cipher_TLS_NULL_WITH_NULL_NULL uint16 = 0x0000 + cipher_TLS_RSA_WITH_NULL_MD5 uint16 = 0x0001 + cipher_TLS_RSA_WITH_NULL_SHA uint16 = 0x0002 + cipher_TLS_RSA_EXPORT_WITH_RC4_40_MD5 uint16 = 0x0003 + cipher_TLS_RSA_WITH_RC4_128_MD5 uint16 = 0x0004 + cipher_TLS_RSA_WITH_RC4_128_SHA uint16 = 0x0005 + cipher_TLS_RSA_EXPORT_WITH_RC2_CBC_40_MD5 uint16 = 0x0006 + cipher_TLS_RSA_WITH_IDEA_CBC_SHA uint16 = 0x0007 + cipher_TLS_RSA_EXPORT_WITH_DES40_CBC_SHA uint16 = 0x0008 + cipher_TLS_RSA_WITH_DES_CBC_SHA uint16 = 0x0009 + cipher_TLS_RSA_WITH_3DES_EDE_CBC_SHA uint16 = 0x000A + cipher_TLS_DH_DSS_EXPORT_WITH_DES40_CBC_SHA uint16 = 0x000B + cipher_TLS_DH_DSS_WITH_DES_CBC_SHA uint16 = 0x000C + cipher_TLS_DH_DSS_WITH_3DES_EDE_CBC_SHA uint16 = 0x000D + cipher_TLS_DH_RSA_EXPORT_WITH_DES40_CBC_SHA uint16 = 0x000E + cipher_TLS_DH_RSA_WITH_DES_CBC_SHA uint16 = 0x000F + cipher_TLS_DH_RSA_WITH_3DES_EDE_CBC_SHA uint16 = 0x0010 + cipher_TLS_DHE_DSS_EXPORT_WITH_DES40_CBC_SHA uint16 = 0x0011 + cipher_TLS_DHE_DSS_WITH_DES_CBC_SHA uint16 = 0x0012 + cipher_TLS_DHE_DSS_WITH_3DES_EDE_CBC_SHA uint16 = 0x0013 + cipher_TLS_DHE_RSA_EXPORT_WITH_DES40_CBC_SHA uint16 = 0x0014 + cipher_TLS_DHE_RSA_WITH_DES_CBC_SHA uint16 = 0x0015 + cipher_TLS_DHE_RSA_WITH_3DES_EDE_CBC_SHA uint16 = 0x0016 + cipher_TLS_DH_anon_EXPORT_WITH_RC4_40_MD5 uint16 = 0x0017 + cipher_TLS_DH_anon_WITH_RC4_128_MD5 uint16 = 0x0018 + cipher_TLS_DH_anon_EXPORT_WITH_DES40_CBC_SHA uint16 = 0x0019 + cipher_TLS_DH_anon_WITH_DES_CBC_SHA uint16 = 0x001A + cipher_TLS_DH_anon_WITH_3DES_EDE_CBC_SHA uint16 = 0x001B + // Reserved uint16 = 0x001C-1D + cipher_TLS_KRB5_WITH_DES_CBC_SHA uint16 = 0x001E + cipher_TLS_KRB5_WITH_3DES_EDE_CBC_SHA uint16 = 0x001F + cipher_TLS_KRB5_WITH_RC4_128_SHA uint16 = 0x0020 + cipher_TLS_KRB5_WITH_IDEA_CBC_SHA uint16 = 0x0021 + cipher_TLS_KRB5_WITH_DES_CBC_MD5 uint16 = 0x0022 + cipher_TLS_KRB5_WITH_3DES_EDE_CBC_MD5 uint16 = 0x0023 + cipher_TLS_KRB5_WITH_RC4_128_MD5 uint16 = 0x0024 + cipher_TLS_KRB5_WITH_IDEA_CBC_MD5 uint16 = 0x0025 + cipher_TLS_KRB5_EXPORT_WITH_DES_CBC_40_SHA uint16 = 0x0026 + cipher_TLS_KRB5_EXPORT_WITH_RC2_CBC_40_SHA uint16 = 0x0027 + cipher_TLS_KRB5_EXPORT_WITH_RC4_40_SHA uint16 = 0x0028 + cipher_TLS_KRB5_EXPORT_WITH_DES_CBC_40_MD5 uint16 = 0x0029 + cipher_TLS_KRB5_EXPORT_WITH_RC2_CBC_40_MD5 uint16 = 0x002A + cipher_TLS_KRB5_EXPORT_WITH_RC4_40_MD5 uint16 = 0x002B + cipher_TLS_PSK_WITH_NULL_SHA uint16 = 0x002C + cipher_TLS_DHE_PSK_WITH_NULL_SHA uint16 = 0x002D + cipher_TLS_RSA_PSK_WITH_NULL_SHA uint16 = 0x002E + cipher_TLS_RSA_WITH_AES_128_CBC_SHA uint16 = 0x002F + cipher_TLS_DH_DSS_WITH_AES_128_CBC_SHA uint16 = 0x0030 + cipher_TLS_DH_RSA_WITH_AES_128_CBC_SHA uint16 = 0x0031 + cipher_TLS_DHE_DSS_WITH_AES_128_CBC_SHA uint16 = 0x0032 + cipher_TLS_DHE_RSA_WITH_AES_128_CBC_SHA uint16 = 0x0033 + cipher_TLS_DH_anon_WITH_AES_128_CBC_SHA uint16 = 0x0034 + cipher_TLS_RSA_WITH_AES_256_CBC_SHA uint16 = 0x0035 + cipher_TLS_DH_DSS_WITH_AES_256_CBC_SHA uint16 = 0x0036 + cipher_TLS_DH_RSA_WITH_AES_256_CBC_SHA uint16 = 0x0037 + cipher_TLS_DHE_DSS_WITH_AES_256_CBC_SHA uint16 = 0x0038 + cipher_TLS_DHE_RSA_WITH_AES_256_CBC_SHA uint16 = 0x0039 + cipher_TLS_DH_anon_WITH_AES_256_CBC_SHA uint16 = 0x003A + cipher_TLS_RSA_WITH_NULL_SHA256 uint16 = 0x003B + cipher_TLS_RSA_WITH_AES_128_CBC_SHA256 uint16 = 0x003C + cipher_TLS_RSA_WITH_AES_256_CBC_SHA256 uint16 = 0x003D + cipher_TLS_DH_DSS_WITH_AES_128_CBC_SHA256 uint16 = 0x003E + cipher_TLS_DH_RSA_WITH_AES_128_CBC_SHA256 uint16 = 0x003F + cipher_TLS_DHE_DSS_WITH_AES_128_CBC_SHA256 uint16 = 0x0040 + cipher_TLS_RSA_WITH_CAMELLIA_128_CBC_SHA uint16 = 0x0041 + cipher_TLS_DH_DSS_WITH_CAMELLIA_128_CBC_SHA uint16 = 0x0042 + cipher_TLS_DH_RSA_WITH_CAMELLIA_128_CBC_SHA uint16 = 0x0043 + cipher_TLS_DHE_DSS_WITH_CAMELLIA_128_CBC_SHA uint16 = 0x0044 + cipher_TLS_DHE_RSA_WITH_CAMELLIA_128_CBC_SHA uint16 = 0x0045 + cipher_TLS_DH_anon_WITH_CAMELLIA_128_CBC_SHA uint16 = 0x0046 + // Reserved uint16 = 0x0047-4F + // Reserved uint16 = 0x0050-58 + // Reserved uint16 = 0x0059-5C + // Unassigned uint16 = 0x005D-5F + // Reserved uint16 = 0x0060-66 + cipher_TLS_DHE_RSA_WITH_AES_128_CBC_SHA256 uint16 = 0x0067 + cipher_TLS_DH_DSS_WITH_AES_256_CBC_SHA256 uint16 = 0x0068 + cipher_TLS_DH_RSA_WITH_AES_256_CBC_SHA256 uint16 = 0x0069 + cipher_TLS_DHE_DSS_WITH_AES_256_CBC_SHA256 uint16 = 0x006A + cipher_TLS_DHE_RSA_WITH_AES_256_CBC_SHA256 uint16 = 0x006B + cipher_TLS_DH_anon_WITH_AES_128_CBC_SHA256 uint16 = 0x006C + cipher_TLS_DH_anon_WITH_AES_256_CBC_SHA256 uint16 = 0x006D + // Unassigned uint16 = 0x006E-83 + cipher_TLS_RSA_WITH_CAMELLIA_256_CBC_SHA uint16 = 0x0084 + cipher_TLS_DH_DSS_WITH_CAMELLIA_256_CBC_SHA uint16 = 0x0085 + cipher_TLS_DH_RSA_WITH_CAMELLIA_256_CBC_SHA uint16 = 0x0086 + cipher_TLS_DHE_DSS_WITH_CAMELLIA_256_CBC_SHA uint16 = 0x0087 + cipher_TLS_DHE_RSA_WITH_CAMELLIA_256_CBC_SHA uint16 = 0x0088 + cipher_TLS_DH_anon_WITH_CAMELLIA_256_CBC_SHA uint16 = 0x0089 + cipher_TLS_PSK_WITH_RC4_128_SHA uint16 = 0x008A + cipher_TLS_PSK_WITH_3DES_EDE_CBC_SHA uint16 = 0x008B + cipher_TLS_PSK_WITH_AES_128_CBC_SHA uint16 = 0x008C + cipher_TLS_PSK_WITH_AES_256_CBC_SHA uint16 = 0x008D + cipher_TLS_DHE_PSK_WITH_RC4_128_SHA uint16 = 0x008E + cipher_TLS_DHE_PSK_WITH_3DES_EDE_CBC_SHA uint16 = 0x008F + cipher_TLS_DHE_PSK_WITH_AES_128_CBC_SHA uint16 = 0x0090 + cipher_TLS_DHE_PSK_WITH_AES_256_CBC_SHA uint16 = 0x0091 + cipher_TLS_RSA_PSK_WITH_RC4_128_SHA uint16 = 0x0092 + cipher_TLS_RSA_PSK_WITH_3DES_EDE_CBC_SHA uint16 = 0x0093 + cipher_TLS_RSA_PSK_WITH_AES_128_CBC_SHA uint16 = 0x0094 + cipher_TLS_RSA_PSK_WITH_AES_256_CBC_SHA uint16 = 0x0095 + cipher_TLS_RSA_WITH_SEED_CBC_SHA uint16 = 0x0096 + cipher_TLS_DH_DSS_WITH_SEED_CBC_SHA uint16 = 0x0097 + cipher_TLS_DH_RSA_WITH_SEED_CBC_SHA uint16 = 0x0098 + cipher_TLS_DHE_DSS_WITH_SEED_CBC_SHA uint16 = 0x0099 + cipher_TLS_DHE_RSA_WITH_SEED_CBC_SHA uint16 = 0x009A + cipher_TLS_DH_anon_WITH_SEED_CBC_SHA uint16 = 0x009B + cipher_TLS_RSA_WITH_AES_128_GCM_SHA256 uint16 = 0x009C + cipher_TLS_RSA_WITH_AES_256_GCM_SHA384 uint16 = 0x009D + cipher_TLS_DHE_RSA_WITH_AES_128_GCM_SHA256 uint16 = 0x009E + cipher_TLS_DHE_RSA_WITH_AES_256_GCM_SHA384 uint16 = 0x009F + cipher_TLS_DH_RSA_WITH_AES_128_GCM_SHA256 uint16 = 0x00A0 + cipher_TLS_DH_RSA_WITH_AES_256_GCM_SHA384 uint16 = 0x00A1 + cipher_TLS_DHE_DSS_WITH_AES_128_GCM_SHA256 uint16 = 0x00A2 + cipher_TLS_DHE_DSS_WITH_AES_256_GCM_SHA384 uint16 = 0x00A3 + cipher_TLS_DH_DSS_WITH_AES_128_GCM_SHA256 uint16 = 0x00A4 + cipher_TLS_DH_DSS_WITH_AES_256_GCM_SHA384 uint16 = 0x00A5 + cipher_TLS_DH_anon_WITH_AES_128_GCM_SHA256 uint16 = 0x00A6 + cipher_TLS_DH_anon_WITH_AES_256_GCM_SHA384 uint16 = 0x00A7 + cipher_TLS_PSK_WITH_AES_128_GCM_SHA256 uint16 = 0x00A8 + cipher_TLS_PSK_WITH_AES_256_GCM_SHA384 uint16 = 0x00A9 + cipher_TLS_DHE_PSK_WITH_AES_128_GCM_SHA256 uint16 = 0x00AA + cipher_TLS_DHE_PSK_WITH_AES_256_GCM_SHA384 uint16 = 0x00AB + cipher_TLS_RSA_PSK_WITH_AES_128_GCM_SHA256 uint16 = 0x00AC + cipher_TLS_RSA_PSK_WITH_AES_256_GCM_SHA384 uint16 = 0x00AD + cipher_TLS_PSK_WITH_AES_128_CBC_SHA256 uint16 = 0x00AE + cipher_TLS_PSK_WITH_AES_256_CBC_SHA384 uint16 = 0x00AF + cipher_TLS_PSK_WITH_NULL_SHA256 uint16 = 0x00B0 + cipher_TLS_PSK_WITH_NULL_SHA384 uint16 = 0x00B1 + cipher_TLS_DHE_PSK_WITH_AES_128_CBC_SHA256 uint16 = 0x00B2 + cipher_TLS_DHE_PSK_WITH_AES_256_CBC_SHA384 uint16 = 0x00B3 + cipher_TLS_DHE_PSK_WITH_NULL_SHA256 uint16 = 0x00B4 + cipher_TLS_DHE_PSK_WITH_NULL_SHA384 uint16 = 0x00B5 + cipher_TLS_RSA_PSK_WITH_AES_128_CBC_SHA256 uint16 = 0x00B6 + cipher_TLS_RSA_PSK_WITH_AES_256_CBC_SHA384 uint16 = 0x00B7 + cipher_TLS_RSA_PSK_WITH_NULL_SHA256 uint16 = 0x00B8 + cipher_TLS_RSA_PSK_WITH_NULL_SHA384 uint16 = 0x00B9 + cipher_TLS_RSA_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0x00BA + cipher_TLS_DH_DSS_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0x00BB + cipher_TLS_DH_RSA_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0x00BC + cipher_TLS_DHE_DSS_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0x00BD + cipher_TLS_DHE_RSA_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0x00BE + cipher_TLS_DH_anon_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0x00BF + cipher_TLS_RSA_WITH_CAMELLIA_256_CBC_SHA256 uint16 = 0x00C0 + cipher_TLS_DH_DSS_WITH_CAMELLIA_256_CBC_SHA256 uint16 = 0x00C1 + cipher_TLS_DH_RSA_WITH_CAMELLIA_256_CBC_SHA256 uint16 = 0x00C2 + cipher_TLS_DHE_DSS_WITH_CAMELLIA_256_CBC_SHA256 uint16 = 0x00C3 + cipher_TLS_DHE_RSA_WITH_CAMELLIA_256_CBC_SHA256 uint16 = 0x00C4 + cipher_TLS_DH_anon_WITH_CAMELLIA_256_CBC_SHA256 uint16 = 0x00C5 + // Unassigned uint16 = 0x00C6-FE + cipher_TLS_EMPTY_RENEGOTIATION_INFO_SCSV uint16 = 0x00FF + // Unassigned uint16 = 0x01-55,* + cipher_TLS_FALLBACK_SCSV uint16 = 0x5600 + // Unassigned uint16 = 0x5601 - 0xC000 + cipher_TLS_ECDH_ECDSA_WITH_NULL_SHA uint16 = 0xC001 + cipher_TLS_ECDH_ECDSA_WITH_RC4_128_SHA uint16 = 0xC002 + cipher_TLS_ECDH_ECDSA_WITH_3DES_EDE_CBC_SHA uint16 = 0xC003 + cipher_TLS_ECDH_ECDSA_WITH_AES_128_CBC_SHA uint16 = 0xC004 + cipher_TLS_ECDH_ECDSA_WITH_AES_256_CBC_SHA uint16 = 0xC005 + cipher_TLS_ECDHE_ECDSA_WITH_NULL_SHA uint16 = 0xC006 + cipher_TLS_ECDHE_ECDSA_WITH_RC4_128_SHA uint16 = 0xC007 + cipher_TLS_ECDHE_ECDSA_WITH_3DES_EDE_CBC_SHA uint16 = 0xC008 + cipher_TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA uint16 = 0xC009 + cipher_TLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHA uint16 = 0xC00A + cipher_TLS_ECDH_RSA_WITH_NULL_SHA uint16 = 0xC00B + cipher_TLS_ECDH_RSA_WITH_RC4_128_SHA uint16 = 0xC00C + cipher_TLS_ECDH_RSA_WITH_3DES_EDE_CBC_SHA uint16 = 0xC00D + cipher_TLS_ECDH_RSA_WITH_AES_128_CBC_SHA uint16 = 0xC00E + cipher_TLS_ECDH_RSA_WITH_AES_256_CBC_SHA uint16 = 0xC00F + cipher_TLS_ECDHE_RSA_WITH_NULL_SHA uint16 = 0xC010 + cipher_TLS_ECDHE_RSA_WITH_RC4_128_SHA uint16 = 0xC011 + cipher_TLS_ECDHE_RSA_WITH_3DES_EDE_CBC_SHA uint16 = 0xC012 + cipher_TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA uint16 = 0xC013 + cipher_TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA uint16 = 0xC014 + cipher_TLS_ECDH_anon_WITH_NULL_SHA uint16 = 0xC015 + cipher_TLS_ECDH_anon_WITH_RC4_128_SHA uint16 = 0xC016 + cipher_TLS_ECDH_anon_WITH_3DES_EDE_CBC_SHA uint16 = 0xC017 + cipher_TLS_ECDH_anon_WITH_AES_128_CBC_SHA uint16 = 0xC018 + cipher_TLS_ECDH_anon_WITH_AES_256_CBC_SHA uint16 = 0xC019 + cipher_TLS_SRP_SHA_WITH_3DES_EDE_CBC_SHA uint16 = 0xC01A + cipher_TLS_SRP_SHA_RSA_WITH_3DES_EDE_CBC_SHA uint16 = 0xC01B + cipher_TLS_SRP_SHA_DSS_WITH_3DES_EDE_CBC_SHA uint16 = 0xC01C + cipher_TLS_SRP_SHA_WITH_AES_128_CBC_SHA uint16 = 0xC01D + cipher_TLS_SRP_SHA_RSA_WITH_AES_128_CBC_SHA uint16 = 0xC01E + cipher_TLS_SRP_SHA_DSS_WITH_AES_128_CBC_SHA uint16 = 0xC01F + cipher_TLS_SRP_SHA_WITH_AES_256_CBC_SHA uint16 = 0xC020 + cipher_TLS_SRP_SHA_RSA_WITH_AES_256_CBC_SHA uint16 = 0xC021 + cipher_TLS_SRP_SHA_DSS_WITH_AES_256_CBC_SHA uint16 = 0xC022 + cipher_TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA256 uint16 = 0xC023 + cipher_TLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHA384 uint16 = 0xC024 + cipher_TLS_ECDH_ECDSA_WITH_AES_128_CBC_SHA256 uint16 = 0xC025 + cipher_TLS_ECDH_ECDSA_WITH_AES_256_CBC_SHA384 uint16 = 0xC026 + cipher_TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256 uint16 = 0xC027 + cipher_TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384 uint16 = 0xC028 + cipher_TLS_ECDH_RSA_WITH_AES_128_CBC_SHA256 uint16 = 0xC029 + cipher_TLS_ECDH_RSA_WITH_AES_256_CBC_SHA384 uint16 = 0xC02A + cipher_TLS_ECDHE_ECDSA_WITH_AES_128_GCM_SHA256 uint16 = 0xC02B + cipher_TLS_ECDHE_ECDSA_WITH_AES_256_GCM_SHA384 uint16 = 0xC02C + cipher_TLS_ECDH_ECDSA_WITH_AES_128_GCM_SHA256 uint16 = 0xC02D + cipher_TLS_ECDH_ECDSA_WITH_AES_256_GCM_SHA384 uint16 = 0xC02E + cipher_TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256 uint16 = 0xC02F + cipher_TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 uint16 = 0xC030 + cipher_TLS_ECDH_RSA_WITH_AES_128_GCM_SHA256 uint16 = 0xC031 + cipher_TLS_ECDH_RSA_WITH_AES_256_GCM_SHA384 uint16 = 0xC032 + cipher_TLS_ECDHE_PSK_WITH_RC4_128_SHA uint16 = 0xC033 + cipher_TLS_ECDHE_PSK_WITH_3DES_EDE_CBC_SHA uint16 = 0xC034 + cipher_TLS_ECDHE_PSK_WITH_AES_128_CBC_SHA uint16 = 0xC035 + cipher_TLS_ECDHE_PSK_WITH_AES_256_CBC_SHA uint16 = 0xC036 + cipher_TLS_ECDHE_PSK_WITH_AES_128_CBC_SHA256 uint16 = 0xC037 + cipher_TLS_ECDHE_PSK_WITH_AES_256_CBC_SHA384 uint16 = 0xC038 + cipher_TLS_ECDHE_PSK_WITH_NULL_SHA uint16 = 0xC039 + cipher_TLS_ECDHE_PSK_WITH_NULL_SHA256 uint16 = 0xC03A + cipher_TLS_ECDHE_PSK_WITH_NULL_SHA384 uint16 = 0xC03B + cipher_TLS_RSA_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC03C + cipher_TLS_RSA_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC03D + cipher_TLS_DH_DSS_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC03E + cipher_TLS_DH_DSS_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC03F + cipher_TLS_DH_RSA_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC040 + cipher_TLS_DH_RSA_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC041 + cipher_TLS_DHE_DSS_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC042 + cipher_TLS_DHE_DSS_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC043 + cipher_TLS_DHE_RSA_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC044 + cipher_TLS_DHE_RSA_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC045 + cipher_TLS_DH_anon_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC046 + cipher_TLS_DH_anon_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC047 + cipher_TLS_ECDHE_ECDSA_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC048 + cipher_TLS_ECDHE_ECDSA_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC049 + cipher_TLS_ECDH_ECDSA_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC04A + cipher_TLS_ECDH_ECDSA_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC04B + cipher_TLS_ECDHE_RSA_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC04C + cipher_TLS_ECDHE_RSA_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC04D + cipher_TLS_ECDH_RSA_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC04E + cipher_TLS_ECDH_RSA_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC04F + cipher_TLS_RSA_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC050 + cipher_TLS_RSA_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC051 + cipher_TLS_DHE_RSA_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC052 + cipher_TLS_DHE_RSA_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC053 + cipher_TLS_DH_RSA_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC054 + cipher_TLS_DH_RSA_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC055 + cipher_TLS_DHE_DSS_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC056 + cipher_TLS_DHE_DSS_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC057 + cipher_TLS_DH_DSS_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC058 + cipher_TLS_DH_DSS_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC059 + cipher_TLS_DH_anon_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC05A + cipher_TLS_DH_anon_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC05B + cipher_TLS_ECDHE_ECDSA_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC05C + cipher_TLS_ECDHE_ECDSA_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC05D + cipher_TLS_ECDH_ECDSA_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC05E + cipher_TLS_ECDH_ECDSA_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC05F + cipher_TLS_ECDHE_RSA_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC060 + cipher_TLS_ECDHE_RSA_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC061 + cipher_TLS_ECDH_RSA_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC062 + cipher_TLS_ECDH_RSA_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC063 + cipher_TLS_PSK_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC064 + cipher_TLS_PSK_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC065 + cipher_TLS_DHE_PSK_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC066 + cipher_TLS_DHE_PSK_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC067 + cipher_TLS_RSA_PSK_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC068 + cipher_TLS_RSA_PSK_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC069 + cipher_TLS_PSK_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC06A + cipher_TLS_PSK_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC06B + cipher_TLS_DHE_PSK_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC06C + cipher_TLS_DHE_PSK_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC06D + cipher_TLS_RSA_PSK_WITH_ARIA_128_GCM_SHA256 uint16 = 0xC06E + cipher_TLS_RSA_PSK_WITH_ARIA_256_GCM_SHA384 uint16 = 0xC06F + cipher_TLS_ECDHE_PSK_WITH_ARIA_128_CBC_SHA256 uint16 = 0xC070 + cipher_TLS_ECDHE_PSK_WITH_ARIA_256_CBC_SHA384 uint16 = 0xC071 + cipher_TLS_ECDHE_ECDSA_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0xC072 + cipher_TLS_ECDHE_ECDSA_WITH_CAMELLIA_256_CBC_SHA384 uint16 = 0xC073 + cipher_TLS_ECDH_ECDSA_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0xC074 + cipher_TLS_ECDH_ECDSA_WITH_CAMELLIA_256_CBC_SHA384 uint16 = 0xC075 + cipher_TLS_ECDHE_RSA_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0xC076 + cipher_TLS_ECDHE_RSA_WITH_CAMELLIA_256_CBC_SHA384 uint16 = 0xC077 + cipher_TLS_ECDH_RSA_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0xC078 + cipher_TLS_ECDH_RSA_WITH_CAMELLIA_256_CBC_SHA384 uint16 = 0xC079 + cipher_TLS_RSA_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC07A + cipher_TLS_RSA_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC07B + cipher_TLS_DHE_RSA_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC07C + cipher_TLS_DHE_RSA_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC07D + cipher_TLS_DH_RSA_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC07E + cipher_TLS_DH_RSA_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC07F + cipher_TLS_DHE_DSS_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC080 + cipher_TLS_DHE_DSS_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC081 + cipher_TLS_DH_DSS_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC082 + cipher_TLS_DH_DSS_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC083 + cipher_TLS_DH_anon_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC084 + cipher_TLS_DH_anon_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC085 + cipher_TLS_ECDHE_ECDSA_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC086 + cipher_TLS_ECDHE_ECDSA_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC087 + cipher_TLS_ECDH_ECDSA_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC088 + cipher_TLS_ECDH_ECDSA_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC089 + cipher_TLS_ECDHE_RSA_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC08A + cipher_TLS_ECDHE_RSA_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC08B + cipher_TLS_ECDH_RSA_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC08C + cipher_TLS_ECDH_RSA_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC08D + cipher_TLS_PSK_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC08E + cipher_TLS_PSK_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC08F + cipher_TLS_DHE_PSK_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC090 + cipher_TLS_DHE_PSK_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC091 + cipher_TLS_RSA_PSK_WITH_CAMELLIA_128_GCM_SHA256 uint16 = 0xC092 + cipher_TLS_RSA_PSK_WITH_CAMELLIA_256_GCM_SHA384 uint16 = 0xC093 + cipher_TLS_PSK_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0xC094 + cipher_TLS_PSK_WITH_CAMELLIA_256_CBC_SHA384 uint16 = 0xC095 + cipher_TLS_DHE_PSK_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0xC096 + cipher_TLS_DHE_PSK_WITH_CAMELLIA_256_CBC_SHA384 uint16 = 0xC097 + cipher_TLS_RSA_PSK_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0xC098 + cipher_TLS_RSA_PSK_WITH_CAMELLIA_256_CBC_SHA384 uint16 = 0xC099 + cipher_TLS_ECDHE_PSK_WITH_CAMELLIA_128_CBC_SHA256 uint16 = 0xC09A + cipher_TLS_ECDHE_PSK_WITH_CAMELLIA_256_CBC_SHA384 uint16 = 0xC09B + cipher_TLS_RSA_WITH_AES_128_CCM uint16 = 0xC09C + cipher_TLS_RSA_WITH_AES_256_CCM uint16 = 0xC09D + cipher_TLS_DHE_RSA_WITH_AES_128_CCM uint16 = 0xC09E + cipher_TLS_DHE_RSA_WITH_AES_256_CCM uint16 = 0xC09F + cipher_TLS_RSA_WITH_AES_128_CCM_8 uint16 = 0xC0A0 + cipher_TLS_RSA_WITH_AES_256_CCM_8 uint16 = 0xC0A1 + cipher_TLS_DHE_RSA_WITH_AES_128_CCM_8 uint16 = 0xC0A2 + cipher_TLS_DHE_RSA_WITH_AES_256_CCM_8 uint16 = 0xC0A3 + cipher_TLS_PSK_WITH_AES_128_CCM uint16 = 0xC0A4 + cipher_TLS_PSK_WITH_AES_256_CCM uint16 = 0xC0A5 + cipher_TLS_DHE_PSK_WITH_AES_128_CCM uint16 = 0xC0A6 + cipher_TLS_DHE_PSK_WITH_AES_256_CCM uint16 = 0xC0A7 + cipher_TLS_PSK_WITH_AES_128_CCM_8 uint16 = 0xC0A8 + cipher_TLS_PSK_WITH_AES_256_CCM_8 uint16 = 0xC0A9 + cipher_TLS_PSK_DHE_WITH_AES_128_CCM_8 uint16 = 0xC0AA + cipher_TLS_PSK_DHE_WITH_AES_256_CCM_8 uint16 = 0xC0AB + cipher_TLS_ECDHE_ECDSA_WITH_AES_128_CCM uint16 = 0xC0AC + cipher_TLS_ECDHE_ECDSA_WITH_AES_256_CCM uint16 = 0xC0AD + cipher_TLS_ECDHE_ECDSA_WITH_AES_128_CCM_8 uint16 = 0xC0AE + cipher_TLS_ECDHE_ECDSA_WITH_AES_256_CCM_8 uint16 = 0xC0AF + // Unassigned uint16 = 0xC0B0-FF + // Unassigned uint16 = 0xC1-CB,* + // Unassigned uint16 = 0xCC00-A7 + cipher_TLS_ECDHE_RSA_WITH_CHACHA20_POLY1305_SHA256 uint16 = 0xCCA8 + cipher_TLS_ECDHE_ECDSA_WITH_CHACHA20_POLY1305_SHA256 uint16 = 0xCCA9 + cipher_TLS_DHE_RSA_WITH_CHACHA20_POLY1305_SHA256 uint16 = 0xCCAA + cipher_TLS_PSK_WITH_CHACHA20_POLY1305_SHA256 uint16 = 0xCCAB + cipher_TLS_ECDHE_PSK_WITH_CHACHA20_POLY1305_SHA256 uint16 = 0xCCAC + cipher_TLS_DHE_PSK_WITH_CHACHA20_POLY1305_SHA256 uint16 = 0xCCAD + cipher_TLS_RSA_PSK_WITH_CHACHA20_POLY1305_SHA256 uint16 = 0xCCAE +) + +// isBadCipher reports whether the cipher is blacklisted by the HTTP/2 spec. +// References: +// https://tools.ietf.org/html/rfc7540#appendix-A +// Reject cipher suites from Appendix A. +// "This list includes those cipher suites that do not +// offer an ephemeral key exchange and those that are +// based on the TLS null, stream or block cipher type" +func isBadCipher(cipher uint16) bool { + switch cipher { + case cipher_TLS_NULL_WITH_NULL_NULL, + cipher_TLS_RSA_WITH_NULL_MD5, + cipher_TLS_RSA_WITH_NULL_SHA, + cipher_TLS_RSA_EXPORT_WITH_RC4_40_MD5, + cipher_TLS_RSA_WITH_RC4_128_MD5, + cipher_TLS_RSA_WITH_RC4_128_SHA, + cipher_TLS_RSA_EXPORT_WITH_RC2_CBC_40_MD5, + cipher_TLS_RSA_WITH_IDEA_CBC_SHA, + cipher_TLS_RSA_EXPORT_WITH_DES40_CBC_SHA, + cipher_TLS_RSA_WITH_DES_CBC_SHA, + cipher_TLS_RSA_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_DH_DSS_EXPORT_WITH_DES40_CBC_SHA, + cipher_TLS_DH_DSS_WITH_DES_CBC_SHA, + cipher_TLS_DH_DSS_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_DH_RSA_EXPORT_WITH_DES40_CBC_SHA, + cipher_TLS_DH_RSA_WITH_DES_CBC_SHA, + cipher_TLS_DH_RSA_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_DHE_DSS_EXPORT_WITH_DES40_CBC_SHA, + cipher_TLS_DHE_DSS_WITH_DES_CBC_SHA, + cipher_TLS_DHE_DSS_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_DHE_RSA_EXPORT_WITH_DES40_CBC_SHA, + cipher_TLS_DHE_RSA_WITH_DES_CBC_SHA, + cipher_TLS_DHE_RSA_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_DH_anon_EXPORT_WITH_RC4_40_MD5, + cipher_TLS_DH_anon_WITH_RC4_128_MD5, + cipher_TLS_DH_anon_EXPORT_WITH_DES40_CBC_SHA, + cipher_TLS_DH_anon_WITH_DES_CBC_SHA, + cipher_TLS_DH_anon_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_KRB5_WITH_DES_CBC_SHA, + cipher_TLS_KRB5_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_KRB5_WITH_RC4_128_SHA, + cipher_TLS_KRB5_WITH_IDEA_CBC_SHA, + cipher_TLS_KRB5_WITH_DES_CBC_MD5, + cipher_TLS_KRB5_WITH_3DES_EDE_CBC_MD5, + cipher_TLS_KRB5_WITH_RC4_128_MD5, + cipher_TLS_KRB5_WITH_IDEA_CBC_MD5, + cipher_TLS_KRB5_EXPORT_WITH_DES_CBC_40_SHA, + cipher_TLS_KRB5_EXPORT_WITH_RC2_CBC_40_SHA, + cipher_TLS_KRB5_EXPORT_WITH_RC4_40_SHA, + cipher_TLS_KRB5_EXPORT_WITH_DES_CBC_40_MD5, + cipher_TLS_KRB5_EXPORT_WITH_RC2_CBC_40_MD5, + cipher_TLS_KRB5_EXPORT_WITH_RC4_40_MD5, + cipher_TLS_PSK_WITH_NULL_SHA, + cipher_TLS_DHE_PSK_WITH_NULL_SHA, + cipher_TLS_RSA_PSK_WITH_NULL_SHA, + cipher_TLS_RSA_WITH_AES_128_CBC_SHA, + cipher_TLS_DH_DSS_WITH_AES_128_CBC_SHA, + cipher_TLS_DH_RSA_WITH_AES_128_CBC_SHA, + cipher_TLS_DHE_DSS_WITH_AES_128_CBC_SHA, + cipher_TLS_DHE_RSA_WITH_AES_128_CBC_SHA, + cipher_TLS_DH_anon_WITH_AES_128_CBC_SHA, + cipher_TLS_RSA_WITH_AES_256_CBC_SHA, + cipher_TLS_DH_DSS_WITH_AES_256_CBC_SHA, + cipher_TLS_DH_RSA_WITH_AES_256_CBC_SHA, + cipher_TLS_DHE_DSS_WITH_AES_256_CBC_SHA, + cipher_TLS_DHE_RSA_WITH_AES_256_CBC_SHA, + cipher_TLS_DH_anon_WITH_AES_256_CBC_SHA, + cipher_TLS_RSA_WITH_NULL_SHA256, + cipher_TLS_RSA_WITH_AES_128_CBC_SHA256, + cipher_TLS_RSA_WITH_AES_256_CBC_SHA256, + cipher_TLS_DH_DSS_WITH_AES_128_CBC_SHA256, + cipher_TLS_DH_RSA_WITH_AES_128_CBC_SHA256, + cipher_TLS_DHE_DSS_WITH_AES_128_CBC_SHA256, + cipher_TLS_RSA_WITH_CAMELLIA_128_CBC_SHA, + cipher_TLS_DH_DSS_WITH_CAMELLIA_128_CBC_SHA, + cipher_TLS_DH_RSA_WITH_CAMELLIA_128_CBC_SHA, + cipher_TLS_DHE_DSS_WITH_CAMELLIA_128_CBC_SHA, + cipher_TLS_DHE_RSA_WITH_CAMELLIA_128_CBC_SHA, + cipher_TLS_DH_anon_WITH_CAMELLIA_128_CBC_SHA, + cipher_TLS_DHE_RSA_WITH_AES_128_CBC_SHA256, + cipher_TLS_DH_DSS_WITH_AES_256_CBC_SHA256, + cipher_TLS_DH_RSA_WITH_AES_256_CBC_SHA256, + cipher_TLS_DHE_DSS_WITH_AES_256_CBC_SHA256, + cipher_TLS_DHE_RSA_WITH_AES_256_CBC_SHA256, + cipher_TLS_DH_anon_WITH_AES_128_CBC_SHA256, + cipher_TLS_DH_anon_WITH_AES_256_CBC_SHA256, + cipher_TLS_RSA_WITH_CAMELLIA_256_CBC_SHA, + cipher_TLS_DH_DSS_WITH_CAMELLIA_256_CBC_SHA, + cipher_TLS_DH_RSA_WITH_CAMELLIA_256_CBC_SHA, + cipher_TLS_DHE_DSS_WITH_CAMELLIA_256_CBC_SHA, + cipher_TLS_DHE_RSA_WITH_CAMELLIA_256_CBC_SHA, + cipher_TLS_DH_anon_WITH_CAMELLIA_256_CBC_SHA, + cipher_TLS_PSK_WITH_RC4_128_SHA, + cipher_TLS_PSK_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_PSK_WITH_AES_128_CBC_SHA, + cipher_TLS_PSK_WITH_AES_256_CBC_SHA, + cipher_TLS_DHE_PSK_WITH_RC4_128_SHA, + cipher_TLS_DHE_PSK_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_DHE_PSK_WITH_AES_128_CBC_SHA, + cipher_TLS_DHE_PSK_WITH_AES_256_CBC_SHA, + cipher_TLS_RSA_PSK_WITH_RC4_128_SHA, + cipher_TLS_RSA_PSK_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_RSA_PSK_WITH_AES_128_CBC_SHA, + cipher_TLS_RSA_PSK_WITH_AES_256_CBC_SHA, + cipher_TLS_RSA_WITH_SEED_CBC_SHA, + cipher_TLS_DH_DSS_WITH_SEED_CBC_SHA, + cipher_TLS_DH_RSA_WITH_SEED_CBC_SHA, + cipher_TLS_DHE_DSS_WITH_SEED_CBC_SHA, + cipher_TLS_DHE_RSA_WITH_SEED_CBC_SHA, + cipher_TLS_DH_anon_WITH_SEED_CBC_SHA, + cipher_TLS_RSA_WITH_AES_128_GCM_SHA256, + cipher_TLS_RSA_WITH_AES_256_GCM_SHA384, + cipher_TLS_DH_RSA_WITH_AES_128_GCM_SHA256, + cipher_TLS_DH_RSA_WITH_AES_256_GCM_SHA384, + cipher_TLS_DH_DSS_WITH_AES_128_GCM_SHA256, + cipher_TLS_DH_DSS_WITH_AES_256_GCM_SHA384, + cipher_TLS_DH_anon_WITH_AES_128_GCM_SHA256, + cipher_TLS_DH_anon_WITH_AES_256_GCM_SHA384, + cipher_TLS_PSK_WITH_AES_128_GCM_SHA256, + cipher_TLS_PSK_WITH_AES_256_GCM_SHA384, + cipher_TLS_RSA_PSK_WITH_AES_128_GCM_SHA256, + cipher_TLS_RSA_PSK_WITH_AES_256_GCM_SHA384, + cipher_TLS_PSK_WITH_AES_128_CBC_SHA256, + cipher_TLS_PSK_WITH_AES_256_CBC_SHA384, + cipher_TLS_PSK_WITH_NULL_SHA256, + cipher_TLS_PSK_WITH_NULL_SHA384, + cipher_TLS_DHE_PSK_WITH_AES_128_CBC_SHA256, + cipher_TLS_DHE_PSK_WITH_AES_256_CBC_SHA384, + cipher_TLS_DHE_PSK_WITH_NULL_SHA256, + cipher_TLS_DHE_PSK_WITH_NULL_SHA384, + cipher_TLS_RSA_PSK_WITH_AES_128_CBC_SHA256, + cipher_TLS_RSA_PSK_WITH_AES_256_CBC_SHA384, + cipher_TLS_RSA_PSK_WITH_NULL_SHA256, + cipher_TLS_RSA_PSK_WITH_NULL_SHA384, + cipher_TLS_RSA_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_DH_DSS_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_DH_RSA_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_DHE_DSS_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_DHE_RSA_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_DH_anon_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_RSA_WITH_CAMELLIA_256_CBC_SHA256, + cipher_TLS_DH_DSS_WITH_CAMELLIA_256_CBC_SHA256, + cipher_TLS_DH_RSA_WITH_CAMELLIA_256_CBC_SHA256, + cipher_TLS_DHE_DSS_WITH_CAMELLIA_256_CBC_SHA256, + cipher_TLS_DHE_RSA_WITH_CAMELLIA_256_CBC_SHA256, + cipher_TLS_DH_anon_WITH_CAMELLIA_256_CBC_SHA256, + cipher_TLS_EMPTY_RENEGOTIATION_INFO_SCSV, + cipher_TLS_ECDH_ECDSA_WITH_NULL_SHA, + cipher_TLS_ECDH_ECDSA_WITH_RC4_128_SHA, + cipher_TLS_ECDH_ECDSA_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_ECDH_ECDSA_WITH_AES_128_CBC_SHA, + cipher_TLS_ECDH_ECDSA_WITH_AES_256_CBC_SHA, + cipher_TLS_ECDHE_ECDSA_WITH_NULL_SHA, + cipher_TLS_ECDHE_ECDSA_WITH_RC4_128_SHA, + cipher_TLS_ECDHE_ECDSA_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA, + cipher_TLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHA, + cipher_TLS_ECDH_RSA_WITH_NULL_SHA, + cipher_TLS_ECDH_RSA_WITH_RC4_128_SHA, + cipher_TLS_ECDH_RSA_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_ECDH_RSA_WITH_AES_128_CBC_SHA, + cipher_TLS_ECDH_RSA_WITH_AES_256_CBC_SHA, + cipher_TLS_ECDHE_RSA_WITH_NULL_SHA, + cipher_TLS_ECDHE_RSA_WITH_RC4_128_SHA, + cipher_TLS_ECDHE_RSA_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA, + cipher_TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA, + cipher_TLS_ECDH_anon_WITH_NULL_SHA, + cipher_TLS_ECDH_anon_WITH_RC4_128_SHA, + cipher_TLS_ECDH_anon_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_ECDH_anon_WITH_AES_128_CBC_SHA, + cipher_TLS_ECDH_anon_WITH_AES_256_CBC_SHA, + cipher_TLS_SRP_SHA_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_SRP_SHA_RSA_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_SRP_SHA_DSS_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_SRP_SHA_WITH_AES_128_CBC_SHA, + cipher_TLS_SRP_SHA_RSA_WITH_AES_128_CBC_SHA, + cipher_TLS_SRP_SHA_DSS_WITH_AES_128_CBC_SHA, + cipher_TLS_SRP_SHA_WITH_AES_256_CBC_SHA, + cipher_TLS_SRP_SHA_RSA_WITH_AES_256_CBC_SHA, + cipher_TLS_SRP_SHA_DSS_WITH_AES_256_CBC_SHA, + cipher_TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA256, + cipher_TLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHA384, + cipher_TLS_ECDH_ECDSA_WITH_AES_128_CBC_SHA256, + cipher_TLS_ECDH_ECDSA_WITH_AES_256_CBC_SHA384, + cipher_TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256, + cipher_TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384, + cipher_TLS_ECDH_RSA_WITH_AES_128_CBC_SHA256, + cipher_TLS_ECDH_RSA_WITH_AES_256_CBC_SHA384, + cipher_TLS_ECDH_ECDSA_WITH_AES_128_GCM_SHA256, + cipher_TLS_ECDH_ECDSA_WITH_AES_256_GCM_SHA384, + cipher_TLS_ECDH_RSA_WITH_AES_128_GCM_SHA256, + cipher_TLS_ECDH_RSA_WITH_AES_256_GCM_SHA384, + cipher_TLS_ECDHE_PSK_WITH_RC4_128_SHA, + cipher_TLS_ECDHE_PSK_WITH_3DES_EDE_CBC_SHA, + cipher_TLS_ECDHE_PSK_WITH_AES_128_CBC_SHA, + cipher_TLS_ECDHE_PSK_WITH_AES_256_CBC_SHA, + cipher_TLS_ECDHE_PSK_WITH_AES_128_CBC_SHA256, + cipher_TLS_ECDHE_PSK_WITH_AES_256_CBC_SHA384, + cipher_TLS_ECDHE_PSK_WITH_NULL_SHA, + cipher_TLS_ECDHE_PSK_WITH_NULL_SHA256, + cipher_TLS_ECDHE_PSK_WITH_NULL_SHA384, + cipher_TLS_RSA_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_RSA_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_DH_DSS_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_DH_DSS_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_DH_RSA_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_DH_RSA_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_DHE_DSS_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_DHE_DSS_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_DHE_RSA_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_DHE_RSA_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_DH_anon_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_DH_anon_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_ECDHE_ECDSA_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_ECDHE_ECDSA_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_ECDH_ECDSA_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_ECDH_ECDSA_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_ECDHE_RSA_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_ECDHE_RSA_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_ECDH_RSA_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_ECDH_RSA_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_RSA_WITH_ARIA_128_GCM_SHA256, + cipher_TLS_RSA_WITH_ARIA_256_GCM_SHA384, + cipher_TLS_DH_RSA_WITH_ARIA_128_GCM_SHA256, + cipher_TLS_DH_RSA_WITH_ARIA_256_GCM_SHA384, + cipher_TLS_DH_DSS_WITH_ARIA_128_GCM_SHA256, + cipher_TLS_DH_DSS_WITH_ARIA_256_GCM_SHA384, + cipher_TLS_DH_anon_WITH_ARIA_128_GCM_SHA256, + cipher_TLS_DH_anon_WITH_ARIA_256_GCM_SHA384, + cipher_TLS_ECDH_ECDSA_WITH_ARIA_128_GCM_SHA256, + cipher_TLS_ECDH_ECDSA_WITH_ARIA_256_GCM_SHA384, + cipher_TLS_ECDH_RSA_WITH_ARIA_128_GCM_SHA256, + cipher_TLS_ECDH_RSA_WITH_ARIA_256_GCM_SHA384, + cipher_TLS_PSK_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_PSK_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_DHE_PSK_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_DHE_PSK_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_RSA_PSK_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_RSA_PSK_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_PSK_WITH_ARIA_128_GCM_SHA256, + cipher_TLS_PSK_WITH_ARIA_256_GCM_SHA384, + cipher_TLS_RSA_PSK_WITH_ARIA_128_GCM_SHA256, + cipher_TLS_RSA_PSK_WITH_ARIA_256_GCM_SHA384, + cipher_TLS_ECDHE_PSK_WITH_ARIA_128_CBC_SHA256, + cipher_TLS_ECDHE_PSK_WITH_ARIA_256_CBC_SHA384, + cipher_TLS_ECDHE_ECDSA_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_ECDHE_ECDSA_WITH_CAMELLIA_256_CBC_SHA384, + cipher_TLS_ECDH_ECDSA_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_ECDH_ECDSA_WITH_CAMELLIA_256_CBC_SHA384, + cipher_TLS_ECDHE_RSA_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_ECDHE_RSA_WITH_CAMELLIA_256_CBC_SHA384, + cipher_TLS_ECDH_RSA_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_ECDH_RSA_WITH_CAMELLIA_256_CBC_SHA384, + cipher_TLS_RSA_WITH_CAMELLIA_128_GCM_SHA256, + cipher_TLS_RSA_WITH_CAMELLIA_256_GCM_SHA384, + cipher_TLS_DH_RSA_WITH_CAMELLIA_128_GCM_SHA256, + cipher_TLS_DH_RSA_WITH_CAMELLIA_256_GCM_SHA384, + cipher_TLS_DH_DSS_WITH_CAMELLIA_128_GCM_SHA256, + cipher_TLS_DH_DSS_WITH_CAMELLIA_256_GCM_SHA384, + cipher_TLS_DH_anon_WITH_CAMELLIA_128_GCM_SHA256, + cipher_TLS_DH_anon_WITH_CAMELLIA_256_GCM_SHA384, + cipher_TLS_ECDH_ECDSA_WITH_CAMELLIA_128_GCM_SHA256, + cipher_TLS_ECDH_ECDSA_WITH_CAMELLIA_256_GCM_SHA384, + cipher_TLS_ECDH_RSA_WITH_CAMELLIA_128_GCM_SHA256, + cipher_TLS_ECDH_RSA_WITH_CAMELLIA_256_GCM_SHA384, + cipher_TLS_PSK_WITH_CAMELLIA_128_GCM_SHA256, + cipher_TLS_PSK_WITH_CAMELLIA_256_GCM_SHA384, + cipher_TLS_RSA_PSK_WITH_CAMELLIA_128_GCM_SHA256, + cipher_TLS_RSA_PSK_WITH_CAMELLIA_256_GCM_SHA384, + cipher_TLS_PSK_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_PSK_WITH_CAMELLIA_256_CBC_SHA384, + cipher_TLS_DHE_PSK_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_DHE_PSK_WITH_CAMELLIA_256_CBC_SHA384, + cipher_TLS_RSA_PSK_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_RSA_PSK_WITH_CAMELLIA_256_CBC_SHA384, + cipher_TLS_ECDHE_PSK_WITH_CAMELLIA_128_CBC_SHA256, + cipher_TLS_ECDHE_PSK_WITH_CAMELLIA_256_CBC_SHA384, + cipher_TLS_RSA_WITH_AES_128_CCM, + cipher_TLS_RSA_WITH_AES_256_CCM, + cipher_TLS_RSA_WITH_AES_128_CCM_8, + cipher_TLS_RSA_WITH_AES_256_CCM_8, + cipher_TLS_PSK_WITH_AES_128_CCM, + cipher_TLS_PSK_WITH_AES_256_CCM, + cipher_TLS_PSK_WITH_AES_128_CCM_8, + cipher_TLS_PSK_WITH_AES_256_CCM_8: + return true + default: + return false + } +} diff --git a/vendor/golang.org/x/net/http2/client_conn_pool.go b/vendor/golang.org/x/net/http2/client_conn_pool.go index b139412..bdf5652 100644 --- a/vendor/golang.org/x/net/http2/client_conn_pool.go +++ b/vendor/golang.org/x/net/http2/client_conn_pool.go @@ -247,7 +247,7 @@ func filterOutClientConn(in []*ClientConn, exclude *ClientConn) []*ClientConn { } // noDialClientConnPool is an implementation of http2.ClientConnPool -// which never dials. We let the HTTP/1.1 client dial and use its TLS +// which never dials. We let the HTTP/1.1 client dial and use its TLS // connection instead. type noDialClientConnPool struct{ *clientConnPool } diff --git a/vendor/golang.org/x/net/http2/configure_transport.go b/vendor/golang.org/x/net/http2/configure_transport.go index 4f720f5..b65fc6d 100644 --- a/vendor/golang.org/x/net/http2/configure_transport.go +++ b/vendor/golang.org/x/net/http2/configure_transport.go @@ -56,7 +56,7 @@ func configureTransport(t1 *http.Transport) (*Transport, error) { } // registerHTTPSProtocol calls Transport.RegisterProtocol but -// convering panics into errors. +// converting panics into errors. func registerHTTPSProtocol(t *http.Transport, rt http.RoundTripper) (err error) { defer func() { if e := recover(); e != nil { diff --git a/vendor/golang.org/x/net/http2/databuffer.go b/vendor/golang.org/x/net/http2/databuffer.go new file mode 100644 index 0000000..a3067f8 --- /dev/null +++ b/vendor/golang.org/x/net/http2/databuffer.go @@ -0,0 +1,146 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package http2 + +import ( + "errors" + "fmt" + "sync" +) + +// Buffer chunks are allocated from a pool to reduce pressure on GC. +// The maximum wasted space per dataBuffer is 2x the largest size class, +// which happens when the dataBuffer has multiple chunks and there is +// one unread byte in both the first and last chunks. We use a few size +// classes to minimize overheads for servers that typically receive very +// small request bodies. +// +// TODO: Benchmark to determine if the pools are necessary. The GC may have +// improved enough that we can instead allocate chunks like this: +// make([]byte, max(16<<10, expectedBytesRemaining)) +var ( + dataChunkSizeClasses = []int{ + 1 << 10, + 2 << 10, + 4 << 10, + 8 << 10, + 16 << 10, + } + dataChunkPools = [...]sync.Pool{ + {New: func() interface{} { return make([]byte, 1<<10) }}, + {New: func() interface{} { return make([]byte, 2<<10) }}, + {New: func() interface{} { return make([]byte, 4<<10) }}, + {New: func() interface{} { return make([]byte, 8<<10) }}, + {New: func() interface{} { return make([]byte, 16<<10) }}, + } +) + +func getDataBufferChunk(size int64) []byte { + i := 0 + for ; i < len(dataChunkSizeClasses)-1; i++ { + if size <= int64(dataChunkSizeClasses[i]) { + break + } + } + return dataChunkPools[i].Get().([]byte) +} + +func putDataBufferChunk(p []byte) { + for i, n := range dataChunkSizeClasses { + if len(p) == n { + dataChunkPools[i].Put(p) + return + } + } + panic(fmt.Sprintf("unexpected buffer len=%v", len(p))) +} + +// dataBuffer is an io.ReadWriter backed by a list of data chunks. +// Each dataBuffer is used to read DATA frames on a single stream. +// The buffer is divided into chunks so the server can limit the +// total memory used by a single connection without limiting the +// request body size on any single stream. +type dataBuffer struct { + chunks [][]byte + r int // next byte to read is chunks[0][r] + w int // next byte to write is chunks[len(chunks)-1][w] + size int // total buffered bytes + expected int64 // we expect at least this many bytes in future Write calls (ignored if <= 0) +} + +var errReadEmpty = errors.New("read from empty dataBuffer") + +// Read copies bytes from the buffer into p. +// It is an error to read when no data is available. +func (b *dataBuffer) Read(p []byte) (int, error) { + if b.size == 0 { + return 0, errReadEmpty + } + var ntotal int + for len(p) > 0 && b.size > 0 { + readFrom := b.bytesFromFirstChunk() + n := copy(p, readFrom) + p = p[n:] + ntotal += n + b.r += n + b.size -= n + // If the first chunk has been consumed, advance to the next chunk. + if b.r == len(b.chunks[0]) { + putDataBufferChunk(b.chunks[0]) + end := len(b.chunks) - 1 + copy(b.chunks[:end], b.chunks[1:]) + b.chunks[end] = nil + b.chunks = b.chunks[:end] + b.r = 0 + } + } + return ntotal, nil +} + +func (b *dataBuffer) bytesFromFirstChunk() []byte { + if len(b.chunks) == 1 { + return b.chunks[0][b.r:b.w] + } + return b.chunks[0][b.r:] +} + +// Len returns the number of bytes of the unread portion of the buffer. +func (b *dataBuffer) Len() int { + return b.size +} + +// Write appends p to the buffer. +func (b *dataBuffer) Write(p []byte) (int, error) { + ntotal := len(p) + for len(p) > 0 { + // If the last chunk is empty, allocate a new chunk. Try to allocate + // enough to fully copy p plus any additional bytes we expect to + // receive. However, this may allocate less than len(p). + want := int64(len(p)) + if b.expected > want { + want = b.expected + } + chunk := b.lastChunkOrAlloc(want) + n := copy(chunk[b.w:], p) + p = p[n:] + b.w += n + b.size += n + b.expected -= int64(n) + } + return ntotal, nil +} + +func (b *dataBuffer) lastChunkOrAlloc(want int64) []byte { + if len(b.chunks) != 0 { + last := b.chunks[len(b.chunks)-1] + if b.w < len(last) { + return last + } + } + chunk := getDataBufferChunk(want) + b.chunks = append(b.chunks, chunk) + b.w = 0 + return chunk +} diff --git a/vendor/golang.org/x/net/http2/errors.go b/vendor/golang.org/x/net/http2/errors.go index 20fd762..71f2c46 100644 --- a/vendor/golang.org/x/net/http2/errors.go +++ b/vendor/golang.org/x/net/http2/errors.go @@ -87,13 +87,16 @@ type goAwayFlowError struct{} func (goAwayFlowError) Error() string { return "connection exceeded flow control window size" } -// connErrorReason wraps a ConnectionError with an informative error about why it occurs. - +// connError represents an HTTP/2 ConnectionError error code, along +// with a string (for debugging) explaining why. +// // Errors of this type are only returned by the frame parser functions -// and converted into ConnectionError(ErrCodeProtocol). +// and converted into ConnectionError(Code), after stashing away +// the Reason into the Framer's errDetail field, accessible via +// the (*Framer).ErrorDetail method. type connError struct { - Code ErrCode - Reason string + Code ErrCode // the ConnectionError error code + Reason string // additional reason } func (e connError) Error() string { diff --git a/vendor/golang.org/x/net/http2/fixed_buffer.go b/vendor/golang.org/x/net/http2/fixed_buffer.go deleted file mode 100644 index 47da0f0..0000000 --- a/vendor/golang.org/x/net/http2/fixed_buffer.go +++ /dev/null @@ -1,60 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package http2 - -import ( - "errors" -) - -// fixedBuffer is an io.ReadWriter backed by a fixed size buffer. -// It never allocates, but moves old data as new data is written. -type fixedBuffer struct { - buf []byte - r, w int -} - -var ( - errReadEmpty = errors.New("read from empty fixedBuffer") - errWriteFull = errors.New("write on full fixedBuffer") -) - -// Read copies bytes from the buffer into p. -// It is an error to read when no data is available. -func (b *fixedBuffer) Read(p []byte) (n int, err error) { - if b.r == b.w { - return 0, errReadEmpty - } - n = copy(p, b.buf[b.r:b.w]) - b.r += n - if b.r == b.w { - b.r = 0 - b.w = 0 - } - return n, nil -} - -// Len returns the number of bytes of the unread portion of the buffer. -func (b *fixedBuffer) Len() int { - return b.w - b.r -} - -// Write copies bytes from p into the buffer. -// It is an error to write more data than the buffer can hold. -func (b *fixedBuffer) Write(p []byte) (n int, err error) { - // Slide existing data to beginning. - if b.r > 0 && len(p) > len(b.buf)-b.w { - copy(b.buf, b.buf[b.r:b.w]) - b.w -= b.r - b.r = 0 - } - - // Write new data. - n = copy(b.buf[b.w:], p) - b.w += n - if n < len(p) { - err = errWriteFull - } - return n, err -} diff --git a/vendor/golang.org/x/net/http2/frame.go b/vendor/golang.org/x/net/http2/frame.go index 358833f..3b14890 100644 --- a/vendor/golang.org/x/net/http2/frame.go +++ b/vendor/golang.org/x/net/http2/frame.go @@ -122,7 +122,7 @@ var flagName = map[FrameType]map[Flags]string{ // a frameParser parses a frame given its FrameHeader and payload // bytes. The length of payload will always equal fh.Length (which // might be 0). -type frameParser func(fh FrameHeader, payload []byte) (Frame, error) +type frameParser func(fc *frameCache, fh FrameHeader, payload []byte) (Frame, error) var frameParsers = map[FrameType]frameParser{ FrameData: parseDataFrame, @@ -312,7 +312,7 @@ type Framer struct { MaxHeaderListSize uint32 // TODO: track which type of frame & with which flags was sent - // last. Then return an error (unless AllowIllegalWrites) if + // last. Then return an error (unless AllowIllegalWrites) if // we're in the middle of a header block and a // non-Continuation or Continuation on a different stream is // attempted to be written. @@ -323,6 +323,8 @@ type Framer struct { debugFramerBuf *bytes.Buffer debugReadLoggerf func(string, ...interface{}) debugWriteLoggerf func(string, ...interface{}) + + frameCache *frameCache // nil if frames aren't reused (default) } func (fr *Framer) maxHeaderListSize() uint32 { @@ -398,6 +400,27 @@ const ( maxFrameSize = 1<<24 - 1 ) +// SetReuseFrames allows the Framer to reuse Frames. +// If called on a Framer, Frames returned by calls to ReadFrame are only +// valid until the next call to ReadFrame. +func (fr *Framer) SetReuseFrames() { + if fr.frameCache != nil { + return + } + fr.frameCache = &frameCache{} +} + +type frameCache struct { + dataFrame DataFrame +} + +func (fc *frameCache) getDataFrame() *DataFrame { + if fc == nil { + return &DataFrame{} + } + return &fc.dataFrame +} + // NewFramer returns a Framer that writes frames to w and reads them from r. func NewFramer(w io.Writer, r io.Reader) *Framer { fr := &Framer{ @@ -477,7 +500,7 @@ func (fr *Framer) ReadFrame() (Frame, error) { if _, err := io.ReadFull(fr.r, payload); err != nil { return nil, err } - f, err := typeFrameParser(fh.Type)(fh, payload) + f, err := typeFrameParser(fh.Type)(fr.frameCache, fh, payload) if err != nil { if ce, ok := err.(connError); ok { return nil, fr.connError(ce.Code, ce.Reason) @@ -565,7 +588,7 @@ func (f *DataFrame) Data() []byte { return f.data } -func parseDataFrame(fh FrameHeader, payload []byte) (Frame, error) { +func parseDataFrame(fc *frameCache, fh FrameHeader, payload []byte) (Frame, error) { if fh.StreamID == 0 { // DATA frames MUST be associated with a stream. If a // DATA frame is received whose stream identifier @@ -574,9 +597,9 @@ func parseDataFrame(fh FrameHeader, payload []byte) (Frame, error) { // PROTOCOL_ERROR. return nil, connError{ErrCodeProtocol, "DATA frame with stream ID 0"} } - f := &DataFrame{ - FrameHeader: fh, - } + f := fc.getDataFrame() + f.FrameHeader = fh + var padSize byte if fh.Flags.Has(FlagDataPadded) { var err error @@ -600,6 +623,7 @@ var ( errStreamID = errors.New("invalid stream ID") errDepStreamID = errors.New("invalid dependent stream ID") errPadLength = errors.New("pad length too large") + errPadBytes = errors.New("padding bytes must all be zeros unless AllowIllegalWrites is enabled") ) func validStreamIDOrZero(streamID uint32) bool { @@ -623,6 +647,7 @@ func (f *Framer) WriteData(streamID uint32, endStream bool, data []byte) error { // // If pad is nil, the padding bit is not sent. // The length of pad must not exceed 255 bytes. +// The bytes of pad must all be zero, unless f.AllowIllegalWrites is set. // // It will perform exactly one Write to the underlying Writer. // It is the caller's responsibility not to violate the maximum frame size @@ -631,8 +656,18 @@ func (f *Framer) WriteDataPadded(streamID uint32, endStream bool, data, pad []by if !validStreamID(streamID) && !f.AllowIllegalWrites { return errStreamID } - if len(pad) > 255 { - return errPadLength + if len(pad) > 0 { + if len(pad) > 255 { + return errPadLength + } + if !f.AllowIllegalWrites { + for _, b := range pad { + if b != 0 { + // "Padding octets MUST be set to zero when sending." + return errPadBytes + } + } + } } var flags Flags if endStream { @@ -660,10 +695,10 @@ type SettingsFrame struct { p []byte } -func parseSettingsFrame(fh FrameHeader, p []byte) (Frame, error) { +func parseSettingsFrame(_ *frameCache, fh FrameHeader, p []byte) (Frame, error) { if fh.Flags.Has(FlagSettingsAck) && fh.Length > 0 { // When this (ACK 0x1) bit is set, the payload of the - // SETTINGS frame MUST be empty. Receipt of a + // SETTINGS frame MUST be empty. Receipt of a // SETTINGS frame with the ACK flag set and a length // field value other than 0 MUST be treated as a // connection error (Section 5.4.1) of type @@ -672,7 +707,7 @@ func parseSettingsFrame(fh FrameHeader, p []byte) (Frame, error) { } if fh.StreamID != 0 { // SETTINGS frames always apply to a connection, - // never a single stream. The stream identifier for a + // never a single stream. The stream identifier for a // SETTINGS frame MUST be zero (0x0). If an endpoint // receives a SETTINGS frame whose stream identifier // field is anything other than 0x0, the endpoint MUST @@ -762,7 +797,7 @@ type PingFrame struct { func (f *PingFrame) IsAck() bool { return f.Flags.Has(FlagPingAck) } -func parsePingFrame(fh FrameHeader, payload []byte) (Frame, error) { +func parsePingFrame(_ *frameCache, fh FrameHeader, payload []byte) (Frame, error) { if len(payload) != 8 { return nil, ConnectionError(ErrCodeFrameSize) } @@ -802,7 +837,7 @@ func (f *GoAwayFrame) DebugData() []byte { return f.debugData } -func parseGoAwayFrame(fh FrameHeader, p []byte) (Frame, error) { +func parseGoAwayFrame(_ *frameCache, fh FrameHeader, p []byte) (Frame, error) { if fh.StreamID != 0 { return nil, ConnectionError(ErrCodeProtocol) } @@ -842,7 +877,7 @@ func (f *UnknownFrame) Payload() []byte { return f.p } -func parseUnknownFrame(fh FrameHeader, p []byte) (Frame, error) { +func parseUnknownFrame(_ *frameCache, fh FrameHeader, p []byte) (Frame, error) { return &UnknownFrame{fh, p}, nil } @@ -853,7 +888,7 @@ type WindowUpdateFrame struct { Increment uint32 // never read with high bit set } -func parseWindowUpdateFrame(fh FrameHeader, p []byte) (Frame, error) { +func parseWindowUpdateFrame(_ *frameCache, fh FrameHeader, p []byte) (Frame, error) { if len(p) != 4 { return nil, ConnectionError(ErrCodeFrameSize) } @@ -918,12 +953,12 @@ func (f *HeadersFrame) HasPriority() bool { return f.FrameHeader.Flags.Has(FlagHeadersPriority) } -func parseHeadersFrame(fh FrameHeader, p []byte) (_ Frame, err error) { +func parseHeadersFrame(_ *frameCache, fh FrameHeader, p []byte) (_ Frame, err error) { hf := &HeadersFrame{ FrameHeader: fh, } if fh.StreamID == 0 { - // HEADERS frames MUST be associated with a stream. If a HEADERS frame + // HEADERS frames MUST be associated with a stream. If a HEADERS frame // is received whose stream identifier field is 0x0, the recipient MUST // respond with a connection error (Section 5.4.1) of type // PROTOCOL_ERROR. @@ -1045,7 +1080,7 @@ type PriorityParam struct { Exclusive bool // Weight is the stream's zero-indexed weight. It should be - // set together with StreamDep, or neither should be set. Per + // set together with StreamDep, or neither should be set. Per // the spec, "Add one to the value to obtain a weight between // 1 and 256." Weight uint8 @@ -1055,7 +1090,7 @@ func (p PriorityParam) IsZero() bool { return p == PriorityParam{} } -func parsePriorityFrame(fh FrameHeader, payload []byte) (Frame, error) { +func parsePriorityFrame(_ *frameCache, fh FrameHeader, payload []byte) (Frame, error) { if fh.StreamID == 0 { return nil, connError{ErrCodeProtocol, "PRIORITY frame with stream ID 0"} } @@ -1102,7 +1137,7 @@ type RSTStreamFrame struct { ErrCode ErrCode } -func parseRSTStreamFrame(fh FrameHeader, p []byte) (Frame, error) { +func parseRSTStreamFrame(_ *frameCache, fh FrameHeader, p []byte) (Frame, error) { if len(p) != 4 { return nil, ConnectionError(ErrCodeFrameSize) } @@ -1132,7 +1167,7 @@ type ContinuationFrame struct { headerFragBuf []byte } -func parseContinuationFrame(fh FrameHeader, p []byte) (Frame, error) { +func parseContinuationFrame(_ *frameCache, fh FrameHeader, p []byte) (Frame, error) { if fh.StreamID == 0 { return nil, connError{ErrCodeProtocol, "CONTINUATION frame with stream ID 0"} } @@ -1182,7 +1217,7 @@ func (f *PushPromiseFrame) HeadersEnded() bool { return f.FrameHeader.Flags.Has(FlagPushPromiseEndHeaders) } -func parsePushPromise(fh FrameHeader, p []byte) (_ Frame, err error) { +func parsePushPromise(_ *frameCache, fh FrameHeader, p []byte) (_ Frame, err error) { pp := &PushPromiseFrame{ FrameHeader: fh, } diff --git a/vendor/golang.org/x/net/http2/go16.go b/vendor/golang.org/x/net/http2/go16.go index 2b72855..00b2e9e 100644 --- a/vendor/golang.org/x/net/http2/go16.go +++ b/vendor/golang.org/x/net/http2/go16.go @@ -7,7 +7,6 @@ package http2 import ( - "crypto/tls" "net/http" "time" ) @@ -15,29 +14,3 @@ import ( func transportExpectContinueTimeout(t1 *http.Transport) time.Duration { return t1.ExpectContinueTimeout } - -// isBadCipher reports whether the cipher is blacklisted by the HTTP/2 spec. -func isBadCipher(cipher uint16) bool { - switch cipher { - case tls.TLS_RSA_WITH_RC4_128_SHA, - tls.TLS_RSA_WITH_3DES_EDE_CBC_SHA, - tls.TLS_RSA_WITH_AES_128_CBC_SHA, - tls.TLS_RSA_WITH_AES_256_CBC_SHA, - tls.TLS_RSA_WITH_AES_128_GCM_SHA256, - tls.TLS_RSA_WITH_AES_256_GCM_SHA384, - tls.TLS_ECDHE_ECDSA_WITH_RC4_128_SHA, - tls.TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA, - tls.TLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHA, - tls.TLS_ECDHE_RSA_WITH_RC4_128_SHA, - tls.TLS_ECDHE_RSA_WITH_3DES_EDE_CBC_SHA, - tls.TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA, - tls.TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA: - // Reject cipher suites from Appendix A. - // "This list includes those cipher suites that do not - // offer an ephemeral key exchange and those that are - // based on the TLS null, stream or block cipher type" - return true - default: - return false - } -} diff --git a/vendor/golang.org/x/net/http2/go18.go b/vendor/golang.org/x/net/http2/go18.go index 633202c..4f30d22 100644 --- a/vendor/golang.org/x/net/http2/go18.go +++ b/vendor/golang.org/x/net/http2/go18.go @@ -12,7 +12,11 @@ import ( "net/http" ) -func cloneTLSConfig(c *tls.Config) *tls.Config { return c.Clone() } +func cloneTLSConfig(c *tls.Config) *tls.Config { + c2 := c.Clone() + c2.GetClientCertificate = c.GetClientCertificate // golang.org/issue/19264 + return c2 +} var _ http.Pusher = (*responseWriter)(nil) @@ -48,3 +52,5 @@ func reqGetBody(req *http.Request) func() (io.ReadCloser, error) { func reqBodyIsNoBody(body io.ReadCloser) bool { return body == http.NoBody } + +func go18httpNoBody() io.ReadCloser { return http.NoBody } // for tests only diff --git a/vendor/golang.org/x/net/http2/go19.go b/vendor/golang.org/x/net/http2/go19.go new file mode 100644 index 0000000..38124ba --- /dev/null +++ b/vendor/golang.org/x/net/http2/go19.go @@ -0,0 +1,16 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build go1.9 + +package http2 + +import ( + "net/http" +) + +func configureServer19(s *http.Server, conf *Server) error { + s.RegisterOnShutdown(conf.state.startGracefulShutdown) + return nil +} diff --git a/vendor/golang.org/x/net/http2/hpack/encode.go b/vendor/golang.org/x/net/http2/hpack/encode.go index f9bb033..54726c2 100644 --- a/vendor/golang.org/x/net/http2/hpack/encode.go +++ b/vendor/golang.org/x/net/http2/hpack/encode.go @@ -39,13 +39,14 @@ func NewEncoder(w io.Writer) *Encoder { tableSizeUpdate: false, w: w, } + e.dynTab.table.init() e.dynTab.setMaxSize(initialHeaderTableSize) return e } // WriteField encodes f into a single Write to e's underlying Writer. // This function may also produce bytes for "Header Table Size Update" -// if necessary. If produced, it is done before encoding f. +// if necessary. If produced, it is done before encoding f. func (e *Encoder) WriteField(f HeaderField) error { e.buf = e.buf[:0] @@ -88,29 +89,17 @@ func (e *Encoder) WriteField(f HeaderField) error { // only name matches, i points to that index and nameValueMatch // becomes false. func (e *Encoder) searchTable(f HeaderField) (i uint64, nameValueMatch bool) { - for idx, hf := range staticTable { - if !constantTimeStringCompare(hf.Name, f.Name) { - continue - } - if i == 0 { - i = uint64(idx + 1) - } - if f.Sensitive { - continue - } - if !constantTimeStringCompare(hf.Value, f.Value) { - continue - } - i = uint64(idx + 1) - nameValueMatch = true - return + i, nameValueMatch = staticTable.search(f) + if nameValueMatch { + return i, true } - j, nameValueMatch := e.dynTab.search(f) + j, nameValueMatch := e.dynTab.table.search(f) if nameValueMatch || (i == 0 && j != 0) { - i = j + uint64(len(staticTable)) + return j + uint64(staticTable.len()), nameValueMatch } - return + + return i, false } // SetMaxDynamicTableSize changes the dynamic header table size to v. diff --git a/vendor/golang.org/x/net/http2/hpack/hpack.go b/vendor/golang.org/x/net/http2/hpack/hpack.go index 135b9f6..176644a 100644 --- a/vendor/golang.org/x/net/http2/hpack/hpack.go +++ b/vendor/golang.org/x/net/http2/hpack/hpack.go @@ -61,7 +61,7 @@ func (hf HeaderField) String() string { func (hf HeaderField) Size() uint32 { // http://http2.github.io/http2-spec/compression.html#rfc.section.4.1 // "The size of the dynamic table is the sum of the size of - // its entries. The size of an entry is the sum of its name's + // its entries. The size of an entry is the sum of its name's // length in octets (as defined in Section 5.2), its value's // length in octets (see Section 5.2), plus 32. The size of // an entry is calculated using the length of the name and @@ -102,6 +102,7 @@ func NewDecoder(maxDynamicTableSize uint32, emitFunc func(f HeaderField)) *Decod emit: emitFunc, emitEnabled: true, } + d.dynTab.table.init() d.dynTab.allowedMaxSize = maxDynamicTableSize d.dynTab.setMaxSize(maxDynamicTableSize) return d @@ -154,12 +155,9 @@ func (d *Decoder) SetAllowedMaxDynamicTableSize(v uint32) { } type dynamicTable struct { - // ents is the FIFO described at // http://http2.github.io/http2-spec/compression.html#rfc.section.2.3.2 - // The newest (low index) is append at the end, and items are - // evicted from the front. - ents []HeaderField - size uint32 + table headerFieldTable + size uint32 // in bytes maxSize uint32 // current maxSize allowedMaxSize uint32 // maxSize may go up to this, inclusive } @@ -169,95 +167,45 @@ func (dt *dynamicTable) setMaxSize(v uint32) { dt.evict() } -// TODO: change dynamicTable to be a struct with a slice and a size int field, -// per http://http2.github.io/http2-spec/compression.html#rfc.section.4.1: -// -// -// Then make add increment the size. maybe the max size should move from Decoder to -// dynamicTable and add should return an ok bool if there was enough space. -// -// Later we'll need a remove operation on dynamicTable. - func (dt *dynamicTable) add(f HeaderField) { - dt.ents = append(dt.ents, f) + dt.table.addEntry(f) dt.size += f.Size() dt.evict() } -// If we're too big, evict old stuff (front of the slice) +// If we're too big, evict old stuff. func (dt *dynamicTable) evict() { - base := dt.ents // keep base pointer of slice - for dt.size > dt.maxSize { - dt.size -= dt.ents[0].Size() - dt.ents = dt.ents[1:] - } - - // Shift slice contents down if we evicted things. - if len(dt.ents) != len(base) { - copy(base, dt.ents) - dt.ents = base[:len(dt.ents)] + var n int + for dt.size > dt.maxSize && n < dt.table.len() { + dt.size -= dt.table.ents[n].Size() + n++ } -} - -// constantTimeStringCompare compares string a and b in a constant -// time manner. -func constantTimeStringCompare(a, b string) bool { - if len(a) != len(b) { - return false - } - - c := byte(0) - - for i := 0; i < len(a); i++ { - c |= a[i] ^ b[i] - } - - return c == 0 -} - -// Search searches f in the table. The return value i is 0 if there is -// no name match. If there is name match or name/value match, i is the -// index of that entry (1-based). If both name and value match, -// nameValueMatch becomes true. -func (dt *dynamicTable) search(f HeaderField) (i uint64, nameValueMatch bool) { - l := len(dt.ents) - for j := l - 1; j >= 0; j-- { - ent := dt.ents[j] - if !constantTimeStringCompare(ent.Name, f.Name) { - continue - } - if i == 0 { - i = uint64(l - j) - } - if f.Sensitive { - continue - } - if !constantTimeStringCompare(ent.Value, f.Value) { - continue - } - i = uint64(l - j) - nameValueMatch = true - return - } - return + dt.table.evictOldest(n) } func (d *Decoder) maxTableIndex() int { - return len(d.dynTab.ents) + len(staticTable) + // This should never overflow. RFC 7540 Section 6.5.2 limits the size of + // the dynamic table to 2^32 bytes, where each entry will occupy more than + // one byte. Further, the staticTable has a fixed, small length. + return d.dynTab.table.len() + staticTable.len() } func (d *Decoder) at(i uint64) (hf HeaderField, ok bool) { - if i < 1 { + // See Section 2.3.3. + if i == 0 { return } + if i <= uint64(staticTable.len()) { + return staticTable.ents[i-1], true + } if i > uint64(d.maxTableIndex()) { return } - if i <= uint64(len(staticTable)) { - return staticTable[i-1], true - } - dents := d.dynTab.ents - return dents[len(dents)-(int(i)-len(staticTable))], true + // In the dynamic table, newer entries have lower indices. + // However, dt.ents[0] is the oldest entry. Hence, dt.ents is + // the reversed dynamic table. + dt := d.dynTab.table + return dt.ents[dt.len()-(int(i)-staticTable.len())], true } // Decode decodes an entire block. @@ -307,7 +255,7 @@ func (d *Decoder) Write(p []byte) (n int, err error) { err = d.parseHeaderFieldRepr() if err == errNeedMore { // Extra paranoia, making sure saveBuf won't - // get too large. All the varint and string + // get too large. All the varint and string // reading code earlier should already catch // overlong things and return ErrStringLength, // but keep this as a last resort. diff --git a/vendor/golang.org/x/net/http2/hpack/tables.go b/vendor/golang.org/x/net/http2/hpack/tables.go index b9283a0..a66cfbe 100644 --- a/vendor/golang.org/x/net/http2/hpack/tables.go +++ b/vendor/golang.org/x/net/http2/hpack/tables.go @@ -4,73 +4,200 @@ package hpack -func pair(name, value string) HeaderField { - return HeaderField{Name: name, Value: value} +import ( + "fmt" +) + +// headerFieldTable implements a list of HeaderFields. +// This is used to implement the static and dynamic tables. +type headerFieldTable struct { + // For static tables, entries are never evicted. + // + // For dynamic tables, entries are evicted from ents[0] and added to the end. + // Each entry has a unique id that starts at one and increments for each + // entry that is added. This unique id is stable across evictions, meaning + // it can be used as a pointer to a specific entry. As in hpack, unique ids + // are 1-based. The unique id for ents[k] is k + evictCount + 1. + // + // Zero is not a valid unique id. + // + // evictCount should not overflow in any remotely practical situation. In + // practice, we will have one dynamic table per HTTP/2 connection. If we + // assume a very powerful server that handles 1M QPS per connection and each + // request adds (then evicts) 100 entries from the table, it would still take + // 2M years for evictCount to overflow. + ents []HeaderField + evictCount uint64 + + // byName maps a HeaderField name to the unique id of the newest entry with + // the same name. See above for a definition of "unique id". + byName map[string]uint64 + + // byNameValue maps a HeaderField name/value pair to the unique id of the newest + // entry with the same name and value. See above for a definition of "unique id". + byNameValue map[pairNameValue]uint64 +} + +type pairNameValue struct { + name, value string +} + +func (t *headerFieldTable) init() { + t.byName = make(map[string]uint64) + t.byNameValue = make(map[pairNameValue]uint64) +} + +// len reports the number of entries in the table. +func (t *headerFieldTable) len() int { + return len(t.ents) +} + +// addEntry adds a new entry. +func (t *headerFieldTable) addEntry(f HeaderField) { + id := uint64(t.len()) + t.evictCount + 1 + t.byName[f.Name] = id + t.byNameValue[pairNameValue{f.Name, f.Value}] = id + t.ents = append(t.ents, f) +} + +// evictOldest evicts the n oldest entries in the table. +func (t *headerFieldTable) evictOldest(n int) { + if n > t.len() { + panic(fmt.Sprintf("evictOldest(%v) on table with %v entries", n, t.len())) + } + for k := 0; k < n; k++ { + f := t.ents[k] + id := t.evictCount + uint64(k) + 1 + if t.byName[f.Name] == id { + delete(t.byName, f.Name) + } + if p := (pairNameValue{f.Name, f.Value}); t.byNameValue[p] == id { + delete(t.byNameValue, p) + } + } + copy(t.ents, t.ents[n:]) + for k := t.len() - n; k < t.len(); k++ { + t.ents[k] = HeaderField{} // so strings can be garbage collected + } + t.ents = t.ents[:t.len()-n] + if t.evictCount+uint64(n) < t.evictCount { + panic("evictCount overflow") + } + t.evictCount += uint64(n) +} + +// search finds f in the table. If there is no match, i is 0. +// If both name and value match, i is the matched index and nameValueMatch +// becomes true. If only name matches, i points to that index and +// nameValueMatch becomes false. +// +// The returned index is a 1-based HPACK index. For dynamic tables, HPACK says +// that index 1 should be the newest entry, but t.ents[0] is the oldest entry, +// meaning t.ents is reversed for dynamic tables. Hence, when t is a dynamic +// table, the return value i actually refers to the entry t.ents[t.len()-i]. +// +// All tables are assumed to be a dynamic tables except for the global +// staticTable pointer. +// +// See Section 2.3.3. +func (t *headerFieldTable) search(f HeaderField) (i uint64, nameValueMatch bool) { + if !f.Sensitive { + if id := t.byNameValue[pairNameValue{f.Name, f.Value}]; id != 0 { + return t.idToIndex(id), true + } + } + if id := t.byName[f.Name]; id != 0 { + return t.idToIndex(id), false + } + return 0, false +} + +// idToIndex converts a unique id to an HPACK index. +// See Section 2.3.3. +func (t *headerFieldTable) idToIndex(id uint64) uint64 { + if id <= t.evictCount { + panic(fmt.Sprintf("id (%v) <= evictCount (%v)", id, t.evictCount)) + } + k := id - t.evictCount - 1 // convert id to an index t.ents[k] + if t != staticTable { + return uint64(t.len()) - k // dynamic table + } + return k + 1 } // http://tools.ietf.org/html/draft-ietf-httpbis-header-compression-07#appendix-B -var staticTable = [...]HeaderField{ - pair(":authority", ""), // index 1 (1-based) - pair(":method", "GET"), - pair(":method", "POST"), - pair(":path", "/"), - pair(":path", "/index.html"), - pair(":scheme", "http"), - pair(":scheme", "https"), - pair(":status", "200"), - pair(":status", "204"), - pair(":status", "206"), - pair(":status", "304"), - pair(":status", "400"), - pair(":status", "404"), - pair(":status", "500"), - pair("accept-charset", ""), - pair("accept-encoding", "gzip, deflate"), - pair("accept-language", ""), - pair("accept-ranges", ""), - pair("accept", ""), - pair("access-control-allow-origin", ""), - pair("age", ""), - pair("allow", ""), - pair("authorization", ""), - pair("cache-control", ""), - pair("content-disposition", ""), - pair("content-encoding", ""), - pair("content-language", ""), - pair("content-length", ""), - pair("content-location", ""), - pair("content-range", ""), - pair("content-type", ""), - pair("cookie", ""), - pair("date", ""), - pair("etag", ""), - pair("expect", ""), - pair("expires", ""), - pair("from", ""), - pair("host", ""), - pair("if-match", ""), - pair("if-modified-since", ""), - pair("if-none-match", ""), - pair("if-range", ""), - pair("if-unmodified-since", ""), - pair("last-modified", ""), - pair("link", ""), - pair("location", ""), - pair("max-forwards", ""), - pair("proxy-authenticate", ""), - pair("proxy-authorization", ""), - pair("range", ""), - pair("referer", ""), - pair("refresh", ""), - pair("retry-after", ""), - pair("server", ""), - pair("set-cookie", ""), - pair("strict-transport-security", ""), - pair("transfer-encoding", ""), - pair("user-agent", ""), - pair("vary", ""), - pair("via", ""), - pair("www-authenticate", ""), +var staticTable = newStaticTable() +var staticTableEntries = [...]HeaderField{ + {Name: ":authority"}, + {Name: ":method", Value: "GET"}, + {Name: ":method", Value: "POST"}, + {Name: ":path", Value: "/"}, + {Name: ":path", Value: "/index.html"}, + {Name: ":scheme", Value: "http"}, + {Name: ":scheme", Value: "https"}, + {Name: ":status", Value: "200"}, + {Name: ":status", Value: "204"}, + {Name: ":status", Value: "206"}, + {Name: ":status", Value: "304"}, + {Name: ":status", Value: "400"}, + {Name: ":status", Value: "404"}, + {Name: ":status", Value: "500"}, + {Name: "accept-charset"}, + {Name: "accept-encoding", Value: "gzip, deflate"}, + {Name: "accept-language"}, + {Name: "accept-ranges"}, + {Name: "accept"}, + {Name: "access-control-allow-origin"}, + {Name: "age"}, + {Name: "allow"}, + {Name: "authorization"}, + {Name: "cache-control"}, + {Name: "content-disposition"}, + {Name: "content-encoding"}, + {Name: "content-language"}, + {Name: "content-length"}, + {Name: "content-location"}, + {Name: "content-range"}, + {Name: "content-type"}, + {Name: "cookie"}, + {Name: "date"}, + {Name: "etag"}, + {Name: "expect"}, + {Name: "expires"}, + {Name: "from"}, + {Name: "host"}, + {Name: "if-match"}, + {Name: "if-modified-since"}, + {Name: "if-none-match"}, + {Name: "if-range"}, + {Name: "if-unmodified-since"}, + {Name: "last-modified"}, + {Name: "link"}, + {Name: "location"}, + {Name: "max-forwards"}, + {Name: "proxy-authenticate"}, + {Name: "proxy-authorization"}, + {Name: "range"}, + {Name: "referer"}, + {Name: "refresh"}, + {Name: "retry-after"}, + {Name: "server"}, + {Name: "set-cookie"}, + {Name: "strict-transport-security"}, + {Name: "transfer-encoding"}, + {Name: "user-agent"}, + {Name: "vary"}, + {Name: "via"}, + {Name: "www-authenticate"}, +} + +func newStaticTable() *headerFieldTable { + t := &headerFieldTable{} + t.init() + for _, e := range staticTableEntries[:] { + t.addEntry(e) + } + return t } var huffmanCodes = [256]uint32{ diff --git a/vendor/golang.org/x/net/http2/http2.go b/vendor/golang.org/x/net/http2/http2.go index a91fed5..15d7aff 100644 --- a/vendor/golang.org/x/net/http2/http2.go +++ b/vendor/golang.org/x/net/http2/http2.go @@ -376,12 +376,16 @@ func (s *sorter) SortStrings(ss []string) { // validPseudoPath reports whether v is a valid :path pseudo-header // value. It must be either: // -// *) a non-empty string starting with '/', but not with with "//", +// *) a non-empty string starting with '/' // *) the string '*', for OPTIONS requests. // // For now this is only used a quick check for deciding when to clean // up Opaque URLs before sending requests from the Transport. // See golang.org/issue/16847 +// +// We used to enforce that the path also didn't start with "//", but +// Google's GFE accepts such paths and Chrome sends them, so ignore +// that part of the spec. See golang.org/issue/19103. func validPseudoPath(v string) bool { - return (len(v) > 0 && v[0] == '/' && (len(v) == 1 || v[1] != '/')) || v == "*" + return (len(v) > 0 && v[0] == '/') || v == "*" } diff --git a/vendor/golang.org/x/net/http2/not_go16.go b/vendor/golang.org/x/net/http2/not_go16.go index efd2e12..508cebc 100644 --- a/vendor/golang.org/x/net/http2/not_go16.go +++ b/vendor/golang.org/x/net/http2/not_go16.go @@ -7,7 +7,6 @@ package http2 import ( - "crypto/tls" "net/http" "time" ) @@ -20,27 +19,3 @@ func transportExpectContinueTimeout(t1 *http.Transport) time.Duration { return 0 } - -// isBadCipher reports whether the cipher is blacklisted by the HTTP/2 spec. -func isBadCipher(cipher uint16) bool { - switch cipher { - case tls.TLS_RSA_WITH_RC4_128_SHA, - tls.TLS_RSA_WITH_3DES_EDE_CBC_SHA, - tls.TLS_RSA_WITH_AES_128_CBC_SHA, - tls.TLS_RSA_WITH_AES_256_CBC_SHA, - tls.TLS_ECDHE_ECDSA_WITH_RC4_128_SHA, - tls.TLS_ECDHE_ECDSA_WITH_AES_128_CBC_SHA, - tls.TLS_ECDHE_ECDSA_WITH_AES_256_CBC_SHA, - tls.TLS_ECDHE_RSA_WITH_RC4_128_SHA, - tls.TLS_ECDHE_RSA_WITH_3DES_EDE_CBC_SHA, - tls.TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA, - tls.TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA: - // Reject cipher suites from Appendix A. - // "This list includes those cipher suites that do not - // offer an ephemeral key exchange and those that are - // based on the TLS null, stream or block cipher type" - return true - default: - return false - } -} diff --git a/vendor/golang.org/x/net/http2/not_go18.go b/vendor/golang.org/x/net/http2/not_go18.go index efbf83c..6f8d3f8 100644 --- a/vendor/golang.org/x/net/http2/not_go18.go +++ b/vendor/golang.org/x/net/http2/not_go18.go @@ -25,3 +25,5 @@ func reqGetBody(req *http.Request) func() (io.ReadCloser, error) { } func reqBodyIsNoBody(io.ReadCloser) bool { return false } + +func go18httpNoBody() io.ReadCloser { return nil } // for tests only diff --git a/vendor/golang.org/x/net/http2/not_go19.go b/vendor/golang.org/x/net/http2/not_go19.go new file mode 100644 index 0000000..5ae0772 --- /dev/null +++ b/vendor/golang.org/x/net/http2/not_go19.go @@ -0,0 +1,16 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build !go1.9 + +package http2 + +import ( + "net/http" +) + +func configureServer19(s *http.Server, conf *Server) error { + // not supported prior to go1.9 + return nil +} diff --git a/vendor/golang.org/x/net/http2/pipe.go b/vendor/golang.org/x/net/http2/pipe.go index 53b7a1d..a614009 100644 --- a/vendor/golang.org/x/net/http2/pipe.go +++ b/vendor/golang.org/x/net/http2/pipe.go @@ -10,13 +10,13 @@ import ( "sync" ) -// pipe is a goroutine-safe io.Reader/io.Writer pair. It's like +// pipe is a goroutine-safe io.Reader/io.Writer pair. It's like // io.Pipe except there are no PipeReader/PipeWriter halves, and the // underlying buffer is an interface. (io.Pipe is always unbuffered) type pipe struct { mu sync.Mutex - c sync.Cond // c.L lazily initialized to &p.mu - b pipeBuffer + c sync.Cond // c.L lazily initialized to &p.mu + b pipeBuffer // nil when done reading err error // read error once empty. non-nil means closed. breakErr error // immediate read error (caller doesn't see rest of b) donec chan struct{} // closed on error @@ -32,6 +32,9 @@ type pipeBuffer interface { func (p *pipe) Len() int { p.mu.Lock() defer p.mu.Unlock() + if p.b == nil { + return 0 + } return p.b.Len() } @@ -47,7 +50,7 @@ func (p *pipe) Read(d []byte) (n int, err error) { if p.breakErr != nil { return 0, p.breakErr } - if p.b.Len() > 0 { + if p.b != nil && p.b.Len() > 0 { return p.b.Read(d) } if p.err != nil { @@ -55,6 +58,7 @@ func (p *pipe) Read(d []byte) (n int, err error) { p.readFn() // e.g. copy trailers p.readFn = nil // not sticky like p.err } + p.b = nil return 0, p.err } p.c.Wait() @@ -75,6 +79,9 @@ func (p *pipe) Write(d []byte) (n int, err error) { if p.err != nil { return 0, errClosedPipeWrite } + if p.breakErr != nil { + return len(d), nil // discard when there is no reader + } return p.b.Write(d) } @@ -109,6 +116,9 @@ func (p *pipe) closeWithError(dst *error, err error, fn func()) { return } p.readFn = fn + if dst == &p.breakErr { + p.b = nil + } *dst = err p.closeDoneLocked() } diff --git a/vendor/golang.org/x/net/http2/server.go b/vendor/golang.org/x/net/http2/server.go index 3c6b90c..eae143d 100644 --- a/vendor/golang.org/x/net/http2/server.go +++ b/vendor/golang.org/x/net/http2/server.go @@ -110,9 +110,41 @@ type Server struct { // activity for the purposes of IdleTimeout. IdleTimeout time.Duration + // MaxUploadBufferPerConnection is the size of the initial flow + // control window for each connections. The HTTP/2 spec does not + // allow this to be smaller than 65535 or larger than 2^32-1. + // If the value is outside this range, a default value will be + // used instead. + MaxUploadBufferPerConnection int32 + + // MaxUploadBufferPerStream is the size of the initial flow control + // window for each stream. The HTTP/2 spec does not allow this to + // be larger than 2^32-1. If the value is zero or larger than the + // maximum, a default value will be used instead. + MaxUploadBufferPerStream int32 + // NewWriteScheduler constructs a write scheduler for a connection. // If nil, a default scheduler is chosen. NewWriteScheduler func() WriteScheduler + + // Internal state. This is a pointer (rather than embedded directly) + // so that we don't embed a Mutex in this struct, which will make the + // struct non-copyable, which might break some callers. + state *serverInternalState +} + +func (s *Server) initialConnRecvWindowSize() int32 { + if s.MaxUploadBufferPerConnection > initialWindowSize { + return s.MaxUploadBufferPerConnection + } + return 1 << 20 +} + +func (s *Server) initialStreamRecvWindowSize() int32 { + if s.MaxUploadBufferPerStream > 0 { + return s.MaxUploadBufferPerStream + } + return 1 << 20 } func (s *Server) maxReadFrameSize() uint32 { @@ -129,6 +161,40 @@ func (s *Server) maxConcurrentStreams() uint32 { return defaultMaxStreams } +type serverInternalState struct { + mu sync.Mutex + activeConns map[*serverConn]struct{} +} + +func (s *serverInternalState) registerConn(sc *serverConn) { + if s == nil { + return // if the Server was used without calling ConfigureServer + } + s.mu.Lock() + s.activeConns[sc] = struct{}{} + s.mu.Unlock() +} + +func (s *serverInternalState) unregisterConn(sc *serverConn) { + if s == nil { + return // if the Server was used without calling ConfigureServer + } + s.mu.Lock() + delete(s.activeConns, sc) + s.mu.Unlock() +} + +func (s *serverInternalState) startGracefulShutdown() { + if s == nil { + return // if the Server was used without calling ConfigureServer + } + s.mu.Lock() + for sc := range s.activeConns { + sc.startGracefulShutdown() + } + s.mu.Unlock() +} + // ConfigureServer adds HTTP/2 support to a net/http Server. // // The configuration conf may be nil. @@ -141,9 +207,13 @@ func ConfigureServer(s *http.Server, conf *Server) error { if conf == nil { conf = new(Server) } + conf.state = &serverInternalState{activeConns: make(map[*serverConn]struct{})} if err := configureServer18(s, conf); err != nil { return err } + if err := configureServer19(s, conf); err != nil { + return err + } if s.TLSConfig == nil { s.TLSConfig = new(tls.Config) @@ -255,35 +325,37 @@ func (s *Server) ServeConn(c net.Conn, opts *ServeConnOpts) { defer cancel() sc := &serverConn{ - srv: s, - hs: opts.baseConfig(), - conn: c, - baseCtx: baseCtx, - remoteAddrStr: c.RemoteAddr().String(), - bw: newBufferedWriter(c), - handler: opts.handler(), - streams: make(map[uint32]*stream), - readFrameCh: make(chan readFrameResult), - wantWriteFrameCh: make(chan FrameWriteRequest, 8), - wantStartPushCh: make(chan startPushRequest, 8), - wroteFrameCh: make(chan frameWriteResult, 1), // buffered; one send in writeFrameAsync - bodyReadCh: make(chan bodyReadMsg), // buffering doesn't matter either way - doneServing: make(chan struct{}), - clientMaxStreams: math.MaxUint32, // Section 6.5.2: "Initially, there is no limit to this value" - advMaxStreams: s.maxConcurrentStreams(), - initialWindowSize: initialWindowSize, - maxFrameSize: initialMaxFrameSize, - headerTableSize: initialHeaderTableSize, - serveG: newGoroutineLock(), - pushEnabled: true, - } + srv: s, + hs: opts.baseConfig(), + conn: c, + baseCtx: baseCtx, + remoteAddrStr: c.RemoteAddr().String(), + bw: newBufferedWriter(c), + handler: opts.handler(), + streams: make(map[uint32]*stream), + readFrameCh: make(chan readFrameResult), + wantWriteFrameCh: make(chan FrameWriteRequest, 8), + serveMsgCh: make(chan interface{}, 8), + wroteFrameCh: make(chan frameWriteResult, 1), // buffered; one send in writeFrameAsync + bodyReadCh: make(chan bodyReadMsg), // buffering doesn't matter either way + doneServing: make(chan struct{}), + clientMaxStreams: math.MaxUint32, // Section 6.5.2: "Initially, there is no limit to this value" + advMaxStreams: s.maxConcurrentStreams(), + initialStreamSendWindowSize: initialWindowSize, + maxFrameSize: initialMaxFrameSize, + headerTableSize: initialHeaderTableSize, + serveG: newGoroutineLock(), + pushEnabled: true, + } + + s.state.registerConn(sc) + defer s.state.unregisterConn(sc) // The net/http package sets the write deadline from the // http.Server.WriteTimeout during the TLS handshake, but then - // passes the connection off to us with the deadline already - // set. Disarm it here so that it is not applied to additional - // streams opened on this connection. - // TODO: implement WriteTimeout fully. See Issue 18437. + // passes the connection off to us with the deadline already set. + // Write deadlines are set per stream in serverConn.newStream. + // Disarm the net.Conn write deadline here. if sc.hs.WriteTimeout != 0 { sc.conn.SetWriteDeadline(time.Time{}) } @@ -294,6 +366,9 @@ func (s *Server) ServeConn(c net.Conn, opts *ServeConnOpts) { sc.writeSched = NewRandomWriteScheduler() } + // These start at the RFC-specified defaults. If there is a higher + // configured value for inflow, that will be updated when we send a + // WINDOW_UPDATE shortly after sending SETTINGS. sc.flow.add(initialWindowSize) sc.inflow.add(initialWindowSize) sc.hpackEncoder = hpack.NewEncoder(&sc.headerWriteBuf) @@ -376,10 +451,9 @@ type serverConn struct { doneServing chan struct{} // closed when serverConn.serve ends readFrameCh chan readFrameResult // written by serverConn.readFrames wantWriteFrameCh chan FrameWriteRequest // from handlers -> serve - wantStartPushCh chan startPushRequest // from handlers -> serve wroteFrameCh chan frameWriteResult // from writeFrameAsync -> serve, tickles more frame writes bodyReadCh chan bodyReadMsg // from handlers -> serve - testHookCh chan func(int) // code to run on the serve loop + serveMsgCh chan interface{} // misc messages & code to send to / run on the serve loop flow flow // conn-wide (not stream-specific) outbound flow control inflow flow // conn-wide inbound flow control tlsState *tls.ConnectionState // shared by all handlers, like net/http @@ -387,38 +461,39 @@ type serverConn struct { writeSched WriteScheduler // Everything following is owned by the serve loop; use serveG.check(): - serveG goroutineLock // used to verify funcs are on serve() - pushEnabled bool - sawFirstSettings bool // got the initial SETTINGS frame after the preface - needToSendSettingsAck bool - unackedSettings int // how many SETTINGS have we sent without ACKs? - clientMaxStreams uint32 // SETTINGS_MAX_CONCURRENT_STREAMS from client (our PUSH_PROMISE limit) - advMaxStreams uint32 // our SETTINGS_MAX_CONCURRENT_STREAMS advertised the client - curClientStreams uint32 // number of open streams initiated by the client - curPushedStreams uint32 // number of open streams initiated by server push - maxClientStreamID uint32 // max ever seen from client (odd), or 0 if there have been no client requests - maxPushPromiseID uint32 // ID of the last push promise (even), or 0 if there have been no pushes - streams map[uint32]*stream - initialWindowSize int32 - maxFrameSize int32 - headerTableSize uint32 - peerMaxHeaderListSize uint32 // zero means unknown (default) - canonHeader map[string]string // http2-lower-case -> Go-Canonical-Case - writingFrame bool // started writing a frame (on serve goroutine or separate) - writingFrameAsync bool // started a frame on its own goroutine but haven't heard back on wroteFrameCh - needsFrameFlush bool // last frame write wasn't a flush - inGoAway bool // we've started to or sent GOAWAY - inFrameScheduleLoop bool // whether we're in the scheduleFrameWrite loop - needToSendGoAway bool // we need to schedule a GOAWAY frame write - goAwayCode ErrCode - shutdownTimerCh <-chan time.Time // nil until used - shutdownTimer *time.Timer // nil until used - idleTimer *time.Timer // nil if unused - idleTimerCh <-chan time.Time // nil if unused + serveG goroutineLock // used to verify funcs are on serve() + pushEnabled bool + sawFirstSettings bool // got the initial SETTINGS frame after the preface + needToSendSettingsAck bool + unackedSettings int // how many SETTINGS have we sent without ACKs? + clientMaxStreams uint32 // SETTINGS_MAX_CONCURRENT_STREAMS from client (our PUSH_PROMISE limit) + advMaxStreams uint32 // our SETTINGS_MAX_CONCURRENT_STREAMS advertised the client + curClientStreams uint32 // number of open streams initiated by the client + curPushedStreams uint32 // number of open streams initiated by server push + maxClientStreamID uint32 // max ever seen from client (odd), or 0 if there have been no client requests + maxPushPromiseID uint32 // ID of the last push promise (even), or 0 if there have been no pushes + streams map[uint32]*stream + initialStreamSendWindowSize int32 + maxFrameSize int32 + headerTableSize uint32 + peerMaxHeaderListSize uint32 // zero means unknown (default) + canonHeader map[string]string // http2-lower-case -> Go-Canonical-Case + writingFrame bool // started writing a frame (on serve goroutine or separate) + writingFrameAsync bool // started a frame on its own goroutine but haven't heard back on wroteFrameCh + needsFrameFlush bool // last frame write wasn't a flush + inGoAway bool // we've started to or sent GOAWAY + inFrameScheduleLoop bool // whether we're in the scheduleFrameWrite loop + needToSendGoAway bool // we need to schedule a GOAWAY frame write + goAwayCode ErrCode + shutdownTimer *time.Timer // nil until used + idleTimer *time.Timer // nil if unused // Owned by the writeFrameAsync goroutine: headerWriteBuf bytes.Buffer hpackEncoder *hpack.Encoder + + // Used by startGracefulShutdown. + shutdownOnce sync.Once } func (sc *serverConn) maxHeaderListSize() uint32 { @@ -463,10 +538,10 @@ type stream struct { numTrailerValues int64 weight uint8 state streamState - resetQueued bool // RST_STREAM queued for write; set by sc.resetStream - gotTrailerHeader bool // HEADER frame for trailers was seen - wroteHeaders bool // whether we wrote headers (not status 100) - reqBuf []byte // if non-nil, body pipe buffer to return later at EOF + resetQueued bool // RST_STREAM queued for write; set by sc.resetStream + gotTrailerHeader bool // HEADER frame for trailers was seen + wroteHeaders bool // whether we wrote headers (not status 100) + writeDeadline *time.Timer // nil if unused trailer http.Header // accumulated trailers reqTrailer http.Header // handler's Request.Trailer @@ -696,48 +771,48 @@ func (sc *serverConn) serve() { {SettingMaxFrameSize, sc.srv.maxReadFrameSize()}, {SettingMaxConcurrentStreams, sc.advMaxStreams}, {SettingMaxHeaderListSize, sc.maxHeaderListSize()}, - - // TODO: more actual settings, notably - // SettingInitialWindowSize, but then we also - // want to bump up the conn window size the - // same amount here right after the settings + {SettingInitialWindowSize, uint32(sc.srv.initialStreamRecvWindowSize())}, }, }) sc.unackedSettings++ + // Each connection starts with intialWindowSize inflow tokens. + // If a higher value is configured, we add more tokens. + if diff := sc.srv.initialConnRecvWindowSize() - initialWindowSize; diff > 0 { + sc.sendWindowUpdate(nil, int(diff)) + } + if err := sc.readPreface(); err != nil { sc.condlogf(err, "http2: server: error reading preface from client %v: %v", sc.conn.RemoteAddr(), err) return } // Now that we've got the preface, get us out of the - // "StateNew" state. We can't go directly to idle, though. + // "StateNew" state. We can't go directly to idle, though. // Active means we read some data and anticipate a request. We'll // do another Active when we get a HEADERS frame. sc.setConnState(http.StateActive) sc.setConnState(http.StateIdle) if sc.srv.IdleTimeout != 0 { - sc.idleTimer = time.NewTimer(sc.srv.IdleTimeout) + sc.idleTimer = time.AfterFunc(sc.srv.IdleTimeout, sc.onIdleTimer) defer sc.idleTimer.Stop() - sc.idleTimerCh = sc.idleTimer.C - } - - var gracefulShutdownCh <-chan struct{} - if sc.hs != nil { - gracefulShutdownCh = h1ServerShutdownChan(sc.hs) } go sc.readFrames() // closed by defer sc.conn.Close above - settingsTimer := time.NewTimer(firstSettingsTimeout) + settingsTimer := time.AfterFunc(firstSettingsTimeout, sc.onSettingsTimer) + defer settingsTimer.Stop() + loopNum := 0 for { loopNum++ select { case wr := <-sc.wantWriteFrameCh: + if se, ok := wr.write.(StreamError); ok { + sc.resetStream(se) + break + } sc.writeFrame(wr) - case spr := <-sc.wantStartPushCh: - sc.startPush(spr) case res := <-sc.wroteFrameCh: sc.wroteFrame(res) case res := <-sc.readFrameCh: @@ -745,26 +820,37 @@ func (sc *serverConn) serve() { return } res.readMore() - if settingsTimer.C != nil { + if settingsTimer != nil { settingsTimer.Stop() - settingsTimer.C = nil + settingsTimer = nil } case m := <-sc.bodyReadCh: sc.noteBodyRead(m.st, m.n) - case <-settingsTimer.C: - sc.logf("timeout waiting for SETTINGS frames from %v", sc.conn.RemoteAddr()) - return - case <-gracefulShutdownCh: - gracefulShutdownCh = nil - sc.startGracefulShutdown() - case <-sc.shutdownTimerCh: - sc.vlogf("GOAWAY close timer fired; closing conn from %v", sc.conn.RemoteAddr()) - return - case <-sc.idleTimerCh: - sc.vlogf("connection is idle") - sc.goAway(ErrCodeNo) - case fn := <-sc.testHookCh: - fn(loopNum) + case msg := <-sc.serveMsgCh: + switch v := msg.(type) { + case func(int): + v(loopNum) // for testing + case *serverMessage: + switch v { + case settingsTimerMsg: + sc.logf("timeout waiting for SETTINGS frames from %v", sc.conn.RemoteAddr()) + return + case idleTimerMsg: + sc.vlogf("connection is idle") + sc.goAway(ErrCodeNo) + case shutdownTimerMsg: + sc.vlogf("GOAWAY close timer fired; closing conn from %v", sc.conn.RemoteAddr()) + return + case gracefulShutdownMsg: + sc.startGracefulShutdownInternal() + default: + panic("unknown timer") + } + case *startPushRequest: + sc.startPush(v) + default: + panic(fmt.Sprintf("unexpected type %T", v)) + } } if sc.inGoAway && sc.curOpenStreams() == 0 && !sc.needToSendGoAway && !sc.writingFrame { @@ -773,6 +859,36 @@ func (sc *serverConn) serve() { } } +func (sc *serverConn) awaitGracefulShutdown(sharedCh <-chan struct{}, privateCh chan struct{}) { + select { + case <-sc.doneServing: + case <-sharedCh: + close(privateCh) + } +} + +type serverMessage int + +// Message values sent to serveMsgCh. +var ( + settingsTimerMsg = new(serverMessage) + idleTimerMsg = new(serverMessage) + shutdownTimerMsg = new(serverMessage) + gracefulShutdownMsg = new(serverMessage) +) + +func (sc *serverConn) onSettingsTimer() { sc.sendServeMsg(settingsTimerMsg) } +func (sc *serverConn) onIdleTimer() { sc.sendServeMsg(idleTimerMsg) } +func (sc *serverConn) onShutdownTimer() { sc.sendServeMsg(shutdownTimerMsg) } + +func (sc *serverConn) sendServeMsg(msg interface{}) { + sc.serveG.checkNotOn() // NOT + select { + case sc.serveMsgCh <- msg: + case <-sc.doneServing: + } +} + // readPreface reads the ClientPreface greeting from the peer // or returns an error on timeout or an invalid greeting. func (sc *serverConn) readPreface() error { @@ -1014,7 +1130,11 @@ func (sc *serverConn) wroteFrame(res frameWriteResult) { // stateClosed after the RST_STREAM frame is // written. st.state = stateHalfClosedLocal - sc.resetStream(streamError(st.id, ErrCodeCancel)) + // Section 8.1: a server MAY request that the client abort + // transmission of a request without error by sending a + // RST_STREAM with an error code of NO_ERROR after sending + // a complete response. + sc.resetStream(streamError(st.id, ErrCodeNo)) case stateHalfClosedRemote: sc.closeStream(st, errHandlerComplete) } @@ -1086,10 +1206,19 @@ func (sc *serverConn) scheduleFrameWrite() { sc.inFrameScheduleLoop = false } -// startGracefulShutdown sends a GOAWAY with ErrCodeNo to tell the -// client we're gracefully shutting down. The connection isn't closed -// until all current streams are done. +// startGracefulShutdown gracefully shuts down a connection. This +// sends GOAWAY with ErrCodeNo to tell the client we're gracefully +// shutting down. The connection isn't closed until all current +// streams are done. +// +// startGracefulShutdown returns immediately; it does not wait until +// the connection has shut down. func (sc *serverConn) startGracefulShutdown() { + sc.serveG.checkNotOn() // NOT + sc.shutdownOnce.Do(func() { sc.sendServeMsg(gracefulShutdownMsg) }) +} + +func (sc *serverConn) startGracefulShutdownInternal() { sc.goAwayIn(ErrCodeNo, 0) } @@ -1121,8 +1250,7 @@ func (sc *serverConn) goAwayIn(code ErrCode, forceCloseIn time.Duration) { func (sc *serverConn) shutDownIn(d time.Duration) { sc.serveG.check() - sc.shutdownTimer = time.NewTimer(d) - sc.shutdownTimerCh = sc.shutdownTimer.C + sc.shutdownTimer = time.AfterFunc(d, sc.onShutdownTimer) } func (sc *serverConn) resetStream(se StreamError) { @@ -1305,6 +1433,9 @@ func (sc *serverConn) closeStream(st *stream, err error) { panic(fmt.Sprintf("invariant; can't close stream in state %v", st.state)) } st.state = stateClosed + if st.writeDeadline != nil { + st.writeDeadline.Stop() + } if st.isPushed() { sc.curPushedStreams-- } else { @@ -1317,7 +1448,7 @@ func (sc *serverConn) closeStream(st *stream, err error) { sc.idleTimer.Reset(sc.srv.IdleTimeout) } if h1ServerKeepAlivesDisabled(sc.hs) { - sc.startGracefulShutdown() + sc.startGracefulShutdownInternal() } } if p := st.body; p != nil { @@ -1395,9 +1526,9 @@ func (sc *serverConn) processSettingInitialWindowSize(val uint32) error { // adjust the size of all stream flow control windows that it // maintains by the difference between the new value and the // old value." - old := sc.initialWindowSize - sc.initialWindowSize = int32(val) - growth := sc.initialWindowSize - old // may be negative + old := sc.initialStreamSendWindowSize + sc.initialStreamSendWindowSize = int32(val) + growth := int32(val) - old // may be negative for _, st := range sc.streams { if !st.flow.add(growth) { // 6.9.2 Initial Flow Control Window Size @@ -1504,7 +1635,7 @@ func (sc *serverConn) processGoAway(f *GoAwayFrame) error { } else { sc.vlogf("http2: received GOAWAY %+v, starting graceful shutdown", f) } - sc.startGracefulShutdown() + sc.startGracefulShutdownInternal() // http://tools.ietf.org/html/rfc7540#section-6.8 // We should not create any new streams, which means we should disable push. sc.pushEnabled = false @@ -1543,6 +1674,12 @@ func (st *stream) copyTrailersToHandlerRequest() { } } +// onWriteTimeout is run on its own goroutine (from time.AfterFunc) +// when the stream's WriteTimeout has fired. +func (st *stream) onWriteTimeout() { + st.sc.writeFrameFromHandler(FrameWriteRequest{write: streamError(st.id, ErrCodeInternal)}) +} + func (sc *serverConn) processHeaders(f *MetaHeadersFrame) error { sc.serveG.check() id := f.StreamID @@ -1719,9 +1856,12 @@ func (sc *serverConn) newStream(id, pusherID uint32, state streamState) *stream } st.cw.Init() st.flow.conn = &sc.flow // link to conn-level counter - st.flow.add(sc.initialWindowSize) - st.inflow.conn = &sc.inflow // link to conn-level counter - st.inflow.add(initialWindowSize) // TODO: update this when we send a higher initial window size in the initial settings + st.flow.add(sc.initialStreamSendWindowSize) + st.inflow.conn = &sc.inflow // link to conn-level counter + st.inflow.add(sc.srv.initialStreamRecvWindowSize()) + if sc.hs.WriteTimeout != 0 { + st.writeDeadline = time.AfterFunc(sc.hs.WriteTimeout, st.onWriteTimeout) + } sc.streams[id] = st sc.writeSched.OpenStream(st.id, OpenStreamOptions{PusherID: pusherID}) @@ -1785,16 +1925,14 @@ func (sc *serverConn) newWriterAndRequest(st *stream, f *MetaHeadersFrame) (*res return nil, nil, err } if bodyOpen { - st.reqBuf = getRequestBodyBuf() - req.Body.(*requestBody).pipe = &pipe{ - b: &fixedBuffer{buf: st.reqBuf}, - } - if vv, ok := rp.header["Content-Length"]; ok { req.ContentLength, _ = strconv.ParseInt(vv[0], 10, 64) } else { req.ContentLength = -1 } + req.Body.(*requestBody).pipe = &pipe{ + b: &dataBuffer{expected: req.ContentLength}, + } } return rw, req, nil } @@ -1890,24 +2028,6 @@ func (sc *serverConn) newWriterAndRequestNoBody(st *stream, rp requestParam) (*r return rw, req, nil } -var reqBodyCache = make(chan []byte, 8) - -func getRequestBodyBuf() []byte { - select { - case b := <-reqBodyCache: - return b - default: - return make([]byte, initialWindowSize) - } -} - -func putRequestBodyBuf(b []byte) { - select { - case reqBodyCache <- b: - default: - } -} - // Run on its own goroutine. func (sc *serverConn) runHandler(rw *responseWriter, req *http.Request, handler func(http.ResponseWriter, *http.Request)) { didPanic := true @@ -2003,12 +2123,6 @@ func (sc *serverConn) noteBodyReadFromHandler(st *stream, n int, err error) { case <-sc.doneServing: } } - if err == io.EOF { - if buf := st.reqBuf; buf != nil { - st.reqBuf = nil // shouldn't matter; field unused by other - putRequestBodyBuf(buf) - } - } } func (sc *serverConn) noteBodyRead(st *stream, n int) { @@ -2103,8 +2217,8 @@ func (b *requestBody) Read(p []byte) (n int, err error) { return } -// responseWriter is the http.ResponseWriter implementation. It's -// intentionally small (1 pointer wide) to minimize garbage. The +// responseWriter is the http.ResponseWriter implementation. It's +// intentionally small (1 pointer wide) to minimize garbage. The // responseWriterState pointer inside is zeroed at the end of a // request (in handlerDone) and calls on the responseWriter thereafter // simply crash (caller's mistake), but the much larger responseWriterState @@ -2138,6 +2252,7 @@ type responseWriterState struct { wroteHeader bool // WriteHeader called (explicitly or implicitly). Not necessarily sent to user yet. sentHeader bool // have we sent the header frame? handlerDone bool // handler has finished + dirty bool // a Write failed; don't reuse this responseWriterState sentContentLen int64 // non-zero if handler set a Content-Length header wroteBytes int64 @@ -2219,6 +2334,7 @@ func (rws *responseWriterState) writeChunk(p []byte) (n int, err error) { date: date, }) if err != nil { + rws.dirty = true return 0, err } if endStream { @@ -2240,6 +2356,7 @@ func (rws *responseWriterState) writeChunk(p []byte) (n int, err error) { if len(p) > 0 || endStream { // only send a 0 byte DATA frame if we're ending the stream. if err := rws.conn.writeDataFromHandler(rws.stream, p, endStream); err != nil { + rws.dirty = true return 0, err } } @@ -2251,6 +2368,9 @@ func (rws *responseWriterState) writeChunk(p []byte) (n int, err error) { trailers: rws.trailers, endStream: true, }) + if err != nil { + rws.dirty = true + } return len(p), err } return len(p), nil @@ -2278,7 +2398,7 @@ const TrailerPrefix = "Trailer:" // says you SHOULD (but not must) predeclare any trailers in the // header, the official ResponseWriter rules said trailers in Go must // be predeclared, and then we reuse the same ResponseWriter.Header() -// map to mean both Headers and Trailers. When it's time to write the +// map to mean both Headers and Trailers. When it's time to write the // Trailers, we pick out the fields of Headers that were declared as // trailers. That worked for a while, until we found the first major // user of Trailers in the wild: gRPC (using them only over http2), @@ -2390,7 +2510,7 @@ func cloneHeader(h http.Header) http.Header { // // * Handler calls w.Write or w.WriteString -> // * -> rws.bw (*bufio.Writer) -> -// * (Handler migth call Flush) +// * (Handler might call Flush) // * -> chunkWriter{rws} // * -> responseWriterState.writeChunk(p []byte) // * -> responseWriterState.writeChunk (most of the magic; see comment there) @@ -2429,10 +2549,19 @@ func (w *responseWriter) write(lenData int, dataB []byte, dataS string) (n int, func (w *responseWriter) handlerDone() { rws := w.rws + dirty := rws.dirty rws.handlerDone = true w.Flush() w.rws = nil - responseWriterStatePool.Put(rws) + if !dirty { + // Only recycle the pool if all prior Write calls to + // the serverConn goroutine completed successfully. If + // they returned earlier due to resets from the peer + // there might still be write goroutines outstanding + // from the serverConn referencing the rws memory. See + // issue 20704. + responseWriterStatePool.Put(rws) + } } // Push errors. @@ -2514,7 +2643,7 @@ func (w *responseWriter) push(target string, opts pushOptions) error { return fmt.Errorf("method %q must be GET or HEAD", opts.Method) } - msg := startPushRequest{ + msg := &startPushRequest{ parent: st, method: opts.Method, url: u, @@ -2527,7 +2656,7 @@ func (w *responseWriter) push(target string, opts pushOptions) error { return errClientDisconnected case <-st.cw: return errStreamClosed - case sc.wantStartPushCh <- msg: + case sc.serveMsgCh <- msg: } select { @@ -2549,7 +2678,7 @@ type startPushRequest struct { done chan error } -func (sc *serverConn) startPush(msg startPushRequest) { +func (sc *serverConn) startPush(msg *startPushRequest) { sc.serveG.check() // http://tools.ietf.org/html/rfc7540#section-6.6. @@ -2588,7 +2717,7 @@ func (sc *serverConn) startPush(msg startPushRequest) { // A server that is unable to establish a new stream identifier can send a GOAWAY // frame so that the client is forced to open a new connection for new streams. if sc.maxPushPromiseID+2 >= 1<<31 { - sc.startGracefulShutdown() + sc.startGracefulShutdownInternal() return 0, ErrPushLimitReached } sc.maxPushPromiseID += 2 @@ -2713,31 +2842,6 @@ var badTrailer = map[string]bool{ "Www-Authenticate": true, } -// h1ServerShutdownChan returns a channel that will be closed when the -// provided *http.Server wants to shut down. -// -// This is a somewhat hacky way to get at http1 innards. It works -// when the http2 code is bundled into the net/http package in the -// standard library. The alternatives ended up making the cmd/go tool -// depend on http Servers. This is the lightest option for now. -// This is tested via the TestServeShutdown* tests in net/http. -func h1ServerShutdownChan(hs *http.Server) <-chan struct{} { - if fn := testh1ServerShutdownChan; fn != nil { - return fn(hs) - } - var x interface{} = hs - type I interface { - getDoneChan() <-chan struct{} - } - if hs, ok := x.(I); ok { - return hs.getDoneChan() - } - return nil -} - -// optional test hook for h1ServerShutdownChan. -var testh1ServerShutdownChan func(hs *http.Server) <-chan struct{} - // h1ServerKeepAlivesDisabled reports whether hs has its keep-alives // disabled. See comments on h1ServerShutdownChan above for why // the code is written this way. diff --git a/vendor/golang.org/x/net/http2/transport.go b/vendor/golang.org/x/net/http2/transport.go index 0c7e859..e0dfe9f 100644 --- a/vendor/golang.org/x/net/http2/transport.go +++ b/vendor/golang.org/x/net/http2/transport.go @@ -18,6 +18,7 @@ import ( "io/ioutil" "log" "math" + mathrand "math/rand" "net" "net/http" "sort" @@ -164,6 +165,7 @@ type ClientConn struct { goAwayDebug string // goAway frame's debug data, retained as a string streams map[uint32]*clientStream // client-initiated nextStreamID uint32 + pendingRequests int // requests blocked and waiting to be sent because len(streams) == maxConcurrentStreams pings map[[8]byte]chan struct{} // in flight ping data to notification channel bw *bufio.Writer br *bufio.Reader @@ -216,35 +218,45 @@ type clientStream struct { resTrailer *http.Header // client's Response.Trailer } -// awaitRequestCancel runs in its own goroutine and waits for the user -// to cancel a RoundTrip request, its context to expire, or for the -// request to be done (any way it might be removed from the cc.streams -// map: peer reset, successful completion, TCP connection breakage, -// etc) -func (cs *clientStream) awaitRequestCancel(req *http.Request) { +// awaitRequestCancel waits for the user to cancel a request or for the done +// channel to be signaled. A non-nil error is returned only if the request was +// canceled. +func awaitRequestCancel(req *http.Request, done <-chan struct{}) error { ctx := reqContext(req) if req.Cancel == nil && ctx.Done() == nil { - return + return nil } select { case <-req.Cancel: - cs.cancelStream() - cs.bufPipe.CloseWithError(errRequestCanceled) + return errRequestCanceled case <-ctx.Done(): + return ctx.Err() + case <-done: + return nil + } +} + +// awaitRequestCancel waits for the user to cancel a request, its context to +// expire, or for the request to be done (any way it might be removed from the +// cc.streams map: peer reset, successful completion, TCP connection breakage, +// etc). If the request is canceled, then cs will be canceled and closed. +func (cs *clientStream) awaitRequestCancel(req *http.Request) { + if err := awaitRequestCancel(req, cs.done); err != nil { cs.cancelStream() - cs.bufPipe.CloseWithError(ctx.Err()) - case <-cs.done: + cs.bufPipe.CloseWithError(err) } } func (cs *clientStream) cancelStream() { - cs.cc.mu.Lock() + cc := cs.cc + cc.mu.Lock() didReset := cs.didReset cs.didReset = true - cs.cc.mu.Unlock() + cc.mu.Unlock() if !didReset { - cs.cc.writeStreamReset(cs.ID, ErrCodeCancel, nil) + cc.writeStreamReset(cs.ID, ErrCodeCancel, nil) + cc.forgetStreamID(cs.ID) } } @@ -329,7 +341,7 @@ func (t *Transport) RoundTripOpt(req *http.Request, opt RoundTripOpt) (*http.Res } addr := authorityAddr(req.URL.Scheme, req.URL.Host) - for { + for retry := 0; ; retry++ { cc, err := t.connPool().GetClientConn(req, addr) if err != nil { t.vlogf("http2: Transport failed to get client conn for %s: %v", addr, err) @@ -337,9 +349,25 @@ func (t *Transport) RoundTripOpt(req *http.Request, opt RoundTripOpt) (*http.Res } traceGotConn(req, cc) res, err := cc.RoundTrip(req) - if err != nil { - if req, err = shouldRetryRequest(req, err); err == nil { - continue + if err != nil && retry <= 6 { + afterBodyWrite := false + if e, ok := err.(afterReqBodyWriteError); ok { + err = e + afterBodyWrite = true + } + if req, err = shouldRetryRequest(req, err, afterBodyWrite); err == nil { + // After the first retry, do exponential backoff with 10% jitter. + if retry == 0 { + continue + } + backoff := float64(uint(1) << (uint(retry) - 1)) + backoff += backoff * (0.1 * mathrand.Float64()) + select { + case <-time.After(time.Second * time.Duration(backoff)): + continue + case <-reqContext(req).Done(): + return nil, reqContext(req).Err() + } } } if err != nil { @@ -360,43 +388,60 @@ func (t *Transport) CloseIdleConnections() { } var ( - errClientConnClosed = errors.New("http2: client conn is closed") - errClientConnUnusable = errors.New("http2: client conn not usable") - - errClientConnGotGoAway = errors.New("http2: Transport received Server's graceful shutdown GOAWAY") - errClientConnGotGoAwayAfterSomeReqBody = errors.New("http2: Transport received Server's graceful shutdown GOAWAY; some request body already written") + errClientConnClosed = errors.New("http2: client conn is closed") + errClientConnUnusable = errors.New("http2: client conn not usable") + errClientConnGotGoAway = errors.New("http2: Transport received Server's graceful shutdown GOAWAY") ) +// afterReqBodyWriteError is a wrapper around errors returned by ClientConn.RoundTrip. +// It is used to signal that err happened after part of Request.Body was sent to the server. +type afterReqBodyWriteError struct { + err error +} + +func (e afterReqBodyWriteError) Error() string { + return e.err.Error() + "; some request body already written" +} + // shouldRetryRequest is called by RoundTrip when a request fails to get // response headers. It is always called with a non-nil error. // It returns either a request to retry (either the same request, or a // modified clone), or an error if the request can't be replayed. -func shouldRetryRequest(req *http.Request, err error) (*http.Request, error) { - switch err { - default: +func shouldRetryRequest(req *http.Request, err error, afterBodyWrite bool) (*http.Request, error) { + if !canRetryError(err) { return nil, err - case errClientConnUnusable, errClientConnGotGoAway: + } + if !afterBodyWrite { return req, nil - case errClientConnGotGoAwayAfterSomeReqBody: - // If the Body is nil (or http.NoBody), it's safe to reuse - // this request and its Body. - if req.Body == nil || reqBodyIsNoBody(req.Body) { - return req, nil - } - // Otherwise we depend on the Request having its GetBody - // func defined. - getBody := reqGetBody(req) // Go 1.8: getBody = req.GetBody - if getBody == nil { - return nil, errors.New("http2: Transport: peer server initiated graceful shutdown after some of Request.Body was written; define Request.GetBody to avoid this error") - } - body, err := getBody() - if err != nil { - return nil, err - } - newReq := *req - newReq.Body = body - return &newReq, nil } + // If the Body is nil (or http.NoBody), it's safe to reuse + // this request and its Body. + if req.Body == nil || reqBodyIsNoBody(req.Body) { + return req, nil + } + // Otherwise we depend on the Request having its GetBody + // func defined. + getBody := reqGetBody(req) // Go 1.8: getBody = req.GetBody + if getBody == nil { + return nil, fmt.Errorf("http2: Transport: cannot retry err [%v] after Request.Body was written; define Request.GetBody to avoid this error", err) + } + body, err := getBody() + if err != nil { + return nil, err + } + newReq := *req + newReq.Body = body + return &newReq, nil +} + +func canRetryError(err error) bool { + if err == errClientConnUnusable || err == errClientConnGotGoAway { + return true + } + if se, ok := err.(StreamError); ok { + return se.Code == ErrCodeRefusedStream + } + return false } func (t *Transport) dialClientConn(addr string, singleUse bool) (*ClientConn, error) { @@ -560,6 +605,8 @@ func (cc *ClientConn) setGoAway(f *GoAwayFrame) { } } +// CanTakeNewRequest reports whether the connection can take a new request, +// meaning it has not been closed or received or sent a GOAWAY. func (cc *ClientConn) CanTakeNewRequest() bool { cc.mu.Lock() defer cc.mu.Unlock() @@ -571,11 +618,10 @@ func (cc *ClientConn) canTakeNewRequestLocked() bool { return false } return cc.goAway == nil && !cc.closed && - int64(len(cc.streams)+1) < int64(cc.maxConcurrentStreams) && - cc.nextStreamID < math.MaxInt32 + int64(cc.nextStreamID)+int64(cc.pendingRequests) < math.MaxInt32 } -// onIdleTimeout is called from a time.AfterFunc goroutine. It will +// onIdleTimeout is called from a time.AfterFunc goroutine. It will // only be called when we're idle, but because we're coming from a new // goroutine, there could be a new request coming in at the same time, // so this simply calls the synchronized closeIfIdle to shut down this @@ -694,7 +740,7 @@ func checkConnHeaders(req *http.Request) error { // req.ContentLength, where 0 actually means zero (not unknown) and -1 // means unknown. func actualContentLength(req *http.Request) int64 { - if req.Body == nil { + if req.Body == nil || reqBodyIsNoBody(req.Body) { return 0 } if req.ContentLength != 0 { @@ -718,15 +764,14 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) { hasTrailers := trailers != "" cc.mu.Lock() - cc.lastActive = time.Now() - if cc.closed || !cc.canTakeNewRequestLocked() { + if err := cc.awaitOpenSlotForRequest(req); err != nil { cc.mu.Unlock() - return nil, errClientConnUnusable + return nil, err } body := req.Body - hasBody := body != nil contentLen := actualContentLength(req) + hasBody := contentLen != 0 // TODO(bradfitz): this is a copy of the logic in net/http. Unify somewhere? var requestedGzip bool @@ -809,21 +854,20 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) { // 2xx, however, then assume the server DOES potentially // want our body (e.g. full-duplex streaming: // golang.org/issue/13444). If it turns out the server - // doesn't, they'll RST_STREAM us soon enough. This is a - // heuristic to avoid adding knobs to Transport. Hopefully + // doesn't, they'll RST_STREAM us soon enough. This is a + // heuristic to avoid adding knobs to Transport. Hopefully // we can keep it. bodyWriter.cancel() cs.abortRequestBodyWrite(errStopReqBodyWrite) } if re.err != nil { - if re.err == errClientConnGotGoAway { - cc.mu.Lock() - if cs.startedWrite { - re.err = errClientConnGotGoAwayAfterSomeReqBody - } - cc.mu.Unlock() - } + cc.mu.Lock() + afterBodyWrite := cs.startedWrite + cc.mu.Unlock() cc.forgetStreamID(cs.ID) + if afterBodyWrite { + return nil, afterReqBodyWriteError{re.err} + } return nil, re.err } res.Request = req @@ -836,31 +880,31 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) { case re := <-readLoopResCh: return handleReadLoopResponse(re) case <-respHeaderTimer: - cc.forgetStreamID(cs.ID) if !hasBody || bodyWritten { cc.writeStreamReset(cs.ID, ErrCodeCancel, nil) } else { bodyWriter.cancel() cs.abortRequestBodyWrite(errStopReqBodyWriteAndCancel) } + cc.forgetStreamID(cs.ID) return nil, errTimeout case <-ctx.Done(): - cc.forgetStreamID(cs.ID) if !hasBody || bodyWritten { cc.writeStreamReset(cs.ID, ErrCodeCancel, nil) } else { bodyWriter.cancel() cs.abortRequestBodyWrite(errStopReqBodyWriteAndCancel) } + cc.forgetStreamID(cs.ID) return nil, ctx.Err() case <-req.Cancel: - cc.forgetStreamID(cs.ID) if !hasBody || bodyWritten { cc.writeStreamReset(cs.ID, ErrCodeCancel, nil) } else { bodyWriter.cancel() cs.abortRequestBodyWrite(errStopReqBodyWriteAndCancel) } + cc.forgetStreamID(cs.ID) return nil, errRequestCanceled case <-cs.peerReset: // processResetStream already removed the @@ -887,6 +931,45 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) { } } +// awaitOpenSlotForRequest waits until len(streams) < maxConcurrentStreams. +// Must hold cc.mu. +func (cc *ClientConn) awaitOpenSlotForRequest(req *http.Request) error { + var waitingForConn chan struct{} + var waitingForConnErr error // guarded by cc.mu + for { + cc.lastActive = time.Now() + if cc.closed || !cc.canTakeNewRequestLocked() { + return errClientConnUnusable + } + if int64(len(cc.streams))+1 <= int64(cc.maxConcurrentStreams) { + if waitingForConn != nil { + close(waitingForConn) + } + return nil + } + // Unfortunately, we cannot wait on a condition variable and channel at + // the same time, so instead, we spin up a goroutine to check if the + // request is canceled while we wait for a slot to open in the connection. + if waitingForConn == nil { + waitingForConn = make(chan struct{}) + go func() { + if err := awaitRequestCancel(req, waitingForConn); err != nil { + cc.mu.Lock() + waitingForConnErr = err + cc.cond.Broadcast() + cc.mu.Unlock() + } + }() + } + cc.pendingRequests++ + cc.cond.Wait() + cc.pendingRequests-- + if waitingForConnErr != nil { + return waitingForConnErr + } + } +} + // requires cc.wmu be held func (cc *ClientConn) writeHeaders(streamID uint32, endStream bool, hdrs []byte) error { first := true // first frame written (HEADERS is first, then CONTINUATION) @@ -1246,7 +1329,9 @@ func (cc *ClientConn) streamByID(id uint32, andRemove bool) *clientStream { cc.idleTimer.Reset(cc.idleTimeout) } close(cs.done) - cc.cond.Broadcast() // wake up checkResetOrDone via clientStream.awaitFlowControl + // Wake up checkResetOrDone via clientStream.awaitFlowControl and + // wake up RoundTrip if there is a pending request. + cc.cond.Broadcast() } return cs } @@ -1345,8 +1430,9 @@ func (rl *clientConnReadLoop) run() error { cc.vlogf("http2: Transport readFrame error on conn %p: (%T) %v", cc, err, err) } if se, ok := err.(StreamError); ok { - if cs := cc.streamByID(se.StreamID, true /*ended; remove it*/); cs != nil { + if cs := cc.streamByID(se.StreamID, false); cs != nil { cs.cc.writeStreamReset(cs.ID, se.Code, err) + cs.cc.forgetStreamID(cs.ID) if se.Cause == nil { se.Cause = cc.fr.errDetail } @@ -1528,8 +1614,7 @@ func (rl *clientConnReadLoop) handleResponse(cs *clientStream, f *MetaHeadersFra return res, nil } - buf := new(bytes.Buffer) // TODO(bradfitz): recycle this garbage - cs.bufPipe = pipe{b: buf} + cs.bufPipe = pipe{b: &dataBuffer{expected: res.ContentLength}} cs.bytesRemain = res.ContentLength res.Body = transportResponseBody{cs} go cs.awaitRequestCancel(cs.req) @@ -1656,6 +1741,7 @@ func (b transportResponseBody) Close() error { cc.wmu.Lock() if !serverSentStreamEnd { cc.fr.WriteRSTStream(cs.ID, ErrCodeCancel) + cs.didReset = true } // Return connection-level flow control. if unread > 0 { @@ -1668,6 +1754,7 @@ func (b transportResponseBody) Close() error { } cs.bufPipe.BreakWithError(errClosedResponseBody) + cc.forgetStreamID(cs.ID) return nil } @@ -1703,12 +1790,6 @@ func (rl *clientConnReadLoop) processData(f *DataFrame) error { return nil } if f.Length > 0 { - if len(data) > 0 && cs.bufPipe.b == nil { - // Data frame after it's already closed? - cc.logf("http2: Transport received DATA frame for closed stream; closing connection") - return ConnectionError(ErrCodeProtocol) - } - // Check connection-level flow control. cc.mu.Lock() if cs.inflow.available() >= int32(f.Length) { @@ -1719,16 +1800,27 @@ func (rl *clientConnReadLoop) processData(f *DataFrame) error { } // Return any padded flow control now, since we won't // refund it later on body reads. - if pad := int32(f.Length) - int32(len(data)); pad > 0 { - cs.inflow.add(pad) - cc.inflow.add(pad) + var refund int + if pad := int(f.Length) - len(data); pad > 0 { + refund += pad + } + // Return len(data) now if the stream is already closed, + // since data will never be read. + didReset := cs.didReset + if didReset { + refund += len(data) + } + if refund > 0 { + cc.inflow.add(int32(refund)) cc.wmu.Lock() - cc.fr.WriteWindowUpdate(0, uint32(pad)) - cc.fr.WriteWindowUpdate(cs.ID, uint32(pad)) + cc.fr.WriteWindowUpdate(0, uint32(refund)) + if !didReset { + cs.inflow.add(int32(refund)) + cc.fr.WriteWindowUpdate(cs.ID, uint32(refund)) + } cc.bw.Flush() cc.wmu.Unlock() } - didReset := cs.didReset cc.mu.Unlock() if len(data) > 0 && !didReset { diff --git a/vendor/golang.org/x/net/http2/writesched_priority.go b/vendor/golang.org/x/net/http2/writesched_priority.go index 0113272..848fed6 100644 --- a/vendor/golang.org/x/net/http2/writesched_priority.go +++ b/vendor/golang.org/x/net/http2/writesched_priority.go @@ -53,7 +53,7 @@ type PriorityWriteSchedulerConfig struct { } // NewPriorityWriteScheduler constructs a WriteScheduler that schedules -// frames by following HTTP/2 priorities as described in RFC 7340 Section 5.3. +// frames by following HTTP/2 priorities as described in RFC 7540 Section 5.3. // If cfg is nil, default options are used. func NewPriorityWriteScheduler(cfg *PriorityWriteSchedulerConfig) WriteScheduler { if cfg == nil { diff --git a/vendor/golang.org/x/net/idna/idna.go b/vendor/golang.org/x/net/idna/idna.go index 35ff39d..1810100 100644 --- a/vendor/golang.org/x/net/idna/idna.go +++ b/vendor/golang.org/x/net/idna/idna.go @@ -1,61 +1,673 @@ -// Copyright 2012 The Go Authors. All rights reserved. +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +// Copyright 2016 The Go Authors. All rights reserved. // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -// Package idna implements IDNA2008 (Internationalized Domain Names for -// Applications), defined in RFC 5890, RFC 5891, RFC 5892, RFC 5893 and -// RFC 5894. +// Package idna implements IDNA2008 using the compatibility processing +// defined by UTS (Unicode Technical Standard) #46, which defines a standard to +// deal with the transition from IDNA2003. +// +// IDNA2008 (Internationalized Domain Names for Applications), is defined in RFC +// 5890, RFC 5891, RFC 5892, RFC 5893 and RFC 5894. +// UTS #46 is defined in http://www.unicode.org/reports/tr46. +// See http://unicode.org/cldr/utility/idna.jsp for a visualization of the +// differences between these two standards. package idna import ( + "fmt" "strings" "unicode/utf8" -) -// TODO(nigeltao): specify when errors occur. For example, is ToASCII(".") or -// ToASCII("foo\x00") an error? See also http://www.unicode.org/faq/idn.html#11 + "golang.org/x/text/secure/bidirule" + "golang.org/x/text/unicode/norm" +) -// acePrefix is the ASCII Compatible Encoding prefix. -const acePrefix = "xn--" +// NOTE: Unlike common practice in Go APIs, the functions will return a +// sanitized domain name in case of errors. Browsers sometimes use a partially +// evaluated string as lookup. +// TODO: the current error handling is, in my opinion, the least opinionated. +// Other strategies are also viable, though: +// Option 1) Return an empty string in case of error, but allow the user to +// specify explicitly which errors to ignore. +// Option 2) Return the partially evaluated string if it is itself a valid +// string, otherwise return the empty string in case of error. +// Option 3) Option 1 and 2. +// Option 4) Always return an empty string for now and implement Option 1 as +// needed, and document that the return string may not be empty in case of +// error in the future. +// I think Option 1 is best, but it is quite opinionated. -// ToASCII converts a domain or domain label to its ASCII form. For example, -// ToASCII("bücher.example.com") is "xn--bcher-kva.example.com", and -// ToASCII("golang") is "golang". +// ToASCII is a wrapper for Punycode.ToASCII. func ToASCII(s string) (string, error) { - if ascii(s) { - return s, nil - } - labels := strings.Split(s, ".") - for i, label := range labels { - if !ascii(label) { - a, err := encode(acePrefix, label) - if err != nil { - return "", err - } - labels[i] = a + return Punycode.process(s, true) +} + +// ToUnicode is a wrapper for Punycode.ToUnicode. +func ToUnicode(s string) (string, error) { + return Punycode.process(s, false) +} + +// An Option configures a Profile at creation time. +type Option func(*options) + +// Transitional sets a Profile to use the Transitional mapping as defined in UTS +// #46. This will cause, for example, "ß" to be mapped to "ss". Using the +// transitional mapping provides a compromise between IDNA2003 and IDNA2008 +// compatibility. It is used by most browsers when resolving domain names. This +// option is only meaningful if combined with MapForLookup. +func Transitional(transitional bool) Option { + return func(o *options) { o.transitional = true } +} + +// VerifyDNSLength sets whether a Profile should fail if any of the IDN parts +// are longer than allowed by the RFC. +func VerifyDNSLength(verify bool) Option { + return func(o *options) { o.verifyDNSLength = verify } +} + +// RemoveLeadingDots removes leading label separators. Leading runes that map to +// dots, such as U+3002, are removed as well. +// +// This is the behavior suggested by the UTS #46 and is adopted by some +// browsers. +func RemoveLeadingDots(remove bool) Option { + return func(o *options) { o.removeLeadingDots = remove } +} + +// ValidateLabels sets whether to check the mandatory label validation criteria +// as defined in Section 5.4 of RFC 5891. This includes testing for correct use +// of hyphens ('-'), normalization, validity of runes, and the context rules. +func ValidateLabels(enable bool) Option { + return func(o *options) { + // Don't override existing mappings, but set one that at least checks + // normalization if it is not set. + if o.mapping == nil && enable { + o.mapping = normalize } + o.trie = trie + o.validateLabels = enable + o.fromPuny = validateFromPunycode + } +} + +// StrictDomainName limits the set of permissable ASCII characters to those +// allowed in domain names as defined in RFC 1034 (A-Z, a-z, 0-9 and the +// hyphen). This is set by default for MapForLookup and ValidateForRegistration. +// +// This option is useful, for instance, for browsers that allow characters +// outside this range, for example a '_' (U+005F LOW LINE). See +// http://www.rfc-editor.org/std/std3.txt for more details This option +// corresponds to the UseSTD3ASCIIRules option in UTS #46. +func StrictDomainName(use bool) Option { + return func(o *options) { + o.trie = trie + o.useSTD3Rules = use + o.fromPuny = validateFromPunycode + } +} + +// NOTE: the following options pull in tables. The tables should not be linked +// in as long as the options are not used. + +// BidiRule enables the Bidi rule as defined in RFC 5893. Any application +// that relies on proper validation of labels should include this rule. +func BidiRule() Option { + return func(o *options) { o.bidirule = bidirule.ValidString } +} + +// ValidateForRegistration sets validation options to verify that a given IDN is +// properly formatted for registration as defined by Section 4 of RFC 5891. +func ValidateForRegistration() Option { + return func(o *options) { + o.mapping = validateRegistration + StrictDomainName(true)(o) + ValidateLabels(true)(o) + VerifyDNSLength(true)(o) + BidiRule()(o) + } +} + +// MapForLookup sets validation and mapping options such that a given IDN is +// transformed for domain name lookup according to the requirements set out in +// Section 5 of RFC 5891. The mappings follow the recommendations of RFC 5894, +// RFC 5895 and UTS 46. It does not add the Bidi Rule. Use the BidiRule option +// to add this check. +// +// The mappings include normalization and mapping case, width and other +// compatibility mappings. +func MapForLookup() Option { + return func(o *options) { + o.mapping = validateAndMap + StrictDomainName(true)(o) + ValidateLabels(true)(o) + RemoveLeadingDots(true)(o) + } +} + +type options struct { + transitional bool + useSTD3Rules bool + validateLabels bool + verifyDNSLength bool + removeLeadingDots bool + + trie *idnaTrie + + // fromPuny calls validation rules when converting A-labels to U-labels. + fromPuny func(p *Profile, s string) error + + // mapping implements a validation and mapping step as defined in RFC 5895 + // or UTS 46, tailored to, for example, domain registration or lookup. + mapping func(p *Profile, s string) (string, error) + + // bidirule, if specified, checks whether s conforms to the Bidi Rule + // defined in RFC 5893. + bidirule func(s string) bool +} + +// A Profile defines the configuration of a IDNA mapper. +type Profile struct { + options +} + +func apply(o *options, opts []Option) { + for _, f := range opts { + f(o) } - return strings.Join(labels, "."), nil +} + +// New creates a new Profile. +// +// With no options, the returned Profile is the most permissive and equals the +// Punycode Profile. Options can be passed to further restrict the Profile. The +// MapForLookup and ValidateForRegistration options set a collection of options, +// for lookup and registration purposes respectively, which can be tailored by +// adding more fine-grained options, where later options override earlier +// options. +func New(o ...Option) *Profile { + p := &Profile{} + apply(&p.options, o) + return p +} + +// ToASCII converts a domain or domain label to its ASCII form. For example, +// ToASCII("bücher.example.com") is "xn--bcher-kva.example.com", and +// ToASCII("golang") is "golang". If an error is encountered it will return +// an error and a (partially) processed result. +func (p *Profile) ToASCII(s string) (string, error) { + return p.process(s, true) } // ToUnicode converts a domain or domain label to its Unicode form. For example, // ToUnicode("xn--bcher-kva.example.com") is "bücher.example.com", and -// ToUnicode("golang") is "golang". -func ToUnicode(s string) (string, error) { - if !strings.Contains(s, acePrefix) { - return s, nil +// ToUnicode("golang") is "golang". If an error is encountered it will return +// an error and a (partially) processed result. +func (p *Profile) ToUnicode(s string) (string, error) { + pp := *p + pp.transitional = false + return pp.process(s, false) +} + +// String reports a string with a description of the profile for debugging +// purposes. The string format may change with different versions. +func (p *Profile) String() string { + s := "" + if p.transitional { + s = "Transitional" + } else { + s = "NonTransitional" + } + if p.useSTD3Rules { + s += ":UseSTD3Rules" + } + if p.validateLabels { + s += ":ValidateLabels" } - labels := strings.Split(s, ".") - for i, label := range labels { + if p.verifyDNSLength { + s += ":VerifyDNSLength" + } + return s +} + +var ( + // Punycode is a Profile that does raw punycode processing with a minimum + // of validation. + Punycode *Profile = punycode + + // Lookup is the recommended profile for looking up domain names, according + // to Section 5 of RFC 5891. The exact configuration of this profile may + // change over time. + Lookup *Profile = lookup + + // Display is the recommended profile for displaying domain names. + // The configuration of this profile may change over time. + Display *Profile = display + + // Registration is the recommended profile for checking whether a given + // IDN is valid for registration, according to Section 4 of RFC 5891. + Registration *Profile = registration + + punycode = &Profile{} + lookup = &Profile{options{ + transitional: true, + useSTD3Rules: true, + validateLabels: true, + removeLeadingDots: true, + trie: trie, + fromPuny: validateFromPunycode, + mapping: validateAndMap, + bidirule: bidirule.ValidString, + }} + display = &Profile{options{ + useSTD3Rules: true, + validateLabels: true, + removeLeadingDots: true, + trie: trie, + fromPuny: validateFromPunycode, + mapping: validateAndMap, + bidirule: bidirule.ValidString, + }} + registration = &Profile{options{ + useSTD3Rules: true, + validateLabels: true, + verifyDNSLength: true, + trie: trie, + fromPuny: validateFromPunycode, + mapping: validateRegistration, + bidirule: bidirule.ValidString, + }} + + // TODO: profiles + // Register: recommended for approving domain names: don't do any mappings + // but rather reject on invalid input. Bundle or block deviation characters. +) + +type labelError struct{ label, code_ string } + +func (e labelError) code() string { return e.code_ } +func (e labelError) Error() string { + return fmt.Sprintf("idna: invalid label %q", e.label) +} + +type runeError rune + +func (e runeError) code() string { return "P1" } +func (e runeError) Error() string { + return fmt.Sprintf("idna: disallowed rune %U", e) +} + +// process implements the algorithm described in section 4 of UTS #46, +// see http://www.unicode.org/reports/tr46. +func (p *Profile) process(s string, toASCII bool) (string, error) { + var err error + if p.mapping != nil { + s, err = p.mapping(p, s) + } + // Remove leading empty labels. + if p.removeLeadingDots { + for ; len(s) > 0 && s[0] == '.'; s = s[1:] { + } + } + // It seems like we should only create this error on ToASCII, but the + // UTS 46 conformance tests suggests we should always check this. + if err == nil && p.verifyDNSLength && s == "" { + err = &labelError{s, "A4"} + } + labels := labelIter{orig: s} + for ; !labels.done(); labels.next() { + label := labels.label() + if label == "" { + // Empty labels are not okay. The label iterator skips the last + // label if it is empty. + if err == nil && p.verifyDNSLength { + err = &labelError{s, "A4"} + } + continue + } if strings.HasPrefix(label, acePrefix) { - u, err := decode(label[len(acePrefix):]) - if err != nil { - return "", err + u, err2 := decode(label[len(acePrefix):]) + if err2 != nil { + if err == nil { + err = err2 + } + // Spec says keep the old label. + continue + } + labels.set(u) + if err == nil && p.validateLabels { + err = p.fromPuny(p, u) + } + if err == nil { + // This should be called on NonTransitional, according to the + // spec, but that currently does not have any effect. Use the + // original profile to preserve options. + err = p.validateLabel(u) } - labels[i] = u + } else if err == nil { + err = p.validateLabel(label) } } - return strings.Join(labels, "."), nil + if toASCII { + for labels.reset(); !labels.done(); labels.next() { + label := labels.label() + if !ascii(label) { + a, err2 := encode(acePrefix, label) + if err == nil { + err = err2 + } + label = a + labels.set(a) + } + n := len(label) + if p.verifyDNSLength && err == nil && (n == 0 || n > 63) { + err = &labelError{label, "A4"} + } + } + } + s = labels.result() + if toASCII && p.verifyDNSLength && err == nil { + // Compute the length of the domain name minus the root label and its dot. + n := len(s) + if n > 0 && s[n-1] == '.' { + n-- + } + if len(s) < 1 || n > 253 { + err = &labelError{s, "A4"} + } + } + return s, err +} + +func normalize(p *Profile, s string) (string, error) { + return norm.NFC.String(s), nil +} + +func validateRegistration(p *Profile, s string) (string, error) { + if !norm.NFC.IsNormalString(s) { + return s, &labelError{s, "V1"} + } + for i := 0; i < len(s); { + v, sz := trie.lookupString(s[i:]) + // Copy bytes not copied so far. + switch p.simplify(info(v).category()) { + // TODO: handle the NV8 defined in the Unicode idna data set to allow + // for strict conformance to IDNA2008. + case valid, deviation: + case disallowed, mapped, unknown, ignored: + r, _ := utf8.DecodeRuneInString(s[i:]) + return s, runeError(r) + } + i += sz + } + return s, nil +} + +func validateAndMap(p *Profile, s string) (string, error) { + var ( + err error + b []byte + k int + ) + for i := 0; i < len(s); { + v, sz := trie.lookupString(s[i:]) + start := i + i += sz + // Copy bytes not copied so far. + switch p.simplify(info(v).category()) { + case valid: + continue + case disallowed: + if err == nil { + r, _ := utf8.DecodeRuneInString(s[start:]) + err = runeError(r) + } + continue + case mapped, deviation: + b = append(b, s[k:start]...) + b = info(v).appendMapping(b, s[start:i]) + case ignored: + b = append(b, s[k:start]...) + // drop the rune + case unknown: + b = append(b, s[k:start]...) + b = append(b, "\ufffd"...) + } + k = i + } + if k == 0 { + // No changes so far. + s = norm.NFC.String(s) + } else { + b = append(b, s[k:]...) + if norm.NFC.QuickSpan(b) != len(b) { + b = norm.NFC.Bytes(b) + } + // TODO: the punycode converters require strings as input. + s = string(b) + } + return s, err +} + +// A labelIter allows iterating over domain name labels. +type labelIter struct { + orig string + slice []string + curStart int + curEnd int + i int +} + +func (l *labelIter) reset() { + l.curStart = 0 + l.curEnd = 0 + l.i = 0 +} + +func (l *labelIter) done() bool { + return l.curStart >= len(l.orig) +} + +func (l *labelIter) result() string { + if l.slice != nil { + return strings.Join(l.slice, ".") + } + return l.orig +} + +func (l *labelIter) label() string { + if l.slice != nil { + return l.slice[l.i] + } + p := strings.IndexByte(l.orig[l.curStart:], '.') + l.curEnd = l.curStart + p + if p == -1 { + l.curEnd = len(l.orig) + } + return l.orig[l.curStart:l.curEnd] +} + +// next sets the value to the next label. It skips the last label if it is empty. +func (l *labelIter) next() { + l.i++ + if l.slice != nil { + if l.i >= len(l.slice) || l.i == len(l.slice)-1 && l.slice[l.i] == "" { + l.curStart = len(l.orig) + } + } else { + l.curStart = l.curEnd + 1 + if l.curStart == len(l.orig)-1 && l.orig[l.curStart] == '.' { + l.curStart = len(l.orig) + } + } +} + +func (l *labelIter) set(s string) { + if l.slice == nil { + l.slice = strings.Split(l.orig, ".") + } + l.slice[l.i] = s +} + +// acePrefix is the ASCII Compatible Encoding prefix. +const acePrefix = "xn--" + +func (p *Profile) simplify(cat category) category { + switch cat { + case disallowedSTD3Mapped: + if p.useSTD3Rules { + cat = disallowed + } else { + cat = mapped + } + case disallowedSTD3Valid: + if p.useSTD3Rules { + cat = disallowed + } else { + cat = valid + } + case deviation: + if !p.transitional { + cat = valid + } + case validNV8, validXV8: + // TODO: handle V2008 + cat = valid + } + return cat +} + +func validateFromPunycode(p *Profile, s string) error { + if !norm.NFC.IsNormalString(s) { + return &labelError{s, "V1"} + } + for i := 0; i < len(s); { + v, sz := trie.lookupString(s[i:]) + if c := p.simplify(info(v).category()); c != valid && c != deviation { + return &labelError{s, "V6"} + } + i += sz + } + return nil +} + +const ( + zwnj = "\u200c" + zwj = "\u200d" +) + +type joinState int8 + +const ( + stateStart joinState = iota + stateVirama + stateBefore + stateBeforeVirama + stateAfter + stateFAIL +) + +var joinStates = [][numJoinTypes]joinState{ + stateStart: { + joiningL: stateBefore, + joiningD: stateBefore, + joinZWNJ: stateFAIL, + joinZWJ: stateFAIL, + joinVirama: stateVirama, + }, + stateVirama: { + joiningL: stateBefore, + joiningD: stateBefore, + }, + stateBefore: { + joiningL: stateBefore, + joiningD: stateBefore, + joiningT: stateBefore, + joinZWNJ: stateAfter, + joinZWJ: stateFAIL, + joinVirama: stateBeforeVirama, + }, + stateBeforeVirama: { + joiningL: stateBefore, + joiningD: stateBefore, + joiningT: stateBefore, + }, + stateAfter: { + joiningL: stateFAIL, + joiningD: stateBefore, + joiningT: stateAfter, + joiningR: stateStart, + joinZWNJ: stateFAIL, + joinZWJ: stateFAIL, + joinVirama: stateAfter, // no-op as we can't accept joiners here + }, + stateFAIL: { + 0: stateFAIL, + joiningL: stateFAIL, + joiningD: stateFAIL, + joiningT: stateFAIL, + joiningR: stateFAIL, + joinZWNJ: stateFAIL, + joinZWJ: stateFAIL, + joinVirama: stateFAIL, + }, +} + +// validateLabel validates the criteria from Section 4.1. Item 1, 4, and 6 are +// already implicitly satisfied by the overall implementation. +func (p *Profile) validateLabel(s string) error { + if s == "" { + if p.verifyDNSLength { + return &labelError{s, "A4"} + } + return nil + } + if p.bidirule != nil && !p.bidirule(s) { + return &labelError{s, "B"} + } + if !p.validateLabels { + return nil + } + trie := p.trie // p.validateLabels is only set if trie is set. + if len(s) > 4 && s[2] == '-' && s[3] == '-' { + return &labelError{s, "V2"} + } + if s[0] == '-' || s[len(s)-1] == '-' { + return &labelError{s, "V3"} + } + // TODO: merge the use of this in the trie. + v, sz := trie.lookupString(s) + x := info(v) + if x.isModifier() { + return &labelError{s, "V5"} + } + // Quickly return in the absence of zero-width (non) joiners. + if strings.Index(s, zwj) == -1 && strings.Index(s, zwnj) == -1 { + return nil + } + st := stateStart + for i := 0; ; { + jt := x.joinType() + if s[i:i+sz] == zwj { + jt = joinZWJ + } else if s[i:i+sz] == zwnj { + jt = joinZWNJ + } + st = joinStates[st][jt] + if x.isViramaModifier() { + st = joinStates[st][joinVirama] + } + if i += sz; i == len(s) { + break + } + v, sz = trie.lookupString(s[i:]) + x = info(v) + } + if st == stateFAIL || st == stateAfter { + return &labelError{s, "C"} + } + return nil } func ascii(s string) bool { diff --git a/vendor/golang.org/x/net/idna/punycode.go b/vendor/golang.org/x/net/idna/punycode.go index 92e733f..02c7d59 100644 --- a/vendor/golang.org/x/net/idna/punycode.go +++ b/vendor/golang.org/x/net/idna/punycode.go @@ -1,4 +1,6 @@ -// Copyright 2012 The Go Authors. All rights reserved. +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +// Copyright 2016 The Go Authors. All rights reserved. // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. @@ -7,7 +9,6 @@ package idna // This file implements the Punycode algorithm from RFC 3492. import ( - "fmt" "math" "strings" "unicode/utf8" @@ -27,6 +28,8 @@ const ( tmin int32 = 1 ) +func punyError(s string) error { return &labelError{s, "A3"} } + // decode decodes a string as specified in section 6.2. func decode(encoded string) (string, error) { if encoded == "" { @@ -34,7 +37,7 @@ func decode(encoded string) (string, error) { } pos := 1 + strings.LastIndex(encoded, "-") if pos == 1 { - return "", fmt.Errorf("idna: invalid label %q", encoded) + return "", punyError(encoded) } if pos == len(encoded) { return encoded[:len(encoded)-1], nil @@ -50,16 +53,16 @@ func decode(encoded string) (string, error) { oldI, w := i, int32(1) for k := base; ; k += base { if pos == len(encoded) { - return "", fmt.Errorf("idna: invalid label %q", encoded) + return "", punyError(encoded) } digit, ok := decodeDigit(encoded[pos]) if !ok { - return "", fmt.Errorf("idna: invalid label %q", encoded) + return "", punyError(encoded) } pos++ i += digit * w if i < 0 { - return "", fmt.Errorf("idna: invalid label %q", encoded) + return "", punyError(encoded) } t := k - bias if t < tmin { @@ -72,7 +75,7 @@ func decode(encoded string) (string, error) { } w *= base - t if w >= math.MaxInt32/base { - return "", fmt.Errorf("idna: invalid label %q", encoded) + return "", punyError(encoded) } } x := int32(len(output) + 1) @@ -80,7 +83,7 @@ func decode(encoded string) (string, error) { n += i / x i %= x if n > utf8.MaxRune || len(output) >= 1024 { - return "", fmt.Errorf("idna: invalid label %q", encoded) + return "", punyError(encoded) } output = append(output, 0) copy(output[i+1:], output[i:]) @@ -121,14 +124,14 @@ func encode(prefix, s string) (string, error) { } delta += (m - n) * (h + 1) if delta < 0 { - return "", fmt.Errorf("idna: invalid label %q", s) + return "", punyError(s) } n = m for _, r := range s { if r < n { delta++ if delta < 0 { - return "", fmt.Errorf("idna: invalid label %q", s) + return "", punyError(s) } continue } diff --git a/vendor/golang.org/x/net/idna/tables.go b/vendor/golang.org/x/net/idna/tables.go new file mode 100644 index 0000000..d281934 --- /dev/null +++ b/vendor/golang.org/x/net/idna/tables.go @@ -0,0 +1,4477 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package idna + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "9.0.0" + +var mappings string = "" + // Size: 8176 bytes + "\x00\x01 \x03 ̈\x01a\x03 ̄\x012\x013\x03 ́\x03 ̧\x011\x01o\x051⁄4\x051⁄2" + + "\x053⁄4\x03i̇\x03l·\x03ʼn\x01s\x03dž\x03ⱥ\x03ⱦ\x01h\x01j\x01r\x01w\x01y" + + "\x03 ̆\x03 ̇\x03 ̊\x03 ̨\x03 ̃\x03 ̋\x01l\x01x\x04̈́\x03 ι\x01;\x05 ̈́" + + "\x04եւ\x04اٴ\x04وٴ\x04ۇٴ\x04يٴ\x06क़\x06ख़\x06ग़\x06ज़\x06ड़\x06ढ़\x06फ़" + + "\x06य़\x06ড়\x06ঢ়\x06য়\x06ਲ਼\x06ਸ਼\x06ਖ਼\x06ਗ਼\x06ਜ਼\x06ਫ਼\x06ଡ଼\x06ଢ଼" + + "\x06ํา\x06ໍາ\x06ຫນ\x06ຫມ\x06གྷ\x06ཌྷ\x06དྷ\x06བྷ\x06ཛྷ\x06ཀྵ\x06ཱི\x06ཱུ" + + "\x06ྲྀ\x09ྲཱྀ\x06ླྀ\x09ླཱྀ\x06ཱྀ\x06ྒྷ\x06ྜྷ\x06ྡྷ\x06ྦྷ\x06ྫྷ\x06ྐྵ\x02" + + "в\x02д\x02о\x02с\x02т\x02ъ\x02ѣ\x02æ\x01b\x01d\x01e\x02ǝ\x01g\x01i\x01k" + + "\x01m\x01n\x02ȣ\x01p\x01t\x01u\x02ɐ\x02ɑ\x02ə\x02ɛ\x02ɜ\x02ŋ\x02ɔ\x02ɯ" + + "\x01v\x02β\x02γ\x02δ\x02φ\x02χ\x02ρ\x02н\x02ɒ\x01c\x02ɕ\x02ð\x01f\x02ɟ" + + "\x02ɡ\x02ɥ\x02ɨ\x02ɩ\x02ɪ\x02ʝ\x02ɭ\x02ʟ\x02ɱ\x02ɰ\x02ɲ\x02ɳ\x02ɴ\x02ɵ" + + "\x02ɸ\x02ʂ\x02ʃ\x02ƫ\x02ʉ\x02ʊ\x02ʋ\x02ʌ\x01z\x02ʐ\x02ʑ\x02ʒ\x02θ\x02ss" + + "\x02ά\x02έ\x02ή\x02ί\x02ό\x02ύ\x02ώ\x05ἀι\x05ἁι\x05ἂι\x05ἃι\x05ἄι\x05ἅι" + + "\x05ἆι\x05ἇι\x05ἠι\x05ἡι\x05ἢι\x05ἣι\x05ἤι\x05ἥι\x05ἦι\x05ἧι\x05ὠι\x05ὡι" + + "\x05ὢι\x05ὣι\x05ὤι\x05ὥι\x05ὦι\x05ὧι\x05ὰι\x04αι\x04άι\x05ᾶι\x02ι\x05 ̈͂" + + "\x05ὴι\x04ηι\x04ήι\x05ῆι\x05 ̓̀\x05 ̓́\x05 ̓͂\x02ΐ\x05 ̔̀\x05 ̔́\x05 ̔͂" + + "\x02ΰ\x05 ̈̀\x01`\x05ὼι\x04ωι\x04ώι\x05ῶι\x06′′\x09′′′\x06‵‵\x09‵‵‵\x02!" + + "!\x02??\x02?!\x02!?\x0c′′′′\x010\x014\x015\x016\x017\x018\x019\x01+\x01=" + + "\x01(\x01)\x02rs\x02ħ\x02no\x01q\x02sm\x02tm\x02ω\x02å\x02א\x02ב\x02ג" + + "\x02ד\x02π\x051⁄7\x051⁄9\x061⁄10\x051⁄3\x052⁄3\x051⁄5\x052⁄5\x053⁄5\x054" + + "⁄5\x051⁄6\x055⁄6\x051⁄8\x053⁄8\x055⁄8\x057⁄8\x041⁄\x02ii\x02iv\x02vi" + + "\x04viii\x02ix\x02xi\x050⁄3\x06∫∫\x09∫∫∫\x06∮∮\x09∮∮∮\x0210\x0211\x0212" + + "\x0213\x0214\x0215\x0216\x0217\x0218\x0219\x0220\x04(10)\x04(11)\x04(12)" + + "\x04(13)\x04(14)\x04(15)\x04(16)\x04(17)\x04(18)\x04(19)\x04(20)\x0c∫∫∫∫" + + "\x02==\x05⫝̸\x02ɫ\x02ɽ\x02ȿ\x02ɀ\x01.\x04 ゙\x04 ゚\x06より\x06コト\x05(ᄀ)\x05" + + "(ᄂ)\x05(ᄃ)\x05(ᄅ)\x05(ᄆ)\x05(ᄇ)\x05(ᄉ)\x05(ᄋ)\x05(ᄌ)\x05(ᄎ)\x05(ᄏ)\x05(ᄐ" + + ")\x05(ᄑ)\x05(ᄒ)\x05(가)\x05(나)\x05(다)\x05(라)\x05(마)\x05(바)\x05(사)\x05(아)" + + "\x05(자)\x05(차)\x05(카)\x05(타)\x05(파)\x05(하)\x05(주)\x08(오전)\x08(오후)\x05(一)" + + "\x05(二)\x05(三)\x05(四)\x05(五)\x05(六)\x05(七)\x05(八)\x05(九)\x05(十)\x05(月)" + + "\x05(火)\x05(水)\x05(木)\x05(金)\x05(土)\x05(日)\x05(株)\x05(有)\x05(社)\x05(名)" + + "\x05(特)\x05(財)\x05(祝)\x05(労)\x05(代)\x05(呼)\x05(学)\x05(監)\x05(企)\x05(資)" + + "\x05(協)\x05(祭)\x05(休)\x05(自)\x05(至)\x0221\x0222\x0223\x0224\x0225\x0226" + + "\x0227\x0228\x0229\x0230\x0231\x0232\x0233\x0234\x0235\x06참고\x06주의\x0236" + + "\x0237\x0238\x0239\x0240\x0241\x0242\x0243\x0244\x0245\x0246\x0247\x0248" + + "\x0249\x0250\x041月\x042月\x043月\x044月\x045月\x046月\x047月\x048月\x049月\x0510" + + "月\x0511月\x0512月\x02hg\x02ev\x0cアパート\x0cアルファ\x0cアンペア\x09アール\x0cイニング\x09" + + "インチ\x09ウォン\x0fエスクード\x0cエーカー\x09オンス\x09オーム\x09カイリ\x0cカラット\x0cカロリー\x09ガロ" + + "ン\x09ガンマ\x06ギガ\x09ギニー\x0cキュリー\x0cギルダー\x06キロ\x0fキログラム\x12キロメートル\x0fキロワッ" + + "ト\x09グラム\x0fグラムトン\x0fクルゼイロ\x0cクローネ\x09ケース\x09コルナ\x09コーポ\x0cサイクル\x0fサンチ" + + "ーム\x0cシリング\x09センチ\x09セント\x09ダース\x06デシ\x06ドル\x06トン\x06ナノ\x09ノット\x09ハイツ" + + "\x0fパーセント\x09パーツ\x0cバーレル\x0fピアストル\x09ピクル\x06ピコ\x06ビル\x0fファラッド\x0cフィート" + + "\x0fブッシェル\x09フラン\x0fヘクタール\x06ペソ\x09ペニヒ\x09ヘルツ\x09ペンス\x09ページ\x09ベータ\x0cポイ" + + "ント\x09ボルト\x06ホン\x09ポンド\x09ホール\x09ホーン\x0cマイクロ\x09マイル\x09マッハ\x09マルク\x0fマ" + + "ンション\x0cミクロン\x06ミリ\x0fミリバール\x06メガ\x0cメガトン\x0cメートル\x09ヤード\x09ヤール\x09ユアン" + + "\x0cリットル\x06リラ\x09ルピー\x0cルーブル\x06レム\x0fレントゲン\x09ワット\x040点\x041点\x042点" + + "\x043点\x044点\x045点\x046点\x047点\x048点\x049点\x0510点\x0511点\x0512点\x0513点" + + "\x0514点\x0515点\x0516点\x0517点\x0518点\x0519点\x0520点\x0521点\x0522点\x0523点" + + "\x0524点\x02da\x02au\x02ov\x02pc\x02dm\x02iu\x06平成\x06昭和\x06大正\x06明治\x0c株" + + "式会社\x02pa\x02na\x02ma\x02ka\x02kb\x02mb\x02gb\x04kcal\x02pf\x02nf\x02m" + + "g\x02kg\x02hz\x02ml\x02dl\x02kl\x02fm\x02nm\x02mm\x02cm\x02km\x02m2\x02m" + + "3\x05m∕s\x06m∕s2\x07rad∕s\x08rad∕s2\x02ps\x02ns\x02ms\x02pv\x02nv\x02mv" + + "\x02kv\x02pw\x02nw\x02mw\x02kw\x02bq\x02cc\x02cd\x06c∕kg\x02db\x02gy\x02" + + "ha\x02hp\x02in\x02kk\x02kt\x02lm\x02ln\x02lx\x02ph\x02pr\x02sr\x02sv\x02" + + "wb\x05v∕m\x05a∕m\x041日\x042日\x043日\x044日\x045日\x046日\x047日\x048日\x049日" + + "\x0510日\x0511日\x0512日\x0513日\x0514日\x0515日\x0516日\x0517日\x0518日\x0519日" + + "\x0520日\x0521日\x0522日\x0523日\x0524日\x0525日\x0526日\x0527日\x0528日\x0529日" + + "\x0530日\x0531日\x02ь\x02ɦ\x02ɬ\x02ʞ\x02ʇ\x02œ\x04𤋮\x04𢡊\x04𢡄\x04𣏕\x04𥉉" + + "\x04𥳐\x04𧻓\x02ff\x02fi\x02fl\x02st\x04մն\x04մե\x04մի\x04վն\x04մխ\x04יִ" + + "\x04ײַ\x02ע\x02ה\x02כ\x02ל\x02ם\x02ר\x02ת\x04שׁ\x04שׂ\x06שּׁ\x06שּׂ\x04א" + + "ַ\x04אָ\x04אּ\x04בּ\x04גּ\x04דּ\x04הּ\x04וּ\x04זּ\x04טּ\x04יּ\x04ךּ\x04" + + "כּ\x04לּ\x04מּ\x04נּ\x04סּ\x04ףּ\x04פּ\x04צּ\x04קּ\x04רּ\x04שּ\x04תּ" + + "\x04וֹ\x04בֿ\x04כֿ\x04פֿ\x04אל\x02ٱ\x02ٻ\x02پ\x02ڀ\x02ٺ\x02ٿ\x02ٹ\x02ڤ" + + "\x02ڦ\x02ڄ\x02ڃ\x02چ\x02ڇ\x02ڍ\x02ڌ\x02ڎ\x02ڈ\x02ژ\x02ڑ\x02ک\x02گ\x02ڳ" + + "\x02ڱ\x02ں\x02ڻ\x02ۀ\x02ہ\x02ھ\x02ے\x02ۓ\x02ڭ\x02ۇ\x02ۆ\x02ۈ\x02ۋ\x02ۅ" + + "\x02ۉ\x02ې\x02ى\x04ئا\x04ئە\x04ئو\x04ئۇ\x04ئۆ\x04ئۈ\x04ئې\x04ئى\x02ی\x04" + + "ئج\x04ئح\x04ئم\x04ئي\x04بج\x04بح\x04بخ\x04بم\x04بى\x04بي\x04تج\x04تح" + + "\x04تخ\x04تم\x04تى\x04تي\x04ثج\x04ثم\x04ثى\x04ثي\x04جح\x04جم\x04حج\x04حم" + + "\x04خج\x04خح\x04خم\x04سج\x04سح\x04سخ\x04سم\x04صح\x04صم\x04ضج\x04ضح\x04ضخ" + + "\x04ضم\x04طح\x04طم\x04ظم\x04عج\x04عم\x04غج\x04غم\x04فج\x04فح\x04فخ\x04فم" + + "\x04فى\x04في\x04قح\x04قم\x04قى\x04قي\x04كا\x04كج\x04كح\x04كخ\x04كل\x04كم" + + "\x04كى\x04كي\x04لج\x04لح\x04لخ\x04لم\x04لى\x04لي\x04مج\x04مح\x04مخ\x04مم" + + "\x04مى\x04مي\x04نج\x04نح\x04نخ\x04نم\x04نى\x04ني\x04هج\x04هم\x04هى\x04هي" + + "\x04يج\x04يح\x04يخ\x04يم\x04يى\x04يي\x04ذٰ\x04رٰ\x04ىٰ\x05 ٌّ\x05 ٍّ\x05" + + " َّ\x05 ُّ\x05 ِّ\x05 ّٰ\x04ئر\x04ئز\x04ئن\x04بر\x04بز\x04بن\x04تر\x04تز" + + "\x04تن\x04ثر\x04ثز\x04ثن\x04ما\x04نر\x04نز\x04نن\x04ير\x04يز\x04ين\x04ئخ" + + "\x04ئه\x04به\x04ته\x04صخ\x04له\x04نه\x04هٰ\x04يه\x04ثه\x04سه\x04شم\x04شه" + + "\x06ـَّ\x06ـُّ\x06ـِّ\x04طى\x04طي\x04عى\x04عي\x04غى\x04غي\x04سى\x04سي" + + "\x04شى\x04شي\x04حى\x04حي\x04جى\x04جي\x04خى\x04خي\x04صى\x04صي\x04ضى\x04ضي" + + "\x04شج\x04شح\x04شخ\x04شر\x04سر\x04صر\x04ضر\x04اً\x06تجم\x06تحج\x06تحم" + + "\x06تخم\x06تمج\x06تمح\x06تمخ\x06جمح\x06حمي\x06حمى\x06سحج\x06سجح\x06سجى" + + "\x06سمح\x06سمج\x06سمم\x06صحح\x06صمم\x06شحم\x06شجي\x06شمخ\x06شمم\x06ضحى" + + "\x06ضخم\x06طمح\x06طمم\x06طمي\x06عجم\x06عمم\x06عمى\x06غمم\x06غمي\x06غمى" + + "\x06فخم\x06قمح\x06قمم\x06لحم\x06لحي\x06لحى\x06لجج\x06لخم\x06لمح\x06محج" + + "\x06محم\x06محي\x06مجح\x06مجم\x06مخج\x06مخم\x06مجخ\x06همج\x06همم\x06نحم" + + "\x06نحى\x06نجم\x06نجى\x06نمي\x06نمى\x06يمم\x06بخي\x06تجي\x06تجى\x06تخي" + + "\x06تخى\x06تمي\x06تمى\x06جمي\x06جحى\x06جمى\x06سخى\x06صحي\x06شحي\x06ضحي" + + "\x06لجي\x06لمي\x06يحي\x06يجي\x06يمي\x06ممي\x06قمي\x06نحي\x06عمي\x06كمي" + + "\x06نجح\x06مخي\x06لجم\x06كمم\x06جحي\x06حجي\x06مجي\x06فمي\x06بحي\x06سخي" + + "\x06نجي\x06صلے\x06قلے\x08الله\x08اكبر\x08محمد\x08صلعم\x08رسول\x08عليه" + + "\x08وسلم\x06صلى!صلى الله عليه وسلم\x0fجل جلاله\x08ریال\x01,\x01:\x01!" + + "\x01?\x01_\x01{\x01}\x01[\x01]\x01#\x01&\x01*\x01-\x01<\x01>\x01\\\x01$" + + "\x01%\x01@\x04ـً\x04ـَ\x04ـُ\x04ـِ\x04ـّ\x04ـْ\x02ء\x02آ\x02أ\x02ؤ\x02إ" + + "\x02ئ\x02ا\x02ب\x02ة\x02ت\x02ث\x02ج\x02ح\x02خ\x02د\x02ذ\x02ر\x02ز\x02س" + + "\x02ش\x02ص\x02ض\x02ط\x02ظ\x02ع\x02غ\x02ف\x02ق\x02ك\x02ل\x02م\x02ن\x02ه" + + "\x02و\x02ي\x04لآ\x04لأ\x04لإ\x04لا\x01\x22\x01'\x01/\x01^\x01|\x01~\x02¢" + + "\x02£\x02¬\x02¦\x02¥\x08𝅗𝅥\x08𝅘𝅥\x0c𝅘𝅥𝅮\x0c𝅘𝅥𝅯\x0c𝅘𝅥𝅰\x0c𝅘𝅥𝅱\x0c𝅘𝅥𝅲\x08𝆹" + + "𝅥\x08𝆺𝅥\x0c𝆹𝅥𝅮\x0c𝆺𝅥𝅮\x0c𝆹𝅥𝅯\x0c𝆺𝅥𝅯\x02ı\x02ȷ\x02α\x02ε\x02ζ\x02η\x02" + + "κ\x02λ\x02μ\x02ν\x02ξ\x02ο\x02σ\x02τ\x02υ\x02ψ\x03∇\x03∂\x02ϝ\x02ٮ\x02ڡ" + + "\x02ٯ\x020,\x021,\x022,\x023,\x024,\x025,\x026,\x027,\x028,\x029,\x03(a)" + + "\x03(b)\x03(c)\x03(d)\x03(e)\x03(f)\x03(g)\x03(h)\x03(i)\x03(j)\x03(k)" + + "\x03(l)\x03(m)\x03(n)\x03(o)\x03(p)\x03(q)\x03(r)\x03(s)\x03(t)\x03(u)" + + "\x03(v)\x03(w)\x03(x)\x03(y)\x03(z)\x07〔s〕\x02wz\x02hv\x02sd\x03ppv\x02w" + + "c\x02mc\x02md\x02dj\x06ほか\x06ココ\x03サ\x03手\x03字\x03双\x03デ\x03二\x03多\x03解" + + "\x03天\x03交\x03映\x03無\x03料\x03前\x03後\x03再\x03新\x03初\x03終\x03生\x03販\x03声" + + "\x03吹\x03演\x03投\x03捕\x03一\x03三\x03遊\x03左\x03中\x03右\x03指\x03走\x03打\x03禁" + + "\x03空\x03合\x03満\x03有\x03月\x03申\x03割\x03営\x03配\x09〔本〕\x09〔三〕\x09〔二〕\x09〔安" + + "〕\x09〔点〕\x09〔打〕\x09〔盗〕\x09〔勝〕\x09〔敗〕\x03得\x03可\x03丽\x03丸\x03乁\x03你\x03" + + "侮\x03侻\x03倂\x03偺\x03備\x03僧\x03像\x03㒞\x03免\x03兔\x03兤\x03具\x03㒹\x03內\x03" + + "冗\x03冤\x03仌\x03冬\x03况\x03凵\x03刃\x03㓟\x03刻\x03剆\x03剷\x03㔕\x03勇\x03勉\x03" + + "勤\x03勺\x03包\x03匆\x03北\x03卉\x03卑\x03博\x03即\x03卽\x03卿\x03灰\x03及\x03叟\x03" + + "叫\x03叱\x03吆\x03咞\x03吸\x03呈\x03周\x03咢\x03哶\x03唐\x03啓\x03啣\x03善\x03喙\x03" + + "喫\x03喳\x03嗂\x03圖\x03嘆\x03圗\x03噑\x03噴\x03切\x03壮\x03城\x03埴\x03堍\x03型\x03" + + "堲\x03報\x03墬\x03売\x03壷\x03夆\x03夢\x03奢\x03姬\x03娛\x03娧\x03姘\x03婦\x03㛮\x03" + + "嬈\x03嬾\x03寃\x03寘\x03寧\x03寳\x03寿\x03将\x03尢\x03㞁\x03屠\x03屮\x03峀\x03岍\x03" + + "嵃\x03嵮\x03嵫\x03嵼\x03巡\x03巢\x03㠯\x03巽\x03帨\x03帽\x03幩\x03㡢\x03㡼\x03庰\x03" + + "庳\x03庶\x03廊\x03廾\x03舁\x03弢\x03㣇\x03形\x03彫\x03㣣\x03徚\x03忍\x03志\x03忹\x03" + + "悁\x03㤺\x03㤜\x03悔\x03惇\x03慈\x03慌\x03慎\x03慺\x03憎\x03憲\x03憤\x03憯\x03懞\x03" + + "懲\x03懶\x03成\x03戛\x03扝\x03抱\x03拔\x03捐\x03挽\x03拼\x03捨\x03掃\x03揤\x03搢\x03" + + "揅\x03掩\x03㨮\x03摩\x03摾\x03撝\x03摷\x03㩬\x03敏\x03敬\x03旣\x03書\x03晉\x03㬙\x03" + + "暑\x03㬈\x03㫤\x03冒\x03冕\x03最\x03暜\x03肭\x03䏙\x03朗\x03望\x03朡\x03杞\x03杓\x03" + + "㭉\x03柺\x03枅\x03桒\x03梅\x03梎\x03栟\x03椔\x03㮝\x03楂\x03榣\x03槪\x03檨\x03櫛\x03" + + "㰘\x03次\x03歔\x03㱎\x03歲\x03殟\x03殺\x03殻\x03汎\x03沿\x03泍\x03汧\x03洖\x03派\x03" + + "海\x03流\x03浩\x03浸\x03涅\x03洴\x03港\x03湮\x03㴳\x03滋\x03滇\x03淹\x03潮\x03濆\x03" + + "瀹\x03瀞\x03瀛\x03㶖\x03灊\x03災\x03灷\x03炭\x03煅\x03熜\x03爨\x03爵\x03牐\x03犀\x03" + + "犕\x03獺\x03王\x03㺬\x03玥\x03㺸\x03瑇\x03瑜\x03瑱\x03璅\x03瓊\x03㼛\x03甤\x03甾\x03" + + "異\x03瘐\x03㿼\x03䀈\x03直\x03眞\x03真\x03睊\x03䀹\x03瞋\x03䁆\x03䂖\x03硎\x03碌\x03" + + "磌\x03䃣\x03祖\x03福\x03秫\x03䄯\x03穀\x03穊\x03穏\x03䈂\x03篆\x03築\x03䈧\x03糒\x03" + + "䊠\x03糨\x03糣\x03紀\x03絣\x03䌁\x03緇\x03縂\x03繅\x03䌴\x03䍙\x03罺\x03羕\x03翺\x03" + + "者\x03聠\x03聰\x03䏕\x03育\x03脃\x03䐋\x03脾\x03媵\x03舄\x03辞\x03䑫\x03芑\x03芋\x03" + + "芝\x03劳\x03花\x03芳\x03芽\x03苦\x03若\x03茝\x03荣\x03莭\x03茣\x03莽\x03菧\x03著\x03" + + "荓\x03菊\x03菌\x03菜\x03䔫\x03蓱\x03蓳\x03蔖\x03蕤\x03䕝\x03䕡\x03䕫\x03虐\x03虜\x03" + + "虧\x03虩\x03蚩\x03蚈\x03蜎\x03蛢\x03蝹\x03蜨\x03蝫\x03螆\x03蟡\x03蠁\x03䗹\x03衠\x03" + + "衣\x03裗\x03裞\x03䘵\x03裺\x03㒻\x03䚾\x03䛇\x03誠\x03諭\x03變\x03豕\x03貫\x03賁\x03" + + "贛\x03起\x03跋\x03趼\x03跰\x03軔\x03輸\x03邔\x03郱\x03鄑\x03鄛\x03鈸\x03鋗\x03鋘\x03" + + "鉼\x03鏹\x03鐕\x03開\x03䦕\x03閷\x03䧦\x03雃\x03嶲\x03霣\x03䩮\x03䩶\x03韠\x03䪲\x03" + + "頋\x03頩\x03飢\x03䬳\x03餩\x03馧\x03駂\x03駾\x03䯎\x03鬒\x03鱀\x03鳽\x03䳎\x03䳭\x03" + + "鵧\x03䳸\x03麻\x03䵖\x03黹\x03黾\x03鼅\x03鼏\x03鼖\x03鼻" + +var xorData string = "" + // Size: 4855 bytes + "\x02\x0c\x09\x02\xb0\xec\x02\xad\xd8\x02\xad\xd9\x02\x06\x07\x02\x0f\x12" + + "\x02\x0f\x1f\x02\x0f\x1d\x02\x01\x13\x02\x0f\x16\x02\x0f\x0b\x02\x0f3" + + "\x02\x0f7\x02\x0f?\x02\x0f/\x02\x0f*\x02\x0c&\x02\x0c*\x02\x0c;\x02\x0c9" + + "\x02\x0c%\x02\xab\xed\x02\xab\xe2\x02\xab\xe3\x02\xa9\xe0\x02\xa9\xe1" + + "\x02\xa9\xe6\x02\xa3\xcb\x02\xa3\xc8\x02\xa3\xc9\x02\x01#\x02\x01\x08" + + "\x02\x0e>\x02\x0e'\x02\x0f\x03\x02\x03\x0d\x02\x03\x09\x02\x03\x17\x02" + + "\x03\x0e\x02\x02\x03\x02\x011\x02\x01\x00\x02\x01\x10\x02\x03<\x02\x07" + + "\x0d\x02\x02\x0c\x02\x0c0\x02\x01\x03\x02\x01\x01\x02\x01 \x02\x01\x22" + + "\x02\x01)\x02\x01\x0a\x02\x01\x0c\x02\x02\x06\x02\x02\x02\x02\x03\x10" + + "\x03\x037 \x03\x0b+\x03\x02\x01\x04\x02\x01\x02\x02\x019\x02\x03\x1c\x02" + + "\x02$\x03\x80p$\x02\x03:\x02\x03\x0a\x03\xc1r.\x03\xc1r,\x03\xc1r\x02" + + "\x02\x02:\x02\x02>\x02\x02,\x02\x02\x10\x02\x02\x00\x03\xc1s<\x03\xc1s*" + + "\x03\xc2L$\x03\xc2L;\x02\x09)\x02\x0a\x19\x03\x83\xab\xe3\x03\x83\xab" + + "\xf2\x03 4\xe0\x03\x81\xab\xea\x03\x81\xab\xf3\x03 4\xef\x03\x96\xe1\xcd" + + "\x03\x84\xe5\xc3\x02\x0d\x11\x03\x8b\xec\xcb\x03\x94\xec\xcf\x03\x9a\xec" + + "\xc2\x03\x8b\xec\xdb\x03\x94\xec\xdf\x03\x9a\xec\xd2\x03\x01\x0c!\x03" + + "\x01\x0c#\x03ʠ\x9d\x03ʣ\x9c\x03ʢ\x9f\x03ʥ\x9e\x03ʤ\x91\x03ʧ\x90\x03ʦ\x93" + + "\x03ʩ\x92\x03ʨ\x95\x03\xca\xf3\xb5\x03\xca\xf0\xb4\x03\xca\xf1\xb7\x03" + + "\xca\xf6\xb6\x03\xca\xf7\x89\x03\xca\xf4\x88\x03\xca\xf5\x8b\x03\xca\xfa" + + "\x8a\x03\xca\xfb\x8d\x03\xca\xf8\x8c\x03\xca\xf9\x8f\x03\xca\xfe\x8e\x03" + + "\xca\xff\x81\x03\xca\xfc\x80\x03\xca\xfd\x83\x03\xca\xe2\x82\x03\xca\xe3" + + "\x85\x03\xca\xe0\x84\x03\xca\xe1\x87\x03\xca\xe6\x86\x03\xca\xe7\x99\x03" + + "\xca\xe4\x98\x03\xca\xe5\x9b\x03\xca\xea\x9a\x03\xca\xeb\x9d\x03\xca\xe8" + + "\x9c\x03ؓ\x89\x03ߔ\x8b\x02\x010\x03\x03\x04\x1e\x03\x04\x15\x12\x03\x0b" + + "\x05,\x03\x06\x04\x00\x03\x06\x04)\x03\x06\x044\x03\x06\x04<\x03\x06\x05" + + "\x1d\x03\x06\x06\x00\x03\x06\x06\x0a\x03\x06\x06'\x03\x06\x062\x03\x0786" + + "\x03\x079/\x03\x079 \x03\x07:\x0e\x03\x07:\x1b\x03\x07:%\x03\x07;/\x03" + + "\x07;%\x03\x074\x11\x03\x076\x09\x03\x077*\x03\x070\x01\x03\x070\x0f\x03" + + "\x070.\x03\x071\x16\x03\x071\x04\x03\x0710\x03\x072\x18\x03\x072-\x03" + + "\x073\x14\x03\x073>\x03\x07'\x09\x03\x07 \x00\x03\x07\x1f\x0b\x03\x07" + + "\x18#\x03\x07\x18(\x03\x07\x186\x03\x07\x18\x03\x03\x07\x19\x16\x03\x07" + + "\x116\x03\x07\x12'\x03\x07\x13\x10\x03\x07\x0c&\x03\x07\x0c\x08\x03\x07" + + "\x0c\x13\x03\x07\x0d\x02\x03\x07\x0d\x1c\x03\x07\x0b5\x03\x07\x0b\x0a" + + "\x03\x07\x0b\x01\x03\x07\x0b\x0f\x03\x07\x05\x00\x03\x07\x05\x09\x03\x07" + + "\x05\x0b\x03\x07\x07\x01\x03\x07\x07\x08\x03\x07\x00<\x03\x07\x00+\x03" + + "\x07\x01)\x03\x07\x01\x1b\x03\x07\x01\x08\x03\x07\x03?\x03\x0445\x03\x04" + + "4\x08\x03\x0454\x03\x04)/\x03\x04)5\x03\x04+\x05\x03\x04+\x14\x03\x04+ " + + "\x03\x04+<\x03\x04*&\x03\x04*\x22\x03\x04&8\x03\x04!\x01\x03\x04!\x22" + + "\x03\x04\x11+\x03\x04\x10.\x03\x04\x104\x03\x04\x13=\x03\x04\x12\x04\x03" + + "\x04\x12\x0a\x03\x04\x0d\x1d\x03\x04\x0d\x07\x03\x04\x0d \x03\x05<>\x03" + + "\x055<\x03\x055!\x03\x055#\x03\x055&\x03\x054\x1d\x03\x054\x02\x03\x054" + + "\x07\x03\x0571\x03\x053\x1a\x03\x053\x16\x03\x05.<\x03\x05.\x07\x03\x05)" + + ":\x03\x05)<\x03\x05)\x0c\x03\x05)\x15\x03\x05+-\x03\x05+5\x03\x05$\x1e" + + "\x03\x05$\x14\x03\x05'\x04\x03\x05'\x14\x03\x05&\x02\x03\x05\x226\x03" + + "\x05\x22\x0c\x03\x05\x22\x1c\x03\x05\x19\x0a\x03\x05\x1b\x09\x03\x05\x1b" + + "\x0c\x03\x05\x14\x07\x03\x05\x16?\x03\x05\x16\x0c\x03\x05\x0c\x05\x03" + + "\x05\x0e\x0f\x03\x05\x01\x0e\x03\x05\x00(\x03\x05\x030\x03\x05\x03\x06" + + "\x03\x0a==\x03\x0a=1\x03\x0a=,\x03\x0a=\x0c\x03\x0a??\x03\x0a<\x08\x03" + + "\x0a9!\x03\x0a9)\x03\x0a97\x03\x0a99\x03\x0a6\x0a\x03\x0a6\x1c\x03\x0a6" + + "\x17\x03\x0a7'\x03\x0a78\x03\x0a73\x03\x0a'\x01\x03\x0a'&\x03\x0a\x1f" + + "\x0e\x03\x0a\x1f\x03\x03\x0a\x1f3\x03\x0a\x1b/\x03\x0a\x18\x19\x03\x0a" + + "\x19\x01\x03\x0a\x16\x14\x03\x0a\x0e\x22\x03\x0a\x0f\x10\x03\x0a\x0f\x02" + + "\x03\x0a\x0f \x03\x0a\x0c\x04\x03\x0a\x0b>\x03\x0a\x0b+\x03\x0a\x08/\x03" + + "\x0a\x046\x03\x0a\x05\x14\x03\x0a\x00\x04\x03\x0a\x00\x10\x03\x0a\x00" + + "\x14\x03\x0b<3\x03\x0b;*\x03\x0b9\x22\x03\x0b9)\x03\x0b97\x03\x0b+\x10" + + "\x03\x0b((\x03\x0b&5\x03\x0b$\x1c\x03\x0b$\x12\x03\x0b%\x04\x03\x0b#<" + + "\x03\x0b#0\x03\x0b#\x0d\x03\x0b#\x19\x03\x0b!:\x03\x0b!\x1f\x03\x0b!\x00" + + "\x03\x0b\x1e5\x03\x0b\x1c\x1d\x03\x0b\x1d-\x03\x0b\x1d(\x03\x0b\x18.\x03" + + "\x0b\x18 \x03\x0b\x18\x16\x03\x0b\x14\x13\x03\x0b\x15$\x03\x0b\x15\x22" + + "\x03\x0b\x12\x1b\x03\x0b\x12\x10\x03\x0b\x132\x03\x0b\x13=\x03\x0b\x12" + + "\x18\x03\x0b\x0c&\x03\x0b\x061\x03\x0b\x06:\x03\x0b\x05#\x03\x0b\x05<" + + "\x03\x0b\x04\x0b\x03\x0b\x04\x04\x03\x0b\x04\x1b\x03\x0b\x042\x03\x0b" + + "\x041\x03\x0b\x03\x03\x03\x0b\x03\x1d\x03\x0b\x03/\x03\x0b\x03+\x03\x0b" + + "\x02\x1b\x03\x0b\x02\x00\x03\x0b\x01\x1e\x03\x0b\x01\x08\x03\x0b\x015" + + "\x03\x06\x0d9\x03\x06\x0d=\x03\x06\x0d?\x03\x02\x001\x03\x02\x003\x03" + + "\x02\x02\x19\x03\x02\x006\x03\x02\x02\x1b\x03\x02\x004\x03\x02\x00<\x03" + + "\x02\x02\x0a\x03\x02\x02\x0e\x03\x02\x01\x1a\x03\x02\x01\x07\x03\x02\x01" + + "\x05\x03\x02\x01\x0b\x03\x02\x01%\x03\x02\x01\x0c\x03\x02\x01\x04\x03" + + "\x02\x01\x1c\x03\x02\x00.\x03\x02\x002\x03\x02\x00>\x03\x02\x00\x12\x03" + + "\x02\x00\x16\x03\x02\x011\x03\x02\x013\x03\x02\x02 \x03\x02\x02%\x03\x02" + + "\x02$\x03\x02\x028\x03\x02\x02;\x03\x02\x024\x03\x02\x012\x03\x02\x022" + + "\x03\x02\x02/\x03\x02\x01,\x03\x02\x01\x13\x03\x02\x01\x16\x03\x02\x01" + + "\x11\x03\x02\x01\x1e\x03\x02\x01\x15\x03\x02\x01\x17\x03\x02\x01\x0f\x03" + + "\x02\x01\x08\x03\x02\x00?\x03\x02\x03\x07\x03\x02\x03\x0d\x03\x02\x03" + + "\x13\x03\x02\x03\x1d\x03\x02\x03\x1f\x03\x02\x00\x03\x03\x02\x00\x0d\x03" + + "\x02\x00\x01\x03\x02\x00\x1b\x03\x02\x00\x19\x03\x02\x00\x18\x03\x02\x00" + + "\x13\x03\x02\x00/\x03\x07>\x12\x03\x07<\x1f\x03\x07>\x1d\x03\x06\x1d\x0e" + + "\x03\x07>\x1c\x03\x07>:\x03\x07>\x13\x03\x04\x12+\x03\x07?\x03\x03\x07>" + + "\x02\x03\x06\x224\x03\x06\x1a.\x03\x07<%\x03\x06\x1c\x0b\x03\x0609\x03" + + "\x05\x1f\x01\x03\x04'\x08\x03\x93\xfd\xf5\x03\x02\x0d \x03\x02\x0d#\x03" + + "\x02\x0d!\x03\x02\x0d&\x03\x02\x0d\x22\x03\x02\x0d/\x03\x02\x0d,\x03\x02" + + "\x0d$\x03\x02\x0d'\x03\x02\x0d%\x03\x02\x0d;\x03\x02\x0d=\x03\x02\x0d?" + + "\x03\x099.\x03\x08\x0b7\x03\x08\x02\x14\x03\x08\x14\x0d\x03\x08.:\x03" + + "\x089'\x03\x0f\x0b\x18\x03\x0f\x1c1\x03\x0f\x17&\x03\x0f9\x1f\x03\x0f0" + + "\x0c\x03\x0e\x0a9\x03\x0e\x056\x03\x0e\x1c#\x03\x0f\x13\x0e\x03\x072\x00" + + "\x03\x070\x0d\x03\x072\x0b\x03\x06\x11\x18\x03\x070\x10\x03\x06\x0f(\x03" + + "\x072\x05\x03\x06\x0f,\x03\x073\x15\x03\x06\x07\x08\x03\x05\x16\x02\x03" + + "\x04\x0b \x03\x05:8\x03\x05\x16%\x03\x0a\x0d\x1f\x03\x06\x16\x10\x03\x05" + + "\x1d5\x03\x05*;\x03\x05\x16\x1b\x03\x04.-\x03\x06\x1a\x19\x03\x04\x03," + + "\x03\x0b87\x03\x04/\x0a\x03\x06\x00,\x03\x04-\x01\x03\x04\x1e-\x03\x06/(" + + "\x03\x0a\x0b5\x03\x06\x0e7\x03\x06\x07.\x03\x0597\x03\x0a*%\x03\x0760" + + "\x03\x06\x0c;\x03\x05'\x00\x03\x072.\x03\x072\x08\x03\x06=\x01\x03\x06" + + "\x05\x1b\x03\x06\x06\x12\x03\x06$=\x03\x06'\x0d\x03\x04\x11\x0f\x03\x076" + + ",\x03\x06\x07;\x03\x06.,\x03\x86\xf9\xea\x03\x8f\xff\xeb\x02\x092\x02" + + "\x095\x02\x094\x02\x09;\x02\x09>\x02\x098\x02\x09*\x02\x09/\x02\x09,\x02" + + "\x09%\x02\x09&\x02\x09#\x02\x09 \x02\x08!\x02\x08%\x02\x08$\x02\x08+\x02" + + "\x08.\x02\x08*\x02\x08&\x02\x088\x02\x08>\x02\x084\x02\x086\x02\x080\x02" + + "\x08\x10\x02\x08\x17\x02\x08\x12\x02\x08\x1d\x02\x08\x1f\x02\x08\x13\x02" + + "\x08\x15\x02\x08\x14\x02\x08\x0c\x03\x8b\xfd\xd0\x03\x81\xec\xc6\x03\x87" + + "\xe0\x8a\x03-2\xe3\x03\x80\xef\xe4\x03-2\xea\x03\x88\xe6\xeb\x03\x8e\xe6" + + "\xe8\x03\x84\xe6\xe9\x03\x97\xe6\xee\x03-2\xf9\x03-2\xf6\x03\x8e\xe3\xad" + + "\x03\x80\xe3\x92\x03\x88\xe3\x90\x03\x8e\xe3\x90\x03\x80\xe3\x97\x03\x88" + + "\xe3\x95\x03\x88\xfe\xcb\x03\x8e\xfe\xca\x03\x84\xfe\xcd\x03\x91\xef\xc9" + + "\x03-2\xc1\x03-2\xc0\x03-2\xcb\x03\x88@\x09\x03\x8e@\x08\x03\x8f\xe0\xf5" + + "\x03\x8e\xe6\xf9\x03\x8e\xe0\xfa\x03\x93\xff\xf4\x03\x84\xee\xd3\x03\x0b" + + "(\x04\x023 \x021;\x02\x01*\x03\x0b#\x10\x03\x0b 0\x03\x0b!\x10\x03\x0b!0" + + "\x03\x07\x15\x08\x03\x09?5\x03\x07\x1f\x08\x03\x07\x17\x0b\x03\x09\x1f" + + "\x15\x03\x0b\x1c7\x03\x0a+#\x03\x06\x1a\x1b\x03\x06\x1a\x14\x03\x0a\x01" + + "\x18\x03\x06#\x1b\x03\x0a2\x0c\x03\x0a\x01\x04\x03\x09#;\x03\x08='\x03" + + "\x08\x1a\x0a\x03\x07\x03\x0a\x111\x03\x09\x1b\x09\x03\x073.\x03\x07\x01\x00" + + "\x03\x09/,\x03\x07#>\x03\x07\x048\x03\x0a\x1f\x22\x03\x098>\x03\x09\x11" + + "\x00\x03\x08/\x17\x03\x06'\x22\x03\x0b\x1a+\x03\x0a\x22\x19\x03\x0a/1" + + "\x03\x0974\x03\x09\x0f\x22\x03\x08,\x22\x03\x08?\x14\x03\x07$5\x03\x07<3" + + "\x03\x07=*\x03\x07\x13\x18\x03\x068\x0a\x03\x06\x09\x16\x03\x06\x13\x00" + + "\x03\x08\x067\x03\x08\x01\x03\x03\x08\x12\x1d\x03\x07+7\x03\x06(;\x03" + + "\x06\x1c?\x03\x07\x0e\x17\x03\x0a\x06\x1d\x03\x0a\x19\x07\x03\x08\x14$" + + "\x03\x07$;\x03\x08,$\x03\x08\x06\x0d\x03\x07\x16\x0a\x03\x06>>\x03\x0a" + + "\x06\x12\x03\x0a\x14)\x03\x09\x0d\x1f\x03\x09\x12\x17\x03\x09\x19\x01" + + "\x03\x08\x11 \x03\x08\x1d'\x03\x06<\x1a\x03\x0a.\x00\x03\x07'\x18\x03" + + "\x0a\x22\x08\x03\x08\x0d\x0a\x03\x08\x13)\x03\x07*)\x03\x06<,\x03\x07" + + "\x0b\x1a\x03\x09.\x14\x03\x09\x0d\x1e\x03\x07\x0e#\x03\x0b\x1d'\x03\x0a" + + "\x0a8\x03\x09%2\x03\x08+&\x03\x080\x12\x03\x0a)4\x03\x08\x06\x1f\x03\x0b" + + "\x1b\x1a\x03\x0a\x1b\x0f\x03\x0b\x1d*\x03\x09\x16$\x03\x090\x11\x03\x08" + + "\x11\x08\x03\x0a*(\x03\x0a\x042\x03\x089,\x03\x074'\x03\x07\x0f\x05\x03" + + "\x09\x0b\x0a\x03\x07\x1b\x01\x03\x09\x17:\x03\x09.\x0d\x03\x07.\x11\x03" + + "\x09+\x15\x03\x080\x13\x03\x0b\x1f\x19\x03\x0a \x11\x03\x0a\x220\x03\x09" + + "\x07;\x03\x08\x16\x1c\x03\x07,\x13\x03\x07\x0e/\x03\x06\x221\x03\x0a." + + "\x0a\x03\x0a7\x02\x03\x0a\x032\x03\x0a\x1d.\x03\x091\x06\x03\x09\x19:" + + "\x03\x08\x02/\x03\x060+\x03\x06\x0f-\x03\x06\x1c\x1f\x03\x06\x1d\x07\x03" + + "\x0a,\x11\x03\x09=\x0d\x03\x09\x0b;\x03\x07\x1b/\x03\x0a\x1f:\x03\x09 " + + "\x1f\x03\x09.\x10\x03\x094\x0b\x03\x09\x1a1\x03\x08#\x1a\x03\x084\x1d" + + "\x03\x08\x01\x1f\x03\x08\x11\x22\x03\x07'8\x03\x07\x1a>\x03\x0757\x03" + + "\x06&9\x03\x06+\x11\x03\x0a.\x0b\x03\x0a,>\x03\x0a4#\x03\x08%\x17\x03" + + "\x07\x05\x22\x03\x07\x0c\x0b\x03\x0a\x1d+\x03\x0a\x19\x16\x03\x09+\x1f" + + "\x03\x09\x08\x0b\x03\x08\x16\x18\x03\x08+\x12\x03\x0b\x1d\x0c\x03\x0a=" + + "\x10\x03\x0a\x09\x0d\x03\x0a\x10\x11\x03\x09&0\x03\x08(\x1f\x03\x087\x07" + + "\x03\x08\x185\x03\x07'6\x03\x06.\x05\x03\x06=\x04\x03\x06;;\x03\x06\x06," + + "\x03\x0b\x18>\x03\x08\x00\x18\x03\x06 \x03\x03\x06<\x00\x03\x09%\x18\x03" + + "\x0b\x1c<\x03\x0a%!\x03\x0a\x09\x12\x03\x0a\x16\x02\x03\x090'\x03\x09" + + "\x0e=\x03\x08 \x0e\x03\x08>\x03\x03\x074>\x03\x06&?\x03\x06\x19\x09\x03" + + "\x06?(\x03\x0a-\x0e\x03\x09:3\x03\x098:\x03\x09\x12\x0b\x03\x09\x1d\x17" + + "\x03\x087\x05\x03\x082\x14\x03\x08\x06%\x03\x08\x13\x1f\x03\x06\x06\x0e" + + "\x03\x0a\x22<\x03\x09/<\x03\x06>+\x03\x0a'?\x03\x0a\x13\x0c\x03\x09\x10<" + + "\x03\x07\x1b=\x03\x0a\x19\x13\x03\x09\x22\x1d\x03\x09\x07\x0d\x03\x08)" + + "\x1c\x03\x06=\x1a\x03\x0a/4\x03\x0a7\x11\x03\x0a\x16:\x03\x09?3\x03\x09:" + + "/\x03\x09\x05\x0a\x03\x09\x14\x06\x03\x087\x22\x03\x080\x07\x03\x08\x1a" + + "\x1f\x03\x07\x04(\x03\x07\x04\x09\x03\x06 %\x03\x06<\x08\x03\x0a+\x14" + + "\x03\x09\x1d\x16\x03\x0a70\x03\x08 >\x03\x0857\x03\x070\x0a\x03\x06=\x12" + + "\x03\x06\x16%\x03\x06\x1d,\x03\x099#\x03\x09\x10>\x03\x07 \x1e\x03\x08" + + "\x0c<\x03\x08\x0b\x18\x03\x08\x15+\x03\x08,:\x03\x08%\x22\x03\x07\x0a$" + + "\x03\x0b\x1c=\x03\x07+\x08\x03\x0a/\x05\x03\x0a \x07\x03\x0a\x12'\x03" + + "\x09#\x11\x03\x08\x1b\x15\x03\x0a\x06\x01\x03\x09\x1c\x1b\x03\x0922\x03" + + "\x07\x14<\x03\x07\x09\x04\x03\x061\x04\x03\x07\x0e\x01\x03\x0a\x13\x18" + + "\x03\x0a-\x0c\x03\x0a?\x0d\x03\x0a\x09\x0a\x03\x091&\x03\x0a/\x0b\x03" + + "\x08$<\x03\x083\x1d\x03\x08\x0c$\x03\x08\x0d\x07\x03\x08\x0d?\x03\x08" + + "\x0e\x14\x03\x065\x0a\x03\x08\x1a#\x03\x08\x16#\x03\x0702\x03\x07\x03" + + "\x1a\x03\x06(\x1d\x03\x06+\x1b\x03\x06\x0b\x05\x03\x06\x0b\x17\x03\x06" + + "\x0c\x04\x03\x06\x1e\x19\x03\x06+0\x03\x062\x18\x03\x0b\x16\x1e\x03\x0a+" + + "\x16\x03\x0a-?\x03\x0a#:\x03\x0a#\x10\x03\x0a%$\x03\x0a>+\x03\x0a01\x03" + + "\x0a1\x10\x03\x0a\x099\x03\x0a\x0a\x12\x03\x0a\x19\x1f\x03\x0a\x19\x12" + + "\x03\x09*)\x03\x09-\x16\x03\x09.1\x03\x09.2\x03\x09<\x0e\x03\x09> \x03" + + "\x093\x12\x03\x09\x0b\x01\x03\x09\x1c2\x03\x09\x11\x1c\x03\x09\x15%\x03" + + "\x08,&\x03\x08!\x22\x03\x089(\x03\x08\x0b\x1a\x03\x08\x0d2\x03\x08\x0c" + + "\x04\x03\x08\x0c\x06\x03\x08\x0c\x1f\x03\x08\x0c\x0c\x03\x08\x0f\x1f\x03" + + "\x08\x0f\x1d\x03\x08\x00\x14\x03\x08\x03\x14\x03\x08\x06\x16\x03\x08\x1e" + + "#\x03\x08\x11\x11\x03\x08\x10\x18\x03\x08\x14(\x03\x07)\x1e\x03\x07.1" + + "\x03\x07 $\x03\x07 '\x03\x078\x08\x03\x07\x0d0\x03\x07\x0f7\x03\x07\x05#" + + "\x03\x07\x05\x1a\x03\x07\x1a7\x03\x07\x1d-\x03\x07\x17\x10\x03\x06)\x1f" + + "\x03\x062\x0b\x03\x066\x16\x03\x06\x09\x11\x03\x09(\x1e\x03\x07!5\x03" + + "\x0b\x11\x16\x03\x0a/\x04\x03\x0a,\x1a\x03\x0b\x173\x03\x0a,1\x03\x0a/5" + + "\x03\x0a\x221\x03\x0a\x22\x0d\x03\x0a?%\x03\x0a<,\x03\x0a?#\x03\x0a>\x19" + + "\x03\x0a\x08&\x03\x0a\x0b\x0e\x03\x0a\x0c:\x03\x0a\x0c+\x03\x0a\x03\x22" + + "\x03\x0a\x06)\x03\x0a\x11\x10\x03\x0a\x11\x1a\x03\x0a\x17-\x03\x0a\x14(" + + "\x03\x09)\x1e\x03\x09/\x09\x03\x09.\x00\x03\x09,\x07\x03\x09/*\x03\x09-9" + + "\x03\x09\x228\x03\x09%\x09\x03\x09:\x12\x03\x09;\x1d\x03\x09?\x06\x03" + + "\x093%\x03\x096\x05\x03\x096\x08\x03\x097\x02\x03\x09\x07,\x03\x09\x04," + + "\x03\x09\x1f\x16\x03\x09\x11\x03\x03\x09\x11\x12\x03\x09\x168\x03\x08*" + + "\x05\x03\x08/2\x03\x084:\x03\x08\x22+\x03\x08 0\x03\x08&\x0a\x03\x08;" + + "\x10\x03\x08>$\x03\x08>\x18\x03\x0829\x03\x082:\x03\x081,\x03\x081<\x03" + + "\x081\x1c\x03\x087#\x03\x087*\x03\x08\x09'\x03\x08\x00\x1d\x03\x08\x05-" + + "\x03\x08\x1f4\x03\x08\x1d\x04\x03\x08\x16\x0f\x03\x07*7\x03\x07'!\x03" + + "\x07%\x1b\x03\x077\x0c\x03\x07\x0c1\x03\x07\x0c.\x03\x07\x00\x06\x03\x07" + + "\x01\x02\x03\x07\x010\x03\x07\x06=\x03\x07\x01\x03\x03\x07\x01\x13\x03" + + "\x07\x06\x06\x03\x07\x05\x0a\x03\x07\x1f\x09\x03\x07\x17:\x03\x06*1\x03" + + "\x06-\x1d\x03\x06\x223\x03\x062:\x03\x060$\x03\x066\x1e\x03\x064\x12\x03" + + "\x0645\x03\x06\x0b\x00\x03\x06\x0b7\x03\x06\x07\x1f\x03\x06\x15\x12\x03" + + "\x0c\x05\x0f\x03\x0b+\x0b\x03\x0b+-\x03\x06\x16\x1b\x03\x06\x15\x17\x03" + + "\x89\xca\xea\x03\x89\xca\xe8\x03\x0c8\x10\x03\x0c8\x01\x03\x0c8\x0f\x03" + + "\x0d8%\x03\x0d8!\x03\x0c8-\x03\x0c8/\x03\x0c8+\x03\x0c87\x03\x0c85\x03" + + "\x0c9\x09\x03\x0c9\x0d\x03\x0c9\x0f\x03\x0c9\x0b\x03\xcfu\x0c\x03\xcfu" + + "\x0f\x03\xcfu\x0e\x03\xcfu\x09\x03\x0c9\x10\x03\x0d9\x0c\x03\xcf`;\x03" + + "\xcf`>\x03\xcf`9\x03\xcf`8\x03\xcf`7\x03\xcf`*\x03\xcf`-\x03\xcf`,\x03" + + "\x0d\x1b\x1a\x03\x0d\x1b&\x03\x0c=.\x03\x0c=%\x03\x0c>\x1e\x03\x0c>\x14" + + "\x03\x0c?\x06\x03\x0c?\x0b\x03\x0c?\x0c\x03\x0c?\x0d\x03\x0c?\x02\x03" + + "\x0c>\x0f\x03\x0c>\x08\x03\x0c>\x09\x03\x0c>,\x03\x0c>\x0c\x03\x0c?\x13" + + "\x03\x0c?\x16\x03\x0c?\x15\x03\x0c?\x1c\x03\x0c?\x1f\x03\x0c?\x1d\x03" + + "\x0c?\x1a\x03\x0c?\x17\x03\x0c?\x08\x03\x0c?\x09\x03\x0c?\x0e\x03\x0c?" + + "\x04\x03\x0c?\x05\x03\x0c" + + "\x03\x0c=2\x03\x0c=6\x03\x0c<\x07\x03\x0c<\x05\x03\x0e:!\x03\x0e:#\x03" + + "\x0e8\x09\x03\x0e:&\x03\x0e8\x0b\x03\x0e:$\x03\x0e:,\x03\x0e8\x1a\x03" + + "\x0e8\x1e\x03\x0e:*\x03\x0e:7\x03\x0e:5\x03\x0e:;\x03\x0e:\x15\x03\x0e:<" + + "\x03\x0e:4\x03\x0e:'\x03\x0e:-\x03\x0e:%\x03\x0e:?\x03\x0e:=\x03\x0e:)" + + "\x03\x0e:/\x03\xcfs'\x03\x0d=\x0f\x03\x0d+*\x03\x0d99\x03\x0d9;\x03\x0d9" + + "?\x03\x0d)\x0d\x03\x0d(%\x02\x01\x18\x02\x01(\x02\x01\x1e\x03\x0f$!\x03" + + "\x0f87\x03\x0f4\x0e\x03\x0f5\x1d\x03\x06'\x03\x03\x0f\x08\x18\x03\x0f" + + "\x0d\x1b\x03\x0e2=\x03\x0e;\x08\x03\x0e:\x0b\x03\x0e\x06$\x03\x0e\x0d)" + + "\x03\x0e\x16\x1f\x03\x0e\x16\x1b\x03\x0d$\x0a\x03\x05,\x1d\x03\x0d. \x03" + + "\x0d.#\x03\x0c(/\x03\x09%\x02\x03\x0d90\x03\x0d\x0e4\x03\x0d\x0d\x0f\x03" + + "\x0c#\x00\x03\x0c,\x1e\x03\x0c2\x0e\x03\x0c\x01\x17\x03\x0c\x09:\x03\x0e" + + "\x173\x03\x0c\x08\x03\x03\x0c\x11\x07\x03\x0c\x10\x18\x03\x0c\x1f\x1c" + + "\x03\x0c\x19\x0e\x03\x0c\x1a\x1f\x03\x0f0>\x03\x0b->\x03\x0b<+\x03\x0b8" + + "\x13\x03\x0b\x043\x03\x0b\x14\x03\x03\x0b\x16%\x03\x0d\x22&\x03\x0b\x1a" + + "\x1a\x03\x0b\x1a\x04\x03\x0a%9\x03\x0a&2\x03\x0a&0\x03\x0a!\x1a\x03\x0a!" + + "7\x03\x0a5\x10\x03\x0a=4\x03\x0a?\x0e\x03\x0a>\x10\x03\x0a\x00 \x03\x0a" + + "\x0f:\x03\x0a\x0f9\x03\x0a\x0b\x0a\x03\x0a\x17%\x03\x0a\x1b-\x03\x09-" + + "\x1a\x03\x09,4\x03\x09.,\x03\x09)\x09\x03\x096!\x03\x091\x1f\x03\x093" + + "\x16\x03\x0c+\x1f\x03\x098 \x03\x098=\x03\x0c(\x1a\x03\x0c(\x16\x03\x09" + + "\x0a+\x03\x09\x16\x12\x03\x09\x13\x0e\x03\x09\x153\x03\x08)!\x03\x09\x1a" + + "\x01\x03\x09\x18\x01\x03\x08%#\x03\x08>\x22\x03\x08\x05%\x03\x08\x02*" + + "\x03\x08\x15;\x03\x08\x1b7\x03\x0f\x07\x1d\x03\x0f\x04\x03\x03\x070\x0c" + + "\x03\x07;\x0b\x03\x07\x08\x17\x03\x07\x12\x06\x03\x06/-\x03\x0671\x03" + + "\x065+\x03\x06>7\x03\x06\x049\x03\x05+\x1e\x03\x05,\x17\x03\x05 \x1d\x03" + + "\x05\x22\x05\x03\x050\x1d" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *idnaTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return idnaValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = idnaIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *idnaTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return idnaValues[c0] + } + i := idnaIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *idnaTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return idnaValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := idnaIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = idnaIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = idnaIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *idnaTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return idnaValues[c0] + } + i := idnaIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = idnaIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// idnaTrie. Total size: 28496 bytes (27.83 KiB). Checksum: 43288b883596640e. +type idnaTrie struct{} + +func newIdnaTrie(i int) *idnaTrie { + return &idnaTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *idnaTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 123: + return uint16(idnaValues[n<<6+uint32(b)]) + default: + n -= 123 + return uint16(idnaSparse.lookup(n, b)) + } +} + +// idnaValues: 125 blocks, 8000 entries, 16000 bytes +// The third block is the zero block. +var idnaValues = [8000]uint16{ + // Block 0x0, offset 0x0 + 0x00: 0x0080, 0x01: 0x0080, 0x02: 0x0080, 0x03: 0x0080, 0x04: 0x0080, 0x05: 0x0080, + 0x06: 0x0080, 0x07: 0x0080, 0x08: 0x0080, 0x09: 0x0080, 0x0a: 0x0080, 0x0b: 0x0080, + 0x0c: 0x0080, 0x0d: 0x0080, 0x0e: 0x0080, 0x0f: 0x0080, 0x10: 0x0080, 0x11: 0x0080, + 0x12: 0x0080, 0x13: 0x0080, 0x14: 0x0080, 0x15: 0x0080, 0x16: 0x0080, 0x17: 0x0080, + 0x18: 0x0080, 0x19: 0x0080, 0x1a: 0x0080, 0x1b: 0x0080, 0x1c: 0x0080, 0x1d: 0x0080, + 0x1e: 0x0080, 0x1f: 0x0080, 0x20: 0x0080, 0x21: 0x0080, 0x22: 0x0080, 0x23: 0x0080, + 0x24: 0x0080, 0x25: 0x0080, 0x26: 0x0080, 0x27: 0x0080, 0x28: 0x0080, 0x29: 0x0080, + 0x2a: 0x0080, 0x2b: 0x0080, 0x2c: 0x0080, 0x2d: 0x0008, 0x2e: 0x0008, 0x2f: 0x0080, + 0x30: 0x0008, 0x31: 0x0008, 0x32: 0x0008, 0x33: 0x0008, 0x34: 0x0008, 0x35: 0x0008, + 0x36: 0x0008, 0x37: 0x0008, 0x38: 0x0008, 0x39: 0x0008, 0x3a: 0x0080, 0x3b: 0x0080, + 0x3c: 0x0080, 0x3d: 0x0080, 0x3e: 0x0080, 0x3f: 0x0080, + // Block 0x1, offset 0x40 + 0x40: 0x0080, 0x41: 0xe105, 0x42: 0xe105, 0x43: 0xe105, 0x44: 0xe105, 0x45: 0xe105, + 0x46: 0xe105, 0x47: 0xe105, 0x48: 0xe105, 0x49: 0xe105, 0x4a: 0xe105, 0x4b: 0xe105, + 0x4c: 0xe105, 0x4d: 0xe105, 0x4e: 0xe105, 0x4f: 0xe105, 0x50: 0xe105, 0x51: 0xe105, + 0x52: 0xe105, 0x53: 0xe105, 0x54: 0xe105, 0x55: 0xe105, 0x56: 0xe105, 0x57: 0xe105, + 0x58: 0xe105, 0x59: 0xe105, 0x5a: 0xe105, 0x5b: 0x0080, 0x5c: 0x0080, 0x5d: 0x0080, + 0x5e: 0x0080, 0x5f: 0x0080, 0x60: 0x0080, 0x61: 0x0008, 0x62: 0x0008, 0x63: 0x0008, + 0x64: 0x0008, 0x65: 0x0008, 0x66: 0x0008, 0x67: 0x0008, 0x68: 0x0008, 0x69: 0x0008, + 0x6a: 0x0008, 0x6b: 0x0008, 0x6c: 0x0008, 0x6d: 0x0008, 0x6e: 0x0008, 0x6f: 0x0008, + 0x70: 0x0008, 0x71: 0x0008, 0x72: 0x0008, 0x73: 0x0008, 0x74: 0x0008, 0x75: 0x0008, + 0x76: 0x0008, 0x77: 0x0008, 0x78: 0x0008, 0x79: 0x0008, 0x7a: 0x0008, 0x7b: 0x0080, + 0x7c: 0x0080, 0x7d: 0x0080, 0x7e: 0x0080, 0x7f: 0x0080, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0040, 0xc1: 0x0040, 0xc2: 0x0040, 0xc3: 0x0040, 0xc4: 0x0040, 0xc5: 0x0040, + 0xc6: 0x0040, 0xc7: 0x0040, 0xc8: 0x0040, 0xc9: 0x0040, 0xca: 0x0040, 0xcb: 0x0040, + 0xcc: 0x0040, 0xcd: 0x0040, 0xce: 0x0040, 0xcf: 0x0040, 0xd0: 0x0040, 0xd1: 0x0040, + 0xd2: 0x0040, 0xd3: 0x0040, 0xd4: 0x0040, 0xd5: 0x0040, 0xd6: 0x0040, 0xd7: 0x0040, + 0xd8: 0x0040, 0xd9: 0x0040, 0xda: 0x0040, 0xdb: 0x0040, 0xdc: 0x0040, 0xdd: 0x0040, + 0xde: 0x0040, 0xdf: 0x0040, 0xe0: 0x000a, 0xe1: 0x0018, 0xe2: 0x0018, 0xe3: 0x0018, + 0xe4: 0x0018, 0xe5: 0x0018, 0xe6: 0x0018, 0xe7: 0x0018, 0xe8: 0x001a, 0xe9: 0x0018, + 0xea: 0x0039, 0xeb: 0x0018, 0xec: 0x0018, 0xed: 0x03c0, 0xee: 0x0018, 0xef: 0x004a, + 0xf0: 0x0018, 0xf1: 0x0018, 0xf2: 0x0069, 0xf3: 0x0079, 0xf4: 0x008a, 0xf5: 0x0005, + 0xf6: 0x0018, 0xf7: 0x0008, 0xf8: 0x00aa, 0xf9: 0x00c9, 0xfa: 0x00d9, 0xfb: 0x0018, + 0xfc: 0x00e9, 0xfd: 0x0119, 0xfe: 0x0149, 0xff: 0x0018, + // Block 0x4, offset 0x100 + 0x100: 0xe00d, 0x101: 0x0008, 0x102: 0xe00d, 0x103: 0x0008, 0x104: 0xe00d, 0x105: 0x0008, + 0x106: 0xe00d, 0x107: 0x0008, 0x108: 0xe00d, 0x109: 0x0008, 0x10a: 0xe00d, 0x10b: 0x0008, + 0x10c: 0xe00d, 0x10d: 0x0008, 0x10e: 0xe00d, 0x10f: 0x0008, 0x110: 0xe00d, 0x111: 0x0008, + 0x112: 0xe00d, 0x113: 0x0008, 0x114: 0xe00d, 0x115: 0x0008, 0x116: 0xe00d, 0x117: 0x0008, + 0x118: 0xe00d, 0x119: 0x0008, 0x11a: 0xe00d, 0x11b: 0x0008, 0x11c: 0xe00d, 0x11d: 0x0008, + 0x11e: 0xe00d, 0x11f: 0x0008, 0x120: 0xe00d, 0x121: 0x0008, 0x122: 0xe00d, 0x123: 0x0008, + 0x124: 0xe00d, 0x125: 0x0008, 0x126: 0xe00d, 0x127: 0x0008, 0x128: 0xe00d, 0x129: 0x0008, + 0x12a: 0xe00d, 0x12b: 0x0008, 0x12c: 0xe00d, 0x12d: 0x0008, 0x12e: 0xe00d, 0x12f: 0x0008, + 0x130: 0x0179, 0x131: 0x0008, 0x132: 0x0035, 0x133: 0x004d, 0x134: 0xe00d, 0x135: 0x0008, + 0x136: 0xe00d, 0x137: 0x0008, 0x138: 0x0008, 0x139: 0xe01d, 0x13a: 0x0008, 0x13b: 0xe03d, + 0x13c: 0x0008, 0x13d: 0xe01d, 0x13e: 0x0008, 0x13f: 0x0199, + // Block 0x5, offset 0x140 + 0x140: 0x0199, 0x141: 0xe01d, 0x142: 0x0008, 0x143: 0xe03d, 0x144: 0x0008, 0x145: 0xe01d, + 0x146: 0x0008, 0x147: 0xe07d, 0x148: 0x0008, 0x149: 0x01b9, 0x14a: 0xe00d, 0x14b: 0x0008, + 0x14c: 0xe00d, 0x14d: 0x0008, 0x14e: 0xe00d, 0x14f: 0x0008, 0x150: 0xe00d, 0x151: 0x0008, + 0x152: 0xe00d, 0x153: 0x0008, 0x154: 0xe00d, 0x155: 0x0008, 0x156: 0xe00d, 0x157: 0x0008, + 0x158: 0xe00d, 0x159: 0x0008, 0x15a: 0xe00d, 0x15b: 0x0008, 0x15c: 0xe00d, 0x15d: 0x0008, + 0x15e: 0xe00d, 0x15f: 0x0008, 0x160: 0xe00d, 0x161: 0x0008, 0x162: 0xe00d, 0x163: 0x0008, + 0x164: 0xe00d, 0x165: 0x0008, 0x166: 0xe00d, 0x167: 0x0008, 0x168: 0xe00d, 0x169: 0x0008, + 0x16a: 0xe00d, 0x16b: 0x0008, 0x16c: 0xe00d, 0x16d: 0x0008, 0x16e: 0xe00d, 0x16f: 0x0008, + 0x170: 0xe00d, 0x171: 0x0008, 0x172: 0xe00d, 0x173: 0x0008, 0x174: 0xe00d, 0x175: 0x0008, + 0x176: 0xe00d, 0x177: 0x0008, 0x178: 0x0065, 0x179: 0xe01d, 0x17a: 0x0008, 0x17b: 0xe03d, + 0x17c: 0x0008, 0x17d: 0xe01d, 0x17e: 0x0008, 0x17f: 0x01d9, + // Block 0x6, offset 0x180 + 0x180: 0x0008, 0x181: 0x007d, 0x182: 0xe00d, 0x183: 0x0008, 0x184: 0xe00d, 0x185: 0x0008, + 0x186: 0x007d, 0x187: 0xe07d, 0x188: 0x0008, 0x189: 0x0095, 0x18a: 0x00ad, 0x18b: 0xe03d, + 0x18c: 0x0008, 0x18d: 0x0008, 0x18e: 0x00c5, 0x18f: 0x00dd, 0x190: 0x00f5, 0x191: 0xe01d, + 0x192: 0x0008, 0x193: 0x010d, 0x194: 0x0125, 0x195: 0x0008, 0x196: 0x013d, 0x197: 0x013d, + 0x198: 0xe00d, 0x199: 0x0008, 0x19a: 0x0008, 0x19b: 0x0008, 0x19c: 0x010d, 0x19d: 0x0155, + 0x19e: 0x0008, 0x19f: 0x016d, 0x1a0: 0xe00d, 0x1a1: 0x0008, 0x1a2: 0xe00d, 0x1a3: 0x0008, + 0x1a4: 0xe00d, 0x1a5: 0x0008, 0x1a6: 0x0185, 0x1a7: 0xe07d, 0x1a8: 0x0008, 0x1a9: 0x019d, + 0x1aa: 0x0008, 0x1ab: 0x0008, 0x1ac: 0xe00d, 0x1ad: 0x0008, 0x1ae: 0x0185, 0x1af: 0xe0fd, + 0x1b0: 0x0008, 0x1b1: 0x01b5, 0x1b2: 0x01cd, 0x1b3: 0xe03d, 0x1b4: 0x0008, 0x1b5: 0xe01d, + 0x1b6: 0x0008, 0x1b7: 0x01e5, 0x1b8: 0xe00d, 0x1b9: 0x0008, 0x1ba: 0x0008, 0x1bb: 0x0008, + 0x1bc: 0xe00d, 0x1bd: 0x0008, 0x1be: 0x0008, 0x1bf: 0x0008, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0008, 0x1c1: 0x0008, 0x1c2: 0x0008, 0x1c3: 0x0008, 0x1c4: 0x01e9, 0x1c5: 0x01e9, + 0x1c6: 0x01e9, 0x1c7: 0x01fd, 0x1c8: 0x0215, 0x1c9: 0x022d, 0x1ca: 0x0245, 0x1cb: 0x025d, + 0x1cc: 0x0275, 0x1cd: 0xe01d, 0x1ce: 0x0008, 0x1cf: 0xe0fd, 0x1d0: 0x0008, 0x1d1: 0xe01d, + 0x1d2: 0x0008, 0x1d3: 0xe03d, 0x1d4: 0x0008, 0x1d5: 0xe01d, 0x1d6: 0x0008, 0x1d7: 0xe07d, + 0x1d8: 0x0008, 0x1d9: 0xe01d, 0x1da: 0x0008, 0x1db: 0xe03d, 0x1dc: 0x0008, 0x1dd: 0x0008, + 0x1de: 0xe00d, 0x1df: 0x0008, 0x1e0: 0xe00d, 0x1e1: 0x0008, 0x1e2: 0xe00d, 0x1e3: 0x0008, + 0x1e4: 0xe00d, 0x1e5: 0x0008, 0x1e6: 0xe00d, 0x1e7: 0x0008, 0x1e8: 0xe00d, 0x1e9: 0x0008, + 0x1ea: 0xe00d, 0x1eb: 0x0008, 0x1ec: 0xe00d, 0x1ed: 0x0008, 0x1ee: 0xe00d, 0x1ef: 0x0008, + 0x1f0: 0x0008, 0x1f1: 0x028d, 0x1f2: 0x02a5, 0x1f3: 0x02bd, 0x1f4: 0xe00d, 0x1f5: 0x0008, + 0x1f6: 0x02d5, 0x1f7: 0x02ed, 0x1f8: 0xe00d, 0x1f9: 0x0008, 0x1fa: 0xe00d, 0x1fb: 0x0008, + 0x1fc: 0xe00d, 0x1fd: 0x0008, 0x1fe: 0xe00d, 0x1ff: 0x0008, + // Block 0x8, offset 0x200 + 0x200: 0xe00d, 0x201: 0x0008, 0x202: 0xe00d, 0x203: 0x0008, 0x204: 0xe00d, 0x205: 0x0008, + 0x206: 0xe00d, 0x207: 0x0008, 0x208: 0xe00d, 0x209: 0x0008, 0x20a: 0xe00d, 0x20b: 0x0008, + 0x20c: 0xe00d, 0x20d: 0x0008, 0x20e: 0xe00d, 0x20f: 0x0008, 0x210: 0xe00d, 0x211: 0x0008, + 0x212: 0xe00d, 0x213: 0x0008, 0x214: 0xe00d, 0x215: 0x0008, 0x216: 0xe00d, 0x217: 0x0008, + 0x218: 0xe00d, 0x219: 0x0008, 0x21a: 0xe00d, 0x21b: 0x0008, 0x21c: 0xe00d, 0x21d: 0x0008, + 0x21e: 0xe00d, 0x21f: 0x0008, 0x220: 0x0305, 0x221: 0x0008, 0x222: 0xe00d, 0x223: 0x0008, + 0x224: 0xe00d, 0x225: 0x0008, 0x226: 0xe00d, 0x227: 0x0008, 0x228: 0xe00d, 0x229: 0x0008, + 0x22a: 0xe00d, 0x22b: 0x0008, 0x22c: 0xe00d, 0x22d: 0x0008, 0x22e: 0xe00d, 0x22f: 0x0008, + 0x230: 0xe00d, 0x231: 0x0008, 0x232: 0xe00d, 0x233: 0x0008, 0x234: 0x0008, 0x235: 0x0008, + 0x236: 0x0008, 0x237: 0x0008, 0x238: 0x0008, 0x239: 0x0008, 0x23a: 0x0209, 0x23b: 0xe03d, + 0x23c: 0x0008, 0x23d: 0x031d, 0x23e: 0x0229, 0x23f: 0x0008, + // Block 0x9, offset 0x240 + 0x240: 0x0008, 0x241: 0x0008, 0x242: 0x0018, 0x243: 0x0018, 0x244: 0x0018, 0x245: 0x0018, + 0x246: 0x0008, 0x247: 0x0008, 0x248: 0x0008, 0x249: 0x0008, 0x24a: 0x0008, 0x24b: 0x0008, + 0x24c: 0x0008, 0x24d: 0x0008, 0x24e: 0x0008, 0x24f: 0x0008, 0x250: 0x0008, 0x251: 0x0008, + 0x252: 0x0018, 0x253: 0x0018, 0x254: 0x0018, 0x255: 0x0018, 0x256: 0x0018, 0x257: 0x0018, + 0x258: 0x029a, 0x259: 0x02ba, 0x25a: 0x02da, 0x25b: 0x02fa, 0x25c: 0x031a, 0x25d: 0x033a, + 0x25e: 0x0018, 0x25f: 0x0018, 0x260: 0x03ad, 0x261: 0x0359, 0x262: 0x01d9, 0x263: 0x0369, + 0x264: 0x03c5, 0x265: 0x0018, 0x266: 0x0018, 0x267: 0x0018, 0x268: 0x0018, 0x269: 0x0018, + 0x26a: 0x0018, 0x26b: 0x0018, 0x26c: 0x0008, 0x26d: 0x0018, 0x26e: 0x0008, 0x26f: 0x0018, + 0x270: 0x0018, 0x271: 0x0018, 0x272: 0x0018, 0x273: 0x0018, 0x274: 0x0018, 0x275: 0x0018, + 0x276: 0x0018, 0x277: 0x0018, 0x278: 0x0018, 0x279: 0x0018, 0x27a: 0x0018, 0x27b: 0x0018, + 0x27c: 0x0018, 0x27d: 0x0018, 0x27e: 0x0018, 0x27f: 0x0018, + // Block 0xa, offset 0x280 + 0x280: 0x03dd, 0x281: 0x03dd, 0x282: 0x1308, 0x283: 0x03f5, 0x284: 0x0379, 0x285: 0x040d, + 0x286: 0x1308, 0x287: 0x1308, 0x288: 0x1308, 0x289: 0x1308, 0x28a: 0x1308, 0x28b: 0x1308, + 0x28c: 0x1308, 0x28d: 0x1308, 0x28e: 0x1308, 0x28f: 0x13c0, 0x290: 0x1308, 0x291: 0x1308, + 0x292: 0x1308, 0x293: 0x1308, 0x294: 0x1308, 0x295: 0x1308, 0x296: 0x1308, 0x297: 0x1308, + 0x298: 0x1308, 0x299: 0x1308, 0x29a: 0x1308, 0x29b: 0x1308, 0x29c: 0x1308, 0x29d: 0x1308, + 0x29e: 0x1308, 0x29f: 0x1308, 0x2a0: 0x1308, 0x2a1: 0x1308, 0x2a2: 0x1308, 0x2a3: 0x1308, + 0x2a4: 0x1308, 0x2a5: 0x1308, 0x2a6: 0x1308, 0x2a7: 0x1308, 0x2a8: 0x1308, 0x2a9: 0x1308, + 0x2aa: 0x1308, 0x2ab: 0x1308, 0x2ac: 0x1308, 0x2ad: 0x1308, 0x2ae: 0x1308, 0x2af: 0x1308, + 0x2b0: 0xe00d, 0x2b1: 0x0008, 0x2b2: 0xe00d, 0x2b3: 0x0008, 0x2b4: 0x0425, 0x2b5: 0x0008, + 0x2b6: 0xe00d, 0x2b7: 0x0008, 0x2b8: 0x0040, 0x2b9: 0x0040, 0x2ba: 0x03a2, 0x2bb: 0x0008, + 0x2bc: 0x0008, 0x2bd: 0x0008, 0x2be: 0x03c2, 0x2bf: 0x043d, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x0040, 0x2c1: 0x0040, 0x2c2: 0x0040, 0x2c3: 0x0040, 0x2c4: 0x008a, 0x2c5: 0x03d2, + 0x2c6: 0xe155, 0x2c7: 0x0455, 0x2c8: 0xe12d, 0x2c9: 0xe13d, 0x2ca: 0xe12d, 0x2cb: 0x0040, + 0x2cc: 0x03dd, 0x2cd: 0x0040, 0x2ce: 0x046d, 0x2cf: 0x0485, 0x2d0: 0x0008, 0x2d1: 0xe105, + 0x2d2: 0xe105, 0x2d3: 0xe105, 0x2d4: 0xe105, 0x2d5: 0xe105, 0x2d6: 0xe105, 0x2d7: 0xe105, + 0x2d8: 0xe105, 0x2d9: 0xe105, 0x2da: 0xe105, 0x2db: 0xe105, 0x2dc: 0xe105, 0x2dd: 0xe105, + 0x2de: 0xe105, 0x2df: 0xe105, 0x2e0: 0x049d, 0x2e1: 0x049d, 0x2e2: 0x0040, 0x2e3: 0x049d, + 0x2e4: 0x049d, 0x2e5: 0x049d, 0x2e6: 0x049d, 0x2e7: 0x049d, 0x2e8: 0x049d, 0x2e9: 0x049d, + 0x2ea: 0x049d, 0x2eb: 0x049d, 0x2ec: 0x0008, 0x2ed: 0x0008, 0x2ee: 0x0008, 0x2ef: 0x0008, + 0x2f0: 0x0008, 0x2f1: 0x0008, 0x2f2: 0x0008, 0x2f3: 0x0008, 0x2f4: 0x0008, 0x2f5: 0x0008, + 0x2f6: 0x0008, 0x2f7: 0x0008, 0x2f8: 0x0008, 0x2f9: 0x0008, 0x2fa: 0x0008, 0x2fb: 0x0008, + 0x2fc: 0x0008, 0x2fd: 0x0008, 0x2fe: 0x0008, 0x2ff: 0x0008, + // Block 0xc, offset 0x300 + 0x300: 0x0008, 0x301: 0x0008, 0x302: 0xe00f, 0x303: 0x0008, 0x304: 0x0008, 0x305: 0x0008, + 0x306: 0x0008, 0x307: 0x0008, 0x308: 0x0008, 0x309: 0x0008, 0x30a: 0x0008, 0x30b: 0x0008, + 0x30c: 0x0008, 0x30d: 0x0008, 0x30e: 0x0008, 0x30f: 0xe0c5, 0x310: 0x04b5, 0x311: 0x04cd, + 0x312: 0xe0bd, 0x313: 0xe0f5, 0x314: 0xe0fd, 0x315: 0xe09d, 0x316: 0xe0b5, 0x317: 0x0008, + 0x318: 0xe00d, 0x319: 0x0008, 0x31a: 0xe00d, 0x31b: 0x0008, 0x31c: 0xe00d, 0x31d: 0x0008, + 0x31e: 0xe00d, 0x31f: 0x0008, 0x320: 0xe00d, 0x321: 0x0008, 0x322: 0xe00d, 0x323: 0x0008, + 0x324: 0xe00d, 0x325: 0x0008, 0x326: 0xe00d, 0x327: 0x0008, 0x328: 0xe00d, 0x329: 0x0008, + 0x32a: 0xe00d, 0x32b: 0x0008, 0x32c: 0xe00d, 0x32d: 0x0008, 0x32e: 0xe00d, 0x32f: 0x0008, + 0x330: 0x04e5, 0x331: 0xe185, 0x332: 0xe18d, 0x333: 0x0008, 0x334: 0x04fd, 0x335: 0x03dd, + 0x336: 0x0018, 0x337: 0xe07d, 0x338: 0x0008, 0x339: 0xe1d5, 0x33a: 0xe00d, 0x33b: 0x0008, + 0x33c: 0x0008, 0x33d: 0x0515, 0x33e: 0x052d, 0x33f: 0x052d, + // Block 0xd, offset 0x340 + 0x340: 0x0008, 0x341: 0x0008, 0x342: 0x0008, 0x343: 0x0008, 0x344: 0x0008, 0x345: 0x0008, + 0x346: 0x0008, 0x347: 0x0008, 0x348: 0x0008, 0x349: 0x0008, 0x34a: 0x0008, 0x34b: 0x0008, + 0x34c: 0x0008, 0x34d: 0x0008, 0x34e: 0x0008, 0x34f: 0x0008, 0x350: 0x0008, 0x351: 0x0008, + 0x352: 0x0008, 0x353: 0x0008, 0x354: 0x0008, 0x355: 0x0008, 0x356: 0x0008, 0x357: 0x0008, + 0x358: 0x0008, 0x359: 0x0008, 0x35a: 0x0008, 0x35b: 0x0008, 0x35c: 0x0008, 0x35d: 0x0008, + 0x35e: 0x0008, 0x35f: 0x0008, 0x360: 0xe00d, 0x361: 0x0008, 0x362: 0xe00d, 0x363: 0x0008, + 0x364: 0xe00d, 0x365: 0x0008, 0x366: 0xe00d, 0x367: 0x0008, 0x368: 0xe00d, 0x369: 0x0008, + 0x36a: 0xe00d, 0x36b: 0x0008, 0x36c: 0xe00d, 0x36d: 0x0008, 0x36e: 0xe00d, 0x36f: 0x0008, + 0x370: 0xe00d, 0x371: 0x0008, 0x372: 0xe00d, 0x373: 0x0008, 0x374: 0xe00d, 0x375: 0x0008, + 0x376: 0xe00d, 0x377: 0x0008, 0x378: 0xe00d, 0x379: 0x0008, 0x37a: 0xe00d, 0x37b: 0x0008, + 0x37c: 0xe00d, 0x37d: 0x0008, 0x37e: 0xe00d, 0x37f: 0x0008, + // Block 0xe, offset 0x380 + 0x380: 0xe00d, 0x381: 0x0008, 0x382: 0x0018, 0x383: 0x1308, 0x384: 0x1308, 0x385: 0x1308, + 0x386: 0x1308, 0x387: 0x1308, 0x388: 0x1318, 0x389: 0x1318, 0x38a: 0xe00d, 0x38b: 0x0008, + 0x38c: 0xe00d, 0x38d: 0x0008, 0x38e: 0xe00d, 0x38f: 0x0008, 0x390: 0xe00d, 0x391: 0x0008, + 0x392: 0xe00d, 0x393: 0x0008, 0x394: 0xe00d, 0x395: 0x0008, 0x396: 0xe00d, 0x397: 0x0008, + 0x398: 0xe00d, 0x399: 0x0008, 0x39a: 0xe00d, 0x39b: 0x0008, 0x39c: 0xe00d, 0x39d: 0x0008, + 0x39e: 0xe00d, 0x39f: 0x0008, 0x3a0: 0xe00d, 0x3a1: 0x0008, 0x3a2: 0xe00d, 0x3a3: 0x0008, + 0x3a4: 0xe00d, 0x3a5: 0x0008, 0x3a6: 0xe00d, 0x3a7: 0x0008, 0x3a8: 0xe00d, 0x3a9: 0x0008, + 0x3aa: 0xe00d, 0x3ab: 0x0008, 0x3ac: 0xe00d, 0x3ad: 0x0008, 0x3ae: 0xe00d, 0x3af: 0x0008, + 0x3b0: 0xe00d, 0x3b1: 0x0008, 0x3b2: 0xe00d, 0x3b3: 0x0008, 0x3b4: 0xe00d, 0x3b5: 0x0008, + 0x3b6: 0xe00d, 0x3b7: 0x0008, 0x3b8: 0xe00d, 0x3b9: 0x0008, 0x3ba: 0xe00d, 0x3bb: 0x0008, + 0x3bc: 0xe00d, 0x3bd: 0x0008, 0x3be: 0xe00d, 0x3bf: 0x0008, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x0040, 0x3c1: 0xe01d, 0x3c2: 0x0008, 0x3c3: 0xe03d, 0x3c4: 0x0008, 0x3c5: 0xe01d, + 0x3c6: 0x0008, 0x3c7: 0xe07d, 0x3c8: 0x0008, 0x3c9: 0xe01d, 0x3ca: 0x0008, 0x3cb: 0xe03d, + 0x3cc: 0x0008, 0x3cd: 0xe01d, 0x3ce: 0x0008, 0x3cf: 0x0008, 0x3d0: 0xe00d, 0x3d1: 0x0008, + 0x3d2: 0xe00d, 0x3d3: 0x0008, 0x3d4: 0xe00d, 0x3d5: 0x0008, 0x3d6: 0xe00d, 0x3d7: 0x0008, + 0x3d8: 0xe00d, 0x3d9: 0x0008, 0x3da: 0xe00d, 0x3db: 0x0008, 0x3dc: 0xe00d, 0x3dd: 0x0008, + 0x3de: 0xe00d, 0x3df: 0x0008, 0x3e0: 0xe00d, 0x3e1: 0x0008, 0x3e2: 0xe00d, 0x3e3: 0x0008, + 0x3e4: 0xe00d, 0x3e5: 0x0008, 0x3e6: 0xe00d, 0x3e7: 0x0008, 0x3e8: 0xe00d, 0x3e9: 0x0008, + 0x3ea: 0xe00d, 0x3eb: 0x0008, 0x3ec: 0xe00d, 0x3ed: 0x0008, 0x3ee: 0xe00d, 0x3ef: 0x0008, + 0x3f0: 0xe00d, 0x3f1: 0x0008, 0x3f2: 0xe00d, 0x3f3: 0x0008, 0x3f4: 0xe00d, 0x3f5: 0x0008, + 0x3f6: 0xe00d, 0x3f7: 0x0008, 0x3f8: 0xe00d, 0x3f9: 0x0008, 0x3fa: 0xe00d, 0x3fb: 0x0008, + 0x3fc: 0xe00d, 0x3fd: 0x0008, 0x3fe: 0xe00d, 0x3ff: 0x0008, + // Block 0x10, offset 0x400 + 0x400: 0xe00d, 0x401: 0x0008, 0x402: 0xe00d, 0x403: 0x0008, 0x404: 0xe00d, 0x405: 0x0008, + 0x406: 0xe00d, 0x407: 0x0008, 0x408: 0xe00d, 0x409: 0x0008, 0x40a: 0xe00d, 0x40b: 0x0008, + 0x40c: 0xe00d, 0x40d: 0x0008, 0x40e: 0xe00d, 0x40f: 0x0008, 0x410: 0xe00d, 0x411: 0x0008, + 0x412: 0xe00d, 0x413: 0x0008, 0x414: 0xe00d, 0x415: 0x0008, 0x416: 0xe00d, 0x417: 0x0008, + 0x418: 0xe00d, 0x419: 0x0008, 0x41a: 0xe00d, 0x41b: 0x0008, 0x41c: 0xe00d, 0x41d: 0x0008, + 0x41e: 0xe00d, 0x41f: 0x0008, 0x420: 0xe00d, 0x421: 0x0008, 0x422: 0xe00d, 0x423: 0x0008, + 0x424: 0xe00d, 0x425: 0x0008, 0x426: 0xe00d, 0x427: 0x0008, 0x428: 0xe00d, 0x429: 0x0008, + 0x42a: 0xe00d, 0x42b: 0x0008, 0x42c: 0xe00d, 0x42d: 0x0008, 0x42e: 0xe00d, 0x42f: 0x0008, + 0x430: 0x0040, 0x431: 0x03f5, 0x432: 0x03f5, 0x433: 0x03f5, 0x434: 0x03f5, 0x435: 0x03f5, + 0x436: 0x03f5, 0x437: 0x03f5, 0x438: 0x03f5, 0x439: 0x03f5, 0x43a: 0x03f5, 0x43b: 0x03f5, + 0x43c: 0x03f5, 0x43d: 0x03f5, 0x43e: 0x03f5, 0x43f: 0x03f5, + // Block 0x11, offset 0x440 + 0x440: 0x0040, 0x441: 0x0040, 0x442: 0x0040, 0x443: 0x0040, 0x444: 0x0040, 0x445: 0x0040, + 0x446: 0x0018, 0x447: 0x0018, 0x448: 0x0018, 0x449: 0x0018, 0x44a: 0x0018, 0x44b: 0x0018, + 0x44c: 0x0018, 0x44d: 0x0018, 0x44e: 0x0018, 0x44f: 0x0018, 0x450: 0x1308, 0x451: 0x1308, + 0x452: 0x1308, 0x453: 0x1308, 0x454: 0x1308, 0x455: 0x1308, 0x456: 0x1308, 0x457: 0x1308, + 0x458: 0x1308, 0x459: 0x1308, 0x45a: 0x1308, 0x45b: 0x0018, 0x45c: 0x0340, 0x45d: 0x0040, + 0x45e: 0x0018, 0x45f: 0x0018, 0x460: 0x0208, 0x461: 0x0008, 0x462: 0x0408, 0x463: 0x0408, + 0x464: 0x0408, 0x465: 0x0408, 0x466: 0x0208, 0x467: 0x0408, 0x468: 0x0208, 0x469: 0x0408, + 0x46a: 0x0208, 0x46b: 0x0208, 0x46c: 0x0208, 0x46d: 0x0208, 0x46e: 0x0208, 0x46f: 0x0408, + 0x470: 0x0408, 0x471: 0x0408, 0x472: 0x0408, 0x473: 0x0208, 0x474: 0x0208, 0x475: 0x0208, + 0x476: 0x0208, 0x477: 0x0208, 0x478: 0x0208, 0x479: 0x0208, 0x47a: 0x0208, 0x47b: 0x0208, + 0x47c: 0x0208, 0x47d: 0x0208, 0x47e: 0x0208, 0x47f: 0x0208, + // Block 0x12, offset 0x480 + 0x480: 0x0408, 0x481: 0x0208, 0x482: 0x0208, 0x483: 0x0408, 0x484: 0x0408, 0x485: 0x0408, + 0x486: 0x0408, 0x487: 0x0408, 0x488: 0x0408, 0x489: 0x0408, 0x48a: 0x0408, 0x48b: 0x0408, + 0x48c: 0x0208, 0x48d: 0x0408, 0x48e: 0x0208, 0x48f: 0x0408, 0x490: 0x0208, 0x491: 0x0208, + 0x492: 0x0408, 0x493: 0x0408, 0x494: 0x0018, 0x495: 0x0408, 0x496: 0x1308, 0x497: 0x1308, + 0x498: 0x1308, 0x499: 0x1308, 0x49a: 0x1308, 0x49b: 0x1308, 0x49c: 0x1308, 0x49d: 0x0040, + 0x49e: 0x0018, 0x49f: 0x1308, 0x4a0: 0x1308, 0x4a1: 0x1308, 0x4a2: 0x1308, 0x4a3: 0x1308, + 0x4a4: 0x1308, 0x4a5: 0x0008, 0x4a6: 0x0008, 0x4a7: 0x1308, 0x4a8: 0x1308, 0x4a9: 0x0018, + 0x4aa: 0x1308, 0x4ab: 0x1308, 0x4ac: 0x1308, 0x4ad: 0x1308, 0x4ae: 0x0408, 0x4af: 0x0408, + 0x4b0: 0x0008, 0x4b1: 0x0008, 0x4b2: 0x0008, 0x4b3: 0x0008, 0x4b4: 0x0008, 0x4b5: 0x0008, + 0x4b6: 0x0008, 0x4b7: 0x0008, 0x4b8: 0x0008, 0x4b9: 0x0008, 0x4ba: 0x0208, 0x4bb: 0x0208, + 0x4bc: 0x0208, 0x4bd: 0x0008, 0x4be: 0x0008, 0x4bf: 0x0208, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x0018, 0x4c1: 0x0018, 0x4c2: 0x0018, 0x4c3: 0x0018, 0x4c4: 0x0018, 0x4c5: 0x0018, + 0x4c6: 0x0018, 0x4c7: 0x0018, 0x4c8: 0x0018, 0x4c9: 0x0018, 0x4ca: 0x0018, 0x4cb: 0x0018, + 0x4cc: 0x0018, 0x4cd: 0x0018, 0x4ce: 0x0040, 0x4cf: 0x0340, 0x4d0: 0x0408, 0x4d1: 0x1308, + 0x4d2: 0x0208, 0x4d3: 0x0208, 0x4d4: 0x0208, 0x4d5: 0x0408, 0x4d6: 0x0408, 0x4d7: 0x0408, + 0x4d8: 0x0408, 0x4d9: 0x0408, 0x4da: 0x0208, 0x4db: 0x0208, 0x4dc: 0x0208, 0x4dd: 0x0208, + 0x4de: 0x0408, 0x4df: 0x0208, 0x4e0: 0x0208, 0x4e1: 0x0208, 0x4e2: 0x0208, 0x4e3: 0x0208, + 0x4e4: 0x0208, 0x4e5: 0x0208, 0x4e6: 0x0208, 0x4e7: 0x0208, 0x4e8: 0x0408, 0x4e9: 0x0208, + 0x4ea: 0x0408, 0x4eb: 0x0208, 0x4ec: 0x0408, 0x4ed: 0x0208, 0x4ee: 0x0208, 0x4ef: 0x0408, + 0x4f0: 0x1308, 0x4f1: 0x1308, 0x4f2: 0x1308, 0x4f3: 0x1308, 0x4f4: 0x1308, 0x4f5: 0x1308, + 0x4f6: 0x1308, 0x4f7: 0x1308, 0x4f8: 0x1308, 0x4f9: 0x1308, 0x4fa: 0x1308, 0x4fb: 0x1308, + 0x4fc: 0x1308, 0x4fd: 0x1308, 0x4fe: 0x1308, 0x4ff: 0x1308, + // Block 0x14, offset 0x500 + 0x500: 0x1008, 0x501: 0x1308, 0x502: 0x1308, 0x503: 0x1308, 0x504: 0x1308, 0x505: 0x1308, + 0x506: 0x1308, 0x507: 0x1308, 0x508: 0x1308, 0x509: 0x1008, 0x50a: 0x1008, 0x50b: 0x1008, + 0x50c: 0x1008, 0x50d: 0x1b08, 0x50e: 0x1008, 0x50f: 0x1008, 0x510: 0x0008, 0x511: 0x1308, + 0x512: 0x1308, 0x513: 0x1308, 0x514: 0x1308, 0x515: 0x1308, 0x516: 0x1308, 0x517: 0x1308, + 0x518: 0x04c9, 0x519: 0x0501, 0x51a: 0x0539, 0x51b: 0x0571, 0x51c: 0x05a9, 0x51d: 0x05e1, + 0x51e: 0x0619, 0x51f: 0x0651, 0x520: 0x0008, 0x521: 0x0008, 0x522: 0x1308, 0x523: 0x1308, + 0x524: 0x0018, 0x525: 0x0018, 0x526: 0x0008, 0x527: 0x0008, 0x528: 0x0008, 0x529: 0x0008, + 0x52a: 0x0008, 0x52b: 0x0008, 0x52c: 0x0008, 0x52d: 0x0008, 0x52e: 0x0008, 0x52f: 0x0008, + 0x530: 0x0018, 0x531: 0x0008, 0x532: 0x0008, 0x533: 0x0008, 0x534: 0x0008, 0x535: 0x0008, + 0x536: 0x0008, 0x537: 0x0008, 0x538: 0x0008, 0x539: 0x0008, 0x53a: 0x0008, 0x53b: 0x0008, + 0x53c: 0x0008, 0x53d: 0x0008, 0x53e: 0x0008, 0x53f: 0x0008, + // Block 0x15, offset 0x540 + 0x540: 0x0008, 0x541: 0x1308, 0x542: 0x1008, 0x543: 0x1008, 0x544: 0x0040, 0x545: 0x0008, + 0x546: 0x0008, 0x547: 0x0008, 0x548: 0x0008, 0x549: 0x0008, 0x54a: 0x0008, 0x54b: 0x0008, + 0x54c: 0x0008, 0x54d: 0x0040, 0x54e: 0x0040, 0x54f: 0x0008, 0x550: 0x0008, 0x551: 0x0040, + 0x552: 0x0040, 0x553: 0x0008, 0x554: 0x0008, 0x555: 0x0008, 0x556: 0x0008, 0x557: 0x0008, + 0x558: 0x0008, 0x559: 0x0008, 0x55a: 0x0008, 0x55b: 0x0008, 0x55c: 0x0008, 0x55d: 0x0008, + 0x55e: 0x0008, 0x55f: 0x0008, 0x560: 0x0008, 0x561: 0x0008, 0x562: 0x0008, 0x563: 0x0008, + 0x564: 0x0008, 0x565: 0x0008, 0x566: 0x0008, 0x567: 0x0008, 0x568: 0x0008, 0x569: 0x0040, + 0x56a: 0x0008, 0x56b: 0x0008, 0x56c: 0x0008, 0x56d: 0x0008, 0x56e: 0x0008, 0x56f: 0x0008, + 0x570: 0x0008, 0x571: 0x0040, 0x572: 0x0008, 0x573: 0x0040, 0x574: 0x0040, 0x575: 0x0040, + 0x576: 0x0008, 0x577: 0x0008, 0x578: 0x0008, 0x579: 0x0008, 0x57a: 0x0040, 0x57b: 0x0040, + 0x57c: 0x1308, 0x57d: 0x0008, 0x57e: 0x1008, 0x57f: 0x1008, + // Block 0x16, offset 0x580 + 0x580: 0x1008, 0x581: 0x1308, 0x582: 0x1308, 0x583: 0x1308, 0x584: 0x1308, 0x585: 0x0040, + 0x586: 0x0040, 0x587: 0x1008, 0x588: 0x1008, 0x589: 0x0040, 0x58a: 0x0040, 0x58b: 0x1008, + 0x58c: 0x1008, 0x58d: 0x1b08, 0x58e: 0x0008, 0x58f: 0x0040, 0x590: 0x0040, 0x591: 0x0040, + 0x592: 0x0040, 0x593: 0x0040, 0x594: 0x0040, 0x595: 0x0040, 0x596: 0x0040, 0x597: 0x1008, + 0x598: 0x0040, 0x599: 0x0040, 0x59a: 0x0040, 0x59b: 0x0040, 0x59c: 0x0689, 0x59d: 0x06c1, + 0x59e: 0x0040, 0x59f: 0x06f9, 0x5a0: 0x0008, 0x5a1: 0x0008, 0x5a2: 0x1308, 0x5a3: 0x1308, + 0x5a4: 0x0040, 0x5a5: 0x0040, 0x5a6: 0x0008, 0x5a7: 0x0008, 0x5a8: 0x0008, 0x5a9: 0x0008, + 0x5aa: 0x0008, 0x5ab: 0x0008, 0x5ac: 0x0008, 0x5ad: 0x0008, 0x5ae: 0x0008, 0x5af: 0x0008, + 0x5b0: 0x0008, 0x5b1: 0x0008, 0x5b2: 0x0018, 0x5b3: 0x0018, 0x5b4: 0x0018, 0x5b5: 0x0018, + 0x5b6: 0x0018, 0x5b7: 0x0018, 0x5b8: 0x0018, 0x5b9: 0x0018, 0x5ba: 0x0018, 0x5bb: 0x0018, + 0x5bc: 0x0040, 0x5bd: 0x0040, 0x5be: 0x0040, 0x5bf: 0x0040, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x0040, 0x5c1: 0x1308, 0x5c2: 0x1308, 0x5c3: 0x1008, 0x5c4: 0x0040, 0x5c5: 0x0008, + 0x5c6: 0x0008, 0x5c7: 0x0008, 0x5c8: 0x0008, 0x5c9: 0x0008, 0x5ca: 0x0008, 0x5cb: 0x0040, + 0x5cc: 0x0040, 0x5cd: 0x0040, 0x5ce: 0x0040, 0x5cf: 0x0008, 0x5d0: 0x0008, 0x5d1: 0x0040, + 0x5d2: 0x0040, 0x5d3: 0x0008, 0x5d4: 0x0008, 0x5d5: 0x0008, 0x5d6: 0x0008, 0x5d7: 0x0008, + 0x5d8: 0x0008, 0x5d9: 0x0008, 0x5da: 0x0008, 0x5db: 0x0008, 0x5dc: 0x0008, 0x5dd: 0x0008, + 0x5de: 0x0008, 0x5df: 0x0008, 0x5e0: 0x0008, 0x5e1: 0x0008, 0x5e2: 0x0008, 0x5e3: 0x0008, + 0x5e4: 0x0008, 0x5e5: 0x0008, 0x5e6: 0x0008, 0x5e7: 0x0008, 0x5e8: 0x0008, 0x5e9: 0x0040, + 0x5ea: 0x0008, 0x5eb: 0x0008, 0x5ec: 0x0008, 0x5ed: 0x0008, 0x5ee: 0x0008, 0x5ef: 0x0008, + 0x5f0: 0x0008, 0x5f1: 0x0040, 0x5f2: 0x0008, 0x5f3: 0x0731, 0x5f4: 0x0040, 0x5f5: 0x0008, + 0x5f6: 0x0769, 0x5f7: 0x0040, 0x5f8: 0x0008, 0x5f9: 0x0008, 0x5fa: 0x0040, 0x5fb: 0x0040, + 0x5fc: 0x1308, 0x5fd: 0x0040, 0x5fe: 0x1008, 0x5ff: 0x1008, + // Block 0x18, offset 0x600 + 0x600: 0x1008, 0x601: 0x1308, 0x602: 0x1308, 0x603: 0x0040, 0x604: 0x0040, 0x605: 0x0040, + 0x606: 0x0040, 0x607: 0x1308, 0x608: 0x1308, 0x609: 0x0040, 0x60a: 0x0040, 0x60b: 0x1308, + 0x60c: 0x1308, 0x60d: 0x1b08, 0x60e: 0x0040, 0x60f: 0x0040, 0x610: 0x0040, 0x611: 0x1308, + 0x612: 0x0040, 0x613: 0x0040, 0x614: 0x0040, 0x615: 0x0040, 0x616: 0x0040, 0x617: 0x0040, + 0x618: 0x0040, 0x619: 0x07a1, 0x61a: 0x07d9, 0x61b: 0x0811, 0x61c: 0x0008, 0x61d: 0x0040, + 0x61e: 0x0849, 0x61f: 0x0040, 0x620: 0x0040, 0x621: 0x0040, 0x622: 0x0040, 0x623: 0x0040, + 0x624: 0x0040, 0x625: 0x0040, 0x626: 0x0008, 0x627: 0x0008, 0x628: 0x0008, 0x629: 0x0008, + 0x62a: 0x0008, 0x62b: 0x0008, 0x62c: 0x0008, 0x62d: 0x0008, 0x62e: 0x0008, 0x62f: 0x0008, + 0x630: 0x1308, 0x631: 0x1308, 0x632: 0x0008, 0x633: 0x0008, 0x634: 0x0008, 0x635: 0x1308, + 0x636: 0x0040, 0x637: 0x0040, 0x638: 0x0040, 0x639: 0x0040, 0x63a: 0x0040, 0x63b: 0x0040, + 0x63c: 0x0040, 0x63d: 0x0040, 0x63e: 0x0040, 0x63f: 0x0040, + // Block 0x19, offset 0x640 + 0x640: 0x0040, 0x641: 0x1308, 0x642: 0x1308, 0x643: 0x1008, 0x644: 0x0040, 0x645: 0x0008, + 0x646: 0x0008, 0x647: 0x0008, 0x648: 0x0008, 0x649: 0x0008, 0x64a: 0x0008, 0x64b: 0x0008, + 0x64c: 0x0008, 0x64d: 0x0008, 0x64e: 0x0040, 0x64f: 0x0008, 0x650: 0x0008, 0x651: 0x0008, + 0x652: 0x0040, 0x653: 0x0008, 0x654: 0x0008, 0x655: 0x0008, 0x656: 0x0008, 0x657: 0x0008, + 0x658: 0x0008, 0x659: 0x0008, 0x65a: 0x0008, 0x65b: 0x0008, 0x65c: 0x0008, 0x65d: 0x0008, + 0x65e: 0x0008, 0x65f: 0x0008, 0x660: 0x0008, 0x661: 0x0008, 0x662: 0x0008, 0x663: 0x0008, + 0x664: 0x0008, 0x665: 0x0008, 0x666: 0x0008, 0x667: 0x0008, 0x668: 0x0008, 0x669: 0x0040, + 0x66a: 0x0008, 0x66b: 0x0008, 0x66c: 0x0008, 0x66d: 0x0008, 0x66e: 0x0008, 0x66f: 0x0008, + 0x670: 0x0008, 0x671: 0x0040, 0x672: 0x0008, 0x673: 0x0008, 0x674: 0x0040, 0x675: 0x0008, + 0x676: 0x0008, 0x677: 0x0008, 0x678: 0x0008, 0x679: 0x0008, 0x67a: 0x0040, 0x67b: 0x0040, + 0x67c: 0x1308, 0x67d: 0x0008, 0x67e: 0x1008, 0x67f: 0x1008, + // Block 0x1a, offset 0x680 + 0x680: 0x1008, 0x681: 0x1308, 0x682: 0x1308, 0x683: 0x1308, 0x684: 0x1308, 0x685: 0x1308, + 0x686: 0x0040, 0x687: 0x1308, 0x688: 0x1308, 0x689: 0x1008, 0x68a: 0x0040, 0x68b: 0x1008, + 0x68c: 0x1008, 0x68d: 0x1b08, 0x68e: 0x0040, 0x68f: 0x0040, 0x690: 0x0008, 0x691: 0x0040, + 0x692: 0x0040, 0x693: 0x0040, 0x694: 0x0040, 0x695: 0x0040, 0x696: 0x0040, 0x697: 0x0040, + 0x698: 0x0040, 0x699: 0x0040, 0x69a: 0x0040, 0x69b: 0x0040, 0x69c: 0x0040, 0x69d: 0x0040, + 0x69e: 0x0040, 0x69f: 0x0040, 0x6a0: 0x0008, 0x6a1: 0x0008, 0x6a2: 0x1308, 0x6a3: 0x1308, + 0x6a4: 0x0040, 0x6a5: 0x0040, 0x6a6: 0x0008, 0x6a7: 0x0008, 0x6a8: 0x0008, 0x6a9: 0x0008, + 0x6aa: 0x0008, 0x6ab: 0x0008, 0x6ac: 0x0008, 0x6ad: 0x0008, 0x6ae: 0x0008, 0x6af: 0x0008, + 0x6b0: 0x0018, 0x6b1: 0x0018, 0x6b2: 0x0040, 0x6b3: 0x0040, 0x6b4: 0x0040, 0x6b5: 0x0040, + 0x6b6: 0x0040, 0x6b7: 0x0040, 0x6b8: 0x0040, 0x6b9: 0x0008, 0x6ba: 0x0040, 0x6bb: 0x0040, + 0x6bc: 0x0040, 0x6bd: 0x0040, 0x6be: 0x0040, 0x6bf: 0x0040, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x0040, 0x6c1: 0x1308, 0x6c2: 0x1008, 0x6c3: 0x1008, 0x6c4: 0x0040, 0x6c5: 0x0008, + 0x6c6: 0x0008, 0x6c7: 0x0008, 0x6c8: 0x0008, 0x6c9: 0x0008, 0x6ca: 0x0008, 0x6cb: 0x0008, + 0x6cc: 0x0008, 0x6cd: 0x0040, 0x6ce: 0x0040, 0x6cf: 0x0008, 0x6d0: 0x0008, 0x6d1: 0x0040, + 0x6d2: 0x0040, 0x6d3: 0x0008, 0x6d4: 0x0008, 0x6d5: 0x0008, 0x6d6: 0x0008, 0x6d7: 0x0008, + 0x6d8: 0x0008, 0x6d9: 0x0008, 0x6da: 0x0008, 0x6db: 0x0008, 0x6dc: 0x0008, 0x6dd: 0x0008, + 0x6de: 0x0008, 0x6df: 0x0008, 0x6e0: 0x0008, 0x6e1: 0x0008, 0x6e2: 0x0008, 0x6e3: 0x0008, + 0x6e4: 0x0008, 0x6e5: 0x0008, 0x6e6: 0x0008, 0x6e7: 0x0008, 0x6e8: 0x0008, 0x6e9: 0x0040, + 0x6ea: 0x0008, 0x6eb: 0x0008, 0x6ec: 0x0008, 0x6ed: 0x0008, 0x6ee: 0x0008, 0x6ef: 0x0008, + 0x6f0: 0x0008, 0x6f1: 0x0040, 0x6f2: 0x0008, 0x6f3: 0x0008, 0x6f4: 0x0040, 0x6f5: 0x0008, + 0x6f6: 0x0008, 0x6f7: 0x0008, 0x6f8: 0x0008, 0x6f9: 0x0008, 0x6fa: 0x0040, 0x6fb: 0x0040, + 0x6fc: 0x1308, 0x6fd: 0x0008, 0x6fe: 0x1008, 0x6ff: 0x1308, + // Block 0x1c, offset 0x700 + 0x700: 0x1008, 0x701: 0x1308, 0x702: 0x1308, 0x703: 0x1308, 0x704: 0x1308, 0x705: 0x0040, + 0x706: 0x0040, 0x707: 0x1008, 0x708: 0x1008, 0x709: 0x0040, 0x70a: 0x0040, 0x70b: 0x1008, + 0x70c: 0x1008, 0x70d: 0x1b08, 0x70e: 0x0040, 0x70f: 0x0040, 0x710: 0x0040, 0x711: 0x0040, + 0x712: 0x0040, 0x713: 0x0040, 0x714: 0x0040, 0x715: 0x0040, 0x716: 0x1308, 0x717: 0x1008, + 0x718: 0x0040, 0x719: 0x0040, 0x71a: 0x0040, 0x71b: 0x0040, 0x71c: 0x0881, 0x71d: 0x08b9, + 0x71e: 0x0040, 0x71f: 0x0008, 0x720: 0x0008, 0x721: 0x0008, 0x722: 0x1308, 0x723: 0x1308, + 0x724: 0x0040, 0x725: 0x0040, 0x726: 0x0008, 0x727: 0x0008, 0x728: 0x0008, 0x729: 0x0008, + 0x72a: 0x0008, 0x72b: 0x0008, 0x72c: 0x0008, 0x72d: 0x0008, 0x72e: 0x0008, 0x72f: 0x0008, + 0x730: 0x0018, 0x731: 0x0008, 0x732: 0x0018, 0x733: 0x0018, 0x734: 0x0018, 0x735: 0x0018, + 0x736: 0x0018, 0x737: 0x0018, 0x738: 0x0040, 0x739: 0x0040, 0x73a: 0x0040, 0x73b: 0x0040, + 0x73c: 0x0040, 0x73d: 0x0040, 0x73e: 0x0040, 0x73f: 0x0040, + // Block 0x1d, offset 0x740 + 0x740: 0x0040, 0x741: 0x0040, 0x742: 0x1308, 0x743: 0x0008, 0x744: 0x0040, 0x745: 0x0008, + 0x746: 0x0008, 0x747: 0x0008, 0x748: 0x0008, 0x749: 0x0008, 0x74a: 0x0008, 0x74b: 0x0040, + 0x74c: 0x0040, 0x74d: 0x0040, 0x74e: 0x0008, 0x74f: 0x0008, 0x750: 0x0008, 0x751: 0x0040, + 0x752: 0x0008, 0x753: 0x0008, 0x754: 0x0008, 0x755: 0x0008, 0x756: 0x0040, 0x757: 0x0040, + 0x758: 0x0040, 0x759: 0x0008, 0x75a: 0x0008, 0x75b: 0x0040, 0x75c: 0x0008, 0x75d: 0x0040, + 0x75e: 0x0008, 0x75f: 0x0008, 0x760: 0x0040, 0x761: 0x0040, 0x762: 0x0040, 0x763: 0x0008, + 0x764: 0x0008, 0x765: 0x0040, 0x766: 0x0040, 0x767: 0x0040, 0x768: 0x0008, 0x769: 0x0008, + 0x76a: 0x0008, 0x76b: 0x0040, 0x76c: 0x0040, 0x76d: 0x0040, 0x76e: 0x0008, 0x76f: 0x0008, + 0x770: 0x0008, 0x771: 0x0008, 0x772: 0x0008, 0x773: 0x0008, 0x774: 0x0008, 0x775: 0x0008, + 0x776: 0x0008, 0x777: 0x0008, 0x778: 0x0008, 0x779: 0x0008, 0x77a: 0x0040, 0x77b: 0x0040, + 0x77c: 0x0040, 0x77d: 0x0040, 0x77e: 0x1008, 0x77f: 0x1008, + // Block 0x1e, offset 0x780 + 0x780: 0x1308, 0x781: 0x1008, 0x782: 0x1008, 0x783: 0x1008, 0x784: 0x1008, 0x785: 0x0040, + 0x786: 0x1308, 0x787: 0x1308, 0x788: 0x1308, 0x789: 0x0040, 0x78a: 0x1308, 0x78b: 0x1308, + 0x78c: 0x1308, 0x78d: 0x1b08, 0x78e: 0x0040, 0x78f: 0x0040, 0x790: 0x0040, 0x791: 0x0040, + 0x792: 0x0040, 0x793: 0x0040, 0x794: 0x0040, 0x795: 0x1308, 0x796: 0x1308, 0x797: 0x0040, + 0x798: 0x0008, 0x799: 0x0008, 0x79a: 0x0008, 0x79b: 0x0040, 0x79c: 0x0040, 0x79d: 0x0040, + 0x79e: 0x0040, 0x79f: 0x0040, 0x7a0: 0x0008, 0x7a1: 0x0008, 0x7a2: 0x1308, 0x7a3: 0x1308, + 0x7a4: 0x0040, 0x7a5: 0x0040, 0x7a6: 0x0008, 0x7a7: 0x0008, 0x7a8: 0x0008, 0x7a9: 0x0008, + 0x7aa: 0x0008, 0x7ab: 0x0008, 0x7ac: 0x0008, 0x7ad: 0x0008, 0x7ae: 0x0008, 0x7af: 0x0008, + 0x7b0: 0x0040, 0x7b1: 0x0040, 0x7b2: 0x0040, 0x7b3: 0x0040, 0x7b4: 0x0040, 0x7b5: 0x0040, + 0x7b6: 0x0040, 0x7b7: 0x0040, 0x7b8: 0x0018, 0x7b9: 0x0018, 0x7ba: 0x0018, 0x7bb: 0x0018, + 0x7bc: 0x0018, 0x7bd: 0x0018, 0x7be: 0x0018, 0x7bf: 0x0018, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x0008, 0x7c1: 0x1308, 0x7c2: 0x1008, 0x7c3: 0x1008, 0x7c4: 0x0040, 0x7c5: 0x0008, + 0x7c6: 0x0008, 0x7c7: 0x0008, 0x7c8: 0x0008, 0x7c9: 0x0008, 0x7ca: 0x0008, 0x7cb: 0x0008, + 0x7cc: 0x0008, 0x7cd: 0x0040, 0x7ce: 0x0008, 0x7cf: 0x0008, 0x7d0: 0x0008, 0x7d1: 0x0040, + 0x7d2: 0x0008, 0x7d3: 0x0008, 0x7d4: 0x0008, 0x7d5: 0x0008, 0x7d6: 0x0008, 0x7d7: 0x0008, + 0x7d8: 0x0008, 0x7d9: 0x0008, 0x7da: 0x0008, 0x7db: 0x0008, 0x7dc: 0x0008, 0x7dd: 0x0008, + 0x7de: 0x0008, 0x7df: 0x0008, 0x7e0: 0x0008, 0x7e1: 0x0008, 0x7e2: 0x0008, 0x7e3: 0x0008, + 0x7e4: 0x0008, 0x7e5: 0x0008, 0x7e6: 0x0008, 0x7e7: 0x0008, 0x7e8: 0x0008, 0x7e9: 0x0040, + 0x7ea: 0x0008, 0x7eb: 0x0008, 0x7ec: 0x0008, 0x7ed: 0x0008, 0x7ee: 0x0008, 0x7ef: 0x0008, + 0x7f0: 0x0008, 0x7f1: 0x0008, 0x7f2: 0x0008, 0x7f3: 0x0008, 0x7f4: 0x0040, 0x7f5: 0x0008, + 0x7f6: 0x0008, 0x7f7: 0x0008, 0x7f8: 0x0008, 0x7f9: 0x0008, 0x7fa: 0x0040, 0x7fb: 0x0040, + 0x7fc: 0x1308, 0x7fd: 0x0008, 0x7fe: 0x1008, 0x7ff: 0x1308, + // Block 0x20, offset 0x800 + 0x800: 0x1008, 0x801: 0x1008, 0x802: 0x1008, 0x803: 0x1008, 0x804: 0x1008, 0x805: 0x0040, + 0x806: 0x1308, 0x807: 0x1008, 0x808: 0x1008, 0x809: 0x0040, 0x80a: 0x1008, 0x80b: 0x1008, + 0x80c: 0x1308, 0x80d: 0x1b08, 0x80e: 0x0040, 0x80f: 0x0040, 0x810: 0x0040, 0x811: 0x0040, + 0x812: 0x0040, 0x813: 0x0040, 0x814: 0x0040, 0x815: 0x1008, 0x816: 0x1008, 0x817: 0x0040, + 0x818: 0x0040, 0x819: 0x0040, 0x81a: 0x0040, 0x81b: 0x0040, 0x81c: 0x0040, 0x81d: 0x0040, + 0x81e: 0x0008, 0x81f: 0x0040, 0x820: 0x0008, 0x821: 0x0008, 0x822: 0x1308, 0x823: 0x1308, + 0x824: 0x0040, 0x825: 0x0040, 0x826: 0x0008, 0x827: 0x0008, 0x828: 0x0008, 0x829: 0x0008, + 0x82a: 0x0008, 0x82b: 0x0008, 0x82c: 0x0008, 0x82d: 0x0008, 0x82e: 0x0008, 0x82f: 0x0008, + 0x830: 0x0040, 0x831: 0x0008, 0x832: 0x0008, 0x833: 0x0040, 0x834: 0x0040, 0x835: 0x0040, + 0x836: 0x0040, 0x837: 0x0040, 0x838: 0x0040, 0x839: 0x0040, 0x83a: 0x0040, 0x83b: 0x0040, + 0x83c: 0x0040, 0x83d: 0x0040, 0x83e: 0x0040, 0x83f: 0x0040, + // Block 0x21, offset 0x840 + 0x840: 0x1008, 0x841: 0x1308, 0x842: 0x1308, 0x843: 0x1308, 0x844: 0x1308, 0x845: 0x0040, + 0x846: 0x1008, 0x847: 0x1008, 0x848: 0x1008, 0x849: 0x0040, 0x84a: 0x1008, 0x84b: 0x1008, + 0x84c: 0x1008, 0x84d: 0x1b08, 0x84e: 0x0008, 0x84f: 0x0018, 0x850: 0x0040, 0x851: 0x0040, + 0x852: 0x0040, 0x853: 0x0040, 0x854: 0x0008, 0x855: 0x0008, 0x856: 0x0008, 0x857: 0x1008, + 0x858: 0x0018, 0x859: 0x0018, 0x85a: 0x0018, 0x85b: 0x0018, 0x85c: 0x0018, 0x85d: 0x0018, + 0x85e: 0x0018, 0x85f: 0x0008, 0x860: 0x0008, 0x861: 0x0008, 0x862: 0x1308, 0x863: 0x1308, + 0x864: 0x0040, 0x865: 0x0040, 0x866: 0x0008, 0x867: 0x0008, 0x868: 0x0008, 0x869: 0x0008, + 0x86a: 0x0008, 0x86b: 0x0008, 0x86c: 0x0008, 0x86d: 0x0008, 0x86e: 0x0008, 0x86f: 0x0008, + 0x870: 0x0018, 0x871: 0x0018, 0x872: 0x0018, 0x873: 0x0018, 0x874: 0x0018, 0x875: 0x0018, + 0x876: 0x0018, 0x877: 0x0018, 0x878: 0x0018, 0x879: 0x0018, 0x87a: 0x0008, 0x87b: 0x0008, + 0x87c: 0x0008, 0x87d: 0x0008, 0x87e: 0x0008, 0x87f: 0x0008, + // Block 0x22, offset 0x880 + 0x880: 0x0040, 0x881: 0x0008, 0x882: 0x0008, 0x883: 0x0040, 0x884: 0x0008, 0x885: 0x0040, + 0x886: 0x0040, 0x887: 0x0008, 0x888: 0x0008, 0x889: 0x0040, 0x88a: 0x0008, 0x88b: 0x0040, + 0x88c: 0x0040, 0x88d: 0x0008, 0x88e: 0x0040, 0x88f: 0x0040, 0x890: 0x0040, 0x891: 0x0040, + 0x892: 0x0040, 0x893: 0x0040, 0x894: 0x0008, 0x895: 0x0008, 0x896: 0x0008, 0x897: 0x0008, + 0x898: 0x0040, 0x899: 0x0008, 0x89a: 0x0008, 0x89b: 0x0008, 0x89c: 0x0008, 0x89d: 0x0008, + 0x89e: 0x0008, 0x89f: 0x0008, 0x8a0: 0x0040, 0x8a1: 0x0008, 0x8a2: 0x0008, 0x8a3: 0x0008, + 0x8a4: 0x0040, 0x8a5: 0x0008, 0x8a6: 0x0040, 0x8a7: 0x0008, 0x8a8: 0x0040, 0x8a9: 0x0040, + 0x8aa: 0x0008, 0x8ab: 0x0008, 0x8ac: 0x0040, 0x8ad: 0x0008, 0x8ae: 0x0008, 0x8af: 0x0008, + 0x8b0: 0x0008, 0x8b1: 0x1308, 0x8b2: 0x0008, 0x8b3: 0x0929, 0x8b4: 0x1308, 0x8b5: 0x1308, + 0x8b6: 0x1308, 0x8b7: 0x1308, 0x8b8: 0x1308, 0x8b9: 0x1308, 0x8ba: 0x0040, 0x8bb: 0x1308, + 0x8bc: 0x1308, 0x8bd: 0x0008, 0x8be: 0x0040, 0x8bf: 0x0040, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x0008, 0x8c1: 0x0008, 0x8c2: 0x0008, 0x8c3: 0x09d1, 0x8c4: 0x0008, 0x8c5: 0x0008, + 0x8c6: 0x0008, 0x8c7: 0x0008, 0x8c8: 0x0040, 0x8c9: 0x0008, 0x8ca: 0x0008, 0x8cb: 0x0008, + 0x8cc: 0x0008, 0x8cd: 0x0a09, 0x8ce: 0x0008, 0x8cf: 0x0008, 0x8d0: 0x0008, 0x8d1: 0x0008, + 0x8d2: 0x0a41, 0x8d3: 0x0008, 0x8d4: 0x0008, 0x8d5: 0x0008, 0x8d6: 0x0008, 0x8d7: 0x0a79, + 0x8d8: 0x0008, 0x8d9: 0x0008, 0x8da: 0x0008, 0x8db: 0x0008, 0x8dc: 0x0ab1, 0x8dd: 0x0008, + 0x8de: 0x0008, 0x8df: 0x0008, 0x8e0: 0x0008, 0x8e1: 0x0008, 0x8e2: 0x0008, 0x8e3: 0x0008, + 0x8e4: 0x0008, 0x8e5: 0x0008, 0x8e6: 0x0008, 0x8e7: 0x0008, 0x8e8: 0x0008, 0x8e9: 0x0ae9, + 0x8ea: 0x0008, 0x8eb: 0x0008, 0x8ec: 0x0008, 0x8ed: 0x0040, 0x8ee: 0x0040, 0x8ef: 0x0040, + 0x8f0: 0x0040, 0x8f1: 0x1308, 0x8f2: 0x1308, 0x8f3: 0x0b21, 0x8f4: 0x1308, 0x8f5: 0x0b59, + 0x8f6: 0x0b91, 0x8f7: 0x0bc9, 0x8f8: 0x0c19, 0x8f9: 0x0c51, 0x8fa: 0x1308, 0x8fb: 0x1308, + 0x8fc: 0x1308, 0x8fd: 0x1308, 0x8fe: 0x1308, 0x8ff: 0x1008, + // Block 0x24, offset 0x900 + 0x900: 0x1308, 0x901: 0x0ca1, 0x902: 0x1308, 0x903: 0x1308, 0x904: 0x1b08, 0x905: 0x0018, + 0x906: 0x1308, 0x907: 0x1308, 0x908: 0x0008, 0x909: 0x0008, 0x90a: 0x0008, 0x90b: 0x0008, + 0x90c: 0x0008, 0x90d: 0x1308, 0x90e: 0x1308, 0x90f: 0x1308, 0x910: 0x1308, 0x911: 0x1308, + 0x912: 0x1308, 0x913: 0x0cd9, 0x914: 0x1308, 0x915: 0x1308, 0x916: 0x1308, 0x917: 0x1308, + 0x918: 0x0040, 0x919: 0x1308, 0x91a: 0x1308, 0x91b: 0x1308, 0x91c: 0x1308, 0x91d: 0x0d11, + 0x91e: 0x1308, 0x91f: 0x1308, 0x920: 0x1308, 0x921: 0x1308, 0x922: 0x0d49, 0x923: 0x1308, + 0x924: 0x1308, 0x925: 0x1308, 0x926: 0x1308, 0x927: 0x0d81, 0x928: 0x1308, 0x929: 0x1308, + 0x92a: 0x1308, 0x92b: 0x1308, 0x92c: 0x0db9, 0x92d: 0x1308, 0x92e: 0x1308, 0x92f: 0x1308, + 0x930: 0x1308, 0x931: 0x1308, 0x932: 0x1308, 0x933: 0x1308, 0x934: 0x1308, 0x935: 0x1308, + 0x936: 0x1308, 0x937: 0x1308, 0x938: 0x1308, 0x939: 0x0df1, 0x93a: 0x1308, 0x93b: 0x1308, + 0x93c: 0x1308, 0x93d: 0x0040, 0x93e: 0x0018, 0x93f: 0x0018, + // Block 0x25, offset 0x940 + 0x940: 0x0008, 0x941: 0x0008, 0x942: 0x0008, 0x943: 0x0008, 0x944: 0x0008, 0x945: 0x0008, + 0x946: 0x0008, 0x947: 0x0008, 0x948: 0x0008, 0x949: 0x0008, 0x94a: 0x0008, 0x94b: 0x0008, + 0x94c: 0x0008, 0x94d: 0x0008, 0x94e: 0x0008, 0x94f: 0x0008, 0x950: 0x0008, 0x951: 0x0008, + 0x952: 0x0008, 0x953: 0x0008, 0x954: 0x0008, 0x955: 0x0008, 0x956: 0x0008, 0x957: 0x0008, + 0x958: 0x0008, 0x959: 0x0008, 0x95a: 0x0008, 0x95b: 0x0008, 0x95c: 0x0008, 0x95d: 0x0008, + 0x95e: 0x0008, 0x95f: 0x0008, 0x960: 0x0008, 0x961: 0x0008, 0x962: 0x0008, 0x963: 0x0008, + 0x964: 0x0008, 0x965: 0x0008, 0x966: 0x0008, 0x967: 0x0008, 0x968: 0x0008, 0x969: 0x0008, + 0x96a: 0x0008, 0x96b: 0x0008, 0x96c: 0x0039, 0x96d: 0x0ed1, 0x96e: 0x0ee9, 0x96f: 0x0008, + 0x970: 0x0ef9, 0x971: 0x0f09, 0x972: 0x0f19, 0x973: 0x0f31, 0x974: 0x0249, 0x975: 0x0f41, + 0x976: 0x0259, 0x977: 0x0f51, 0x978: 0x0359, 0x979: 0x0f61, 0x97a: 0x0f71, 0x97b: 0x0008, + 0x97c: 0x00d9, 0x97d: 0x0f81, 0x97e: 0x0f99, 0x97f: 0x0269, + // Block 0x26, offset 0x980 + 0x980: 0x0fa9, 0x981: 0x0fb9, 0x982: 0x0279, 0x983: 0x0039, 0x984: 0x0fc9, 0x985: 0x0fe1, + 0x986: 0x059d, 0x987: 0x0ee9, 0x988: 0x0ef9, 0x989: 0x0f09, 0x98a: 0x0ff9, 0x98b: 0x1011, + 0x98c: 0x1029, 0x98d: 0x0f31, 0x98e: 0x0008, 0x98f: 0x0f51, 0x990: 0x0f61, 0x991: 0x1041, + 0x992: 0x00d9, 0x993: 0x1059, 0x994: 0x05b5, 0x995: 0x05b5, 0x996: 0x0f99, 0x997: 0x0fa9, + 0x998: 0x0fb9, 0x999: 0x059d, 0x99a: 0x1071, 0x99b: 0x1089, 0x99c: 0x05cd, 0x99d: 0x1099, + 0x99e: 0x10b1, 0x99f: 0x10c9, 0x9a0: 0x10e1, 0x9a1: 0x10f9, 0x9a2: 0x0f41, 0x9a3: 0x0269, + 0x9a4: 0x0fb9, 0x9a5: 0x1089, 0x9a6: 0x1099, 0x9a7: 0x10b1, 0x9a8: 0x1111, 0x9a9: 0x10e1, + 0x9aa: 0x10f9, 0x9ab: 0x0008, 0x9ac: 0x0008, 0x9ad: 0x0008, 0x9ae: 0x0008, 0x9af: 0x0008, + 0x9b0: 0x0008, 0x9b1: 0x0008, 0x9b2: 0x0008, 0x9b3: 0x0008, 0x9b4: 0x0008, 0x9b5: 0x0008, + 0x9b6: 0x0008, 0x9b7: 0x0008, 0x9b8: 0x1129, 0x9b9: 0x0008, 0x9ba: 0x0008, 0x9bb: 0x0008, + 0x9bc: 0x0008, 0x9bd: 0x0008, 0x9be: 0x0008, 0x9bf: 0x0008, + // Block 0x27, offset 0x9c0 + 0x9c0: 0x0008, 0x9c1: 0x0008, 0x9c2: 0x0008, 0x9c3: 0x0008, 0x9c4: 0x0008, 0x9c5: 0x0008, + 0x9c6: 0x0008, 0x9c7: 0x0008, 0x9c8: 0x0008, 0x9c9: 0x0008, 0x9ca: 0x0008, 0x9cb: 0x0008, + 0x9cc: 0x0008, 0x9cd: 0x0008, 0x9ce: 0x0008, 0x9cf: 0x0008, 0x9d0: 0x0008, 0x9d1: 0x0008, + 0x9d2: 0x0008, 0x9d3: 0x0008, 0x9d4: 0x0008, 0x9d5: 0x0008, 0x9d6: 0x0008, 0x9d7: 0x0008, + 0x9d8: 0x0008, 0x9d9: 0x0008, 0x9da: 0x0008, 0x9db: 0x1141, 0x9dc: 0x1159, 0x9dd: 0x1169, + 0x9de: 0x1181, 0x9df: 0x1029, 0x9e0: 0x1199, 0x9e1: 0x11a9, 0x9e2: 0x11c1, 0x9e3: 0x11d9, + 0x9e4: 0x11f1, 0x9e5: 0x1209, 0x9e6: 0x1221, 0x9e7: 0x05e5, 0x9e8: 0x1239, 0x9e9: 0x1251, + 0x9ea: 0xe17d, 0x9eb: 0x1269, 0x9ec: 0x1281, 0x9ed: 0x1299, 0x9ee: 0x12b1, 0x9ef: 0x12c9, + 0x9f0: 0x12e1, 0x9f1: 0x12f9, 0x9f2: 0x1311, 0x9f3: 0x1329, 0x9f4: 0x1341, 0x9f5: 0x1359, + 0x9f6: 0x1371, 0x9f7: 0x1389, 0x9f8: 0x05fd, 0x9f9: 0x13a1, 0x9fa: 0x13b9, 0x9fb: 0x13d1, + 0x9fc: 0x13e1, 0x9fd: 0x13f9, 0x9fe: 0x1411, 0x9ff: 0x1429, + // Block 0x28, offset 0xa00 + 0xa00: 0xe00d, 0xa01: 0x0008, 0xa02: 0xe00d, 0xa03: 0x0008, 0xa04: 0xe00d, 0xa05: 0x0008, + 0xa06: 0xe00d, 0xa07: 0x0008, 0xa08: 0xe00d, 0xa09: 0x0008, 0xa0a: 0xe00d, 0xa0b: 0x0008, + 0xa0c: 0xe00d, 0xa0d: 0x0008, 0xa0e: 0xe00d, 0xa0f: 0x0008, 0xa10: 0xe00d, 0xa11: 0x0008, + 0xa12: 0xe00d, 0xa13: 0x0008, 0xa14: 0xe00d, 0xa15: 0x0008, 0xa16: 0xe00d, 0xa17: 0x0008, + 0xa18: 0xe00d, 0xa19: 0x0008, 0xa1a: 0xe00d, 0xa1b: 0x0008, 0xa1c: 0xe00d, 0xa1d: 0x0008, + 0xa1e: 0xe00d, 0xa1f: 0x0008, 0xa20: 0xe00d, 0xa21: 0x0008, 0xa22: 0xe00d, 0xa23: 0x0008, + 0xa24: 0xe00d, 0xa25: 0x0008, 0xa26: 0xe00d, 0xa27: 0x0008, 0xa28: 0xe00d, 0xa29: 0x0008, + 0xa2a: 0xe00d, 0xa2b: 0x0008, 0xa2c: 0xe00d, 0xa2d: 0x0008, 0xa2e: 0xe00d, 0xa2f: 0x0008, + 0xa30: 0xe00d, 0xa31: 0x0008, 0xa32: 0xe00d, 0xa33: 0x0008, 0xa34: 0xe00d, 0xa35: 0x0008, + 0xa36: 0xe00d, 0xa37: 0x0008, 0xa38: 0xe00d, 0xa39: 0x0008, 0xa3a: 0xe00d, 0xa3b: 0x0008, + 0xa3c: 0xe00d, 0xa3d: 0x0008, 0xa3e: 0xe00d, 0xa3f: 0x0008, + // Block 0x29, offset 0xa40 + 0xa40: 0xe00d, 0xa41: 0x0008, 0xa42: 0xe00d, 0xa43: 0x0008, 0xa44: 0xe00d, 0xa45: 0x0008, + 0xa46: 0xe00d, 0xa47: 0x0008, 0xa48: 0xe00d, 0xa49: 0x0008, 0xa4a: 0xe00d, 0xa4b: 0x0008, + 0xa4c: 0xe00d, 0xa4d: 0x0008, 0xa4e: 0xe00d, 0xa4f: 0x0008, 0xa50: 0xe00d, 0xa51: 0x0008, + 0xa52: 0xe00d, 0xa53: 0x0008, 0xa54: 0xe00d, 0xa55: 0x0008, 0xa56: 0x0008, 0xa57: 0x0008, + 0xa58: 0x0008, 0xa59: 0x0008, 0xa5a: 0x0615, 0xa5b: 0x0635, 0xa5c: 0x0008, 0xa5d: 0x0008, + 0xa5e: 0x1441, 0xa5f: 0x0008, 0xa60: 0xe00d, 0xa61: 0x0008, 0xa62: 0xe00d, 0xa63: 0x0008, + 0xa64: 0xe00d, 0xa65: 0x0008, 0xa66: 0xe00d, 0xa67: 0x0008, 0xa68: 0xe00d, 0xa69: 0x0008, + 0xa6a: 0xe00d, 0xa6b: 0x0008, 0xa6c: 0xe00d, 0xa6d: 0x0008, 0xa6e: 0xe00d, 0xa6f: 0x0008, + 0xa70: 0xe00d, 0xa71: 0x0008, 0xa72: 0xe00d, 0xa73: 0x0008, 0xa74: 0xe00d, 0xa75: 0x0008, + 0xa76: 0xe00d, 0xa77: 0x0008, 0xa78: 0xe00d, 0xa79: 0x0008, 0xa7a: 0xe00d, 0xa7b: 0x0008, + 0xa7c: 0xe00d, 0xa7d: 0x0008, 0xa7e: 0xe00d, 0xa7f: 0x0008, + // Block 0x2a, offset 0xa80 + 0xa80: 0x0008, 0xa81: 0x0008, 0xa82: 0x0008, 0xa83: 0x0008, 0xa84: 0x0008, 0xa85: 0x0008, + 0xa86: 0x0040, 0xa87: 0x0040, 0xa88: 0xe045, 0xa89: 0xe045, 0xa8a: 0xe045, 0xa8b: 0xe045, + 0xa8c: 0xe045, 0xa8d: 0xe045, 0xa8e: 0x0040, 0xa8f: 0x0040, 0xa90: 0x0008, 0xa91: 0x0008, + 0xa92: 0x0008, 0xa93: 0x0008, 0xa94: 0x0008, 0xa95: 0x0008, 0xa96: 0x0008, 0xa97: 0x0008, + 0xa98: 0x0040, 0xa99: 0xe045, 0xa9a: 0x0040, 0xa9b: 0xe045, 0xa9c: 0x0040, 0xa9d: 0xe045, + 0xa9e: 0x0040, 0xa9f: 0xe045, 0xaa0: 0x0008, 0xaa1: 0x0008, 0xaa2: 0x0008, 0xaa3: 0x0008, + 0xaa4: 0x0008, 0xaa5: 0x0008, 0xaa6: 0x0008, 0xaa7: 0x0008, 0xaa8: 0xe045, 0xaa9: 0xe045, + 0xaaa: 0xe045, 0xaab: 0xe045, 0xaac: 0xe045, 0xaad: 0xe045, 0xaae: 0xe045, 0xaaf: 0xe045, + 0xab0: 0x0008, 0xab1: 0x1459, 0xab2: 0x0008, 0xab3: 0x1471, 0xab4: 0x0008, 0xab5: 0x1489, + 0xab6: 0x0008, 0xab7: 0x14a1, 0xab8: 0x0008, 0xab9: 0x14b9, 0xaba: 0x0008, 0xabb: 0x14d1, + 0xabc: 0x0008, 0xabd: 0x14e9, 0xabe: 0x0040, 0xabf: 0x0040, + // Block 0x2b, offset 0xac0 + 0xac0: 0x1501, 0xac1: 0x1531, 0xac2: 0x1561, 0xac3: 0x1591, 0xac4: 0x15c1, 0xac5: 0x15f1, + 0xac6: 0x1621, 0xac7: 0x1651, 0xac8: 0x1501, 0xac9: 0x1531, 0xaca: 0x1561, 0xacb: 0x1591, + 0xacc: 0x15c1, 0xacd: 0x15f1, 0xace: 0x1621, 0xacf: 0x1651, 0xad0: 0x1681, 0xad1: 0x16b1, + 0xad2: 0x16e1, 0xad3: 0x1711, 0xad4: 0x1741, 0xad5: 0x1771, 0xad6: 0x17a1, 0xad7: 0x17d1, + 0xad8: 0x1681, 0xad9: 0x16b1, 0xada: 0x16e1, 0xadb: 0x1711, 0xadc: 0x1741, 0xadd: 0x1771, + 0xade: 0x17a1, 0xadf: 0x17d1, 0xae0: 0x1801, 0xae1: 0x1831, 0xae2: 0x1861, 0xae3: 0x1891, + 0xae4: 0x18c1, 0xae5: 0x18f1, 0xae6: 0x1921, 0xae7: 0x1951, 0xae8: 0x1801, 0xae9: 0x1831, + 0xaea: 0x1861, 0xaeb: 0x1891, 0xaec: 0x18c1, 0xaed: 0x18f1, 0xaee: 0x1921, 0xaef: 0x1951, + 0xaf0: 0x0008, 0xaf1: 0x0008, 0xaf2: 0x1981, 0xaf3: 0x19b1, 0xaf4: 0x19d9, 0xaf5: 0x0040, + 0xaf6: 0x0008, 0xaf7: 0x1a01, 0xaf8: 0xe045, 0xaf9: 0xe045, 0xafa: 0x064d, 0xafb: 0x1459, + 0xafc: 0x19b1, 0xafd: 0x0666, 0xafe: 0x1a31, 0xaff: 0x0686, + // Block 0x2c, offset 0xb00 + 0xb00: 0x06a6, 0xb01: 0x1a4a, 0xb02: 0x1a79, 0xb03: 0x1aa9, 0xb04: 0x1ad1, 0xb05: 0x0040, + 0xb06: 0x0008, 0xb07: 0x1af9, 0xb08: 0x06c5, 0xb09: 0x1471, 0xb0a: 0x06dd, 0xb0b: 0x1489, + 0xb0c: 0x1aa9, 0xb0d: 0x1b2a, 0xb0e: 0x1b5a, 0xb0f: 0x1b8a, 0xb10: 0x0008, 0xb11: 0x0008, + 0xb12: 0x0008, 0xb13: 0x1bb9, 0xb14: 0x0040, 0xb15: 0x0040, 0xb16: 0x0008, 0xb17: 0x0008, + 0xb18: 0xe045, 0xb19: 0xe045, 0xb1a: 0x06f5, 0xb1b: 0x14a1, 0xb1c: 0x0040, 0xb1d: 0x1bd2, + 0xb1e: 0x1c02, 0xb1f: 0x1c32, 0xb20: 0x0008, 0xb21: 0x0008, 0xb22: 0x0008, 0xb23: 0x1c61, + 0xb24: 0x0008, 0xb25: 0x0008, 0xb26: 0x0008, 0xb27: 0x0008, 0xb28: 0xe045, 0xb29: 0xe045, + 0xb2a: 0x070d, 0xb2b: 0x14d1, 0xb2c: 0xe04d, 0xb2d: 0x1c7a, 0xb2e: 0x03d2, 0xb2f: 0x1caa, + 0xb30: 0x0040, 0xb31: 0x0040, 0xb32: 0x1cb9, 0xb33: 0x1ce9, 0xb34: 0x1d11, 0xb35: 0x0040, + 0xb36: 0x0008, 0xb37: 0x1d39, 0xb38: 0x0725, 0xb39: 0x14b9, 0xb3a: 0x0515, 0xb3b: 0x14e9, + 0xb3c: 0x1ce9, 0xb3d: 0x073e, 0xb3e: 0x075e, 0xb3f: 0x0040, + // Block 0x2d, offset 0xb40 + 0xb40: 0x000a, 0xb41: 0x000a, 0xb42: 0x000a, 0xb43: 0x000a, 0xb44: 0x000a, 0xb45: 0x000a, + 0xb46: 0x000a, 0xb47: 0x000a, 0xb48: 0x000a, 0xb49: 0x000a, 0xb4a: 0x000a, 0xb4b: 0x03c0, + 0xb4c: 0x0003, 0xb4d: 0x0003, 0xb4e: 0x0340, 0xb4f: 0x0340, 0xb50: 0x0018, 0xb51: 0xe00d, + 0xb52: 0x0018, 0xb53: 0x0018, 0xb54: 0x0018, 0xb55: 0x0018, 0xb56: 0x0018, 0xb57: 0x077e, + 0xb58: 0x0018, 0xb59: 0x0018, 0xb5a: 0x0018, 0xb5b: 0x0018, 0xb5c: 0x0018, 0xb5d: 0x0018, + 0xb5e: 0x0018, 0xb5f: 0x0018, 0xb60: 0x0018, 0xb61: 0x0018, 0xb62: 0x0018, 0xb63: 0x0018, + 0xb64: 0x0040, 0xb65: 0x0040, 0xb66: 0x0040, 0xb67: 0x0018, 0xb68: 0x0040, 0xb69: 0x0040, + 0xb6a: 0x0340, 0xb6b: 0x0340, 0xb6c: 0x0340, 0xb6d: 0x0340, 0xb6e: 0x0340, 0xb6f: 0x000a, + 0xb70: 0x0018, 0xb71: 0x0018, 0xb72: 0x0018, 0xb73: 0x1d69, 0xb74: 0x1da1, 0xb75: 0x0018, + 0xb76: 0x1df1, 0xb77: 0x1e29, 0xb78: 0x0018, 0xb79: 0x0018, 0xb7a: 0x0018, 0xb7b: 0x0018, + 0xb7c: 0x1e7a, 0xb7d: 0x0018, 0xb7e: 0x079e, 0xb7f: 0x0018, + // Block 0x2e, offset 0xb80 + 0xb80: 0x0018, 0xb81: 0x0018, 0xb82: 0x0018, 0xb83: 0x0018, 0xb84: 0x0018, 0xb85: 0x0018, + 0xb86: 0x0018, 0xb87: 0x1e92, 0xb88: 0x1eaa, 0xb89: 0x1ec2, 0xb8a: 0x0018, 0xb8b: 0x0018, + 0xb8c: 0x0018, 0xb8d: 0x0018, 0xb8e: 0x0018, 0xb8f: 0x0018, 0xb90: 0x0018, 0xb91: 0x0018, + 0xb92: 0x0018, 0xb93: 0x0018, 0xb94: 0x0018, 0xb95: 0x0018, 0xb96: 0x0018, 0xb97: 0x1ed9, + 0xb98: 0x0018, 0xb99: 0x0018, 0xb9a: 0x0018, 0xb9b: 0x0018, 0xb9c: 0x0018, 0xb9d: 0x0018, + 0xb9e: 0x0018, 0xb9f: 0x000a, 0xba0: 0x03c0, 0xba1: 0x0340, 0xba2: 0x0340, 0xba3: 0x0340, + 0xba4: 0x03c0, 0xba5: 0x0040, 0xba6: 0x0040, 0xba7: 0x0040, 0xba8: 0x0040, 0xba9: 0x0040, + 0xbaa: 0x0340, 0xbab: 0x0340, 0xbac: 0x0340, 0xbad: 0x0340, 0xbae: 0x0340, 0xbaf: 0x0340, + 0xbb0: 0x1f41, 0xbb1: 0x0f41, 0xbb2: 0x0040, 0xbb3: 0x0040, 0xbb4: 0x1f51, 0xbb5: 0x1f61, + 0xbb6: 0x1f71, 0xbb7: 0x1f81, 0xbb8: 0x1f91, 0xbb9: 0x1fa1, 0xbba: 0x1fb2, 0xbbb: 0x07bd, + 0xbbc: 0x1fc2, 0xbbd: 0x1fd2, 0xbbe: 0x1fe2, 0xbbf: 0x0f71, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x1f41, 0xbc1: 0x00c9, 0xbc2: 0x0069, 0xbc3: 0x0079, 0xbc4: 0x1f51, 0xbc5: 0x1f61, + 0xbc6: 0x1f71, 0xbc7: 0x1f81, 0xbc8: 0x1f91, 0xbc9: 0x1fa1, 0xbca: 0x1fb2, 0xbcb: 0x07d5, + 0xbcc: 0x1fc2, 0xbcd: 0x1fd2, 0xbce: 0x1fe2, 0xbcf: 0x0040, 0xbd0: 0x0039, 0xbd1: 0x0f09, + 0xbd2: 0x00d9, 0xbd3: 0x0369, 0xbd4: 0x0ff9, 0xbd5: 0x0249, 0xbd6: 0x0f51, 0xbd7: 0x0359, + 0xbd8: 0x0f61, 0xbd9: 0x0f71, 0xbda: 0x0f99, 0xbdb: 0x01d9, 0xbdc: 0x0fa9, 0xbdd: 0x0040, + 0xbde: 0x0040, 0xbdf: 0x0040, 0xbe0: 0x0018, 0xbe1: 0x0018, 0xbe2: 0x0018, 0xbe3: 0x0018, + 0xbe4: 0x0018, 0xbe5: 0x0018, 0xbe6: 0x0018, 0xbe7: 0x0018, 0xbe8: 0x1ff1, 0xbe9: 0x0018, + 0xbea: 0x0018, 0xbeb: 0x0018, 0xbec: 0x0018, 0xbed: 0x0018, 0xbee: 0x0018, 0xbef: 0x0018, + 0xbf0: 0x0018, 0xbf1: 0x0018, 0xbf2: 0x0018, 0xbf3: 0x0018, 0xbf4: 0x0018, 0xbf5: 0x0018, + 0xbf6: 0x0018, 0xbf7: 0x0018, 0xbf8: 0x0018, 0xbf9: 0x0018, 0xbfa: 0x0018, 0xbfb: 0x0018, + 0xbfc: 0x0018, 0xbfd: 0x0018, 0xbfe: 0x0018, 0xbff: 0x0040, + // Block 0x30, offset 0xc00 + 0xc00: 0x07ee, 0xc01: 0x080e, 0xc02: 0x1159, 0xc03: 0x082d, 0xc04: 0x0018, 0xc05: 0x084e, + 0xc06: 0x086e, 0xc07: 0x1011, 0xc08: 0x0018, 0xc09: 0x088d, 0xc0a: 0x0f31, 0xc0b: 0x0249, + 0xc0c: 0x0249, 0xc0d: 0x0249, 0xc0e: 0x0249, 0xc0f: 0x2009, 0xc10: 0x0f41, 0xc11: 0x0f41, + 0xc12: 0x0359, 0xc13: 0x0359, 0xc14: 0x0018, 0xc15: 0x0f71, 0xc16: 0x2021, 0xc17: 0x0018, + 0xc18: 0x0018, 0xc19: 0x0f99, 0xc1a: 0x2039, 0xc1b: 0x0269, 0xc1c: 0x0269, 0xc1d: 0x0269, + 0xc1e: 0x0018, 0xc1f: 0x0018, 0xc20: 0x2049, 0xc21: 0x08ad, 0xc22: 0x2061, 0xc23: 0x0018, + 0xc24: 0x13d1, 0xc25: 0x0018, 0xc26: 0x2079, 0xc27: 0x0018, 0xc28: 0x13d1, 0xc29: 0x0018, + 0xc2a: 0x0f51, 0xc2b: 0x2091, 0xc2c: 0x0ee9, 0xc2d: 0x1159, 0xc2e: 0x0018, 0xc2f: 0x0f09, + 0xc30: 0x0f09, 0xc31: 0x1199, 0xc32: 0x0040, 0xc33: 0x0f61, 0xc34: 0x00d9, 0xc35: 0x20a9, + 0xc36: 0x20c1, 0xc37: 0x20d9, 0xc38: 0x20f1, 0xc39: 0x0f41, 0xc3a: 0x0018, 0xc3b: 0x08cd, + 0xc3c: 0x2109, 0xc3d: 0x10b1, 0xc3e: 0x10b1, 0xc3f: 0x2109, + // Block 0x31, offset 0xc40 + 0xc40: 0x08ed, 0xc41: 0x0018, 0xc42: 0x0018, 0xc43: 0x0018, 0xc44: 0x0018, 0xc45: 0x0ef9, + 0xc46: 0x0ef9, 0xc47: 0x0f09, 0xc48: 0x0f41, 0xc49: 0x0259, 0xc4a: 0x0018, 0xc4b: 0x0018, + 0xc4c: 0x0018, 0xc4d: 0x0018, 0xc4e: 0x0008, 0xc4f: 0x0018, 0xc50: 0x2121, 0xc51: 0x2151, + 0xc52: 0x2181, 0xc53: 0x21b9, 0xc54: 0x21e9, 0xc55: 0x2219, 0xc56: 0x2249, 0xc57: 0x2279, + 0xc58: 0x22a9, 0xc59: 0x22d9, 0xc5a: 0x2309, 0xc5b: 0x2339, 0xc5c: 0x2369, 0xc5d: 0x2399, + 0xc5e: 0x23c9, 0xc5f: 0x23f9, 0xc60: 0x0f41, 0xc61: 0x2421, 0xc62: 0x0905, 0xc63: 0x2439, + 0xc64: 0x1089, 0xc65: 0x2451, 0xc66: 0x0925, 0xc67: 0x2469, 0xc68: 0x2491, 0xc69: 0x0369, + 0xc6a: 0x24a9, 0xc6b: 0x0945, 0xc6c: 0x0359, 0xc6d: 0x1159, 0xc6e: 0x0ef9, 0xc6f: 0x0f61, + 0xc70: 0x0f41, 0xc71: 0x2421, 0xc72: 0x0965, 0xc73: 0x2439, 0xc74: 0x1089, 0xc75: 0x2451, + 0xc76: 0x0985, 0xc77: 0x2469, 0xc78: 0x2491, 0xc79: 0x0369, 0xc7a: 0x24a9, 0xc7b: 0x09a5, + 0xc7c: 0x0359, 0xc7d: 0x1159, 0xc7e: 0x0ef9, 0xc7f: 0x0f61, + // Block 0x32, offset 0xc80 + 0xc80: 0x0018, 0xc81: 0x0018, 0xc82: 0x0018, 0xc83: 0x0018, 0xc84: 0x0018, 0xc85: 0x0018, + 0xc86: 0x0018, 0xc87: 0x0018, 0xc88: 0x0018, 0xc89: 0x0018, 0xc8a: 0x0018, 0xc8b: 0x0040, + 0xc8c: 0x0040, 0xc8d: 0x0040, 0xc8e: 0x0040, 0xc8f: 0x0040, 0xc90: 0x0040, 0xc91: 0x0040, + 0xc92: 0x0040, 0xc93: 0x0040, 0xc94: 0x0040, 0xc95: 0x0040, 0xc96: 0x0040, 0xc97: 0x0040, + 0xc98: 0x0040, 0xc99: 0x0040, 0xc9a: 0x0040, 0xc9b: 0x0040, 0xc9c: 0x0040, 0xc9d: 0x0040, + 0xc9e: 0x0040, 0xc9f: 0x0040, 0xca0: 0x00c9, 0xca1: 0x0069, 0xca2: 0x0079, 0xca3: 0x1f51, + 0xca4: 0x1f61, 0xca5: 0x1f71, 0xca6: 0x1f81, 0xca7: 0x1f91, 0xca8: 0x1fa1, 0xca9: 0x2601, + 0xcaa: 0x2619, 0xcab: 0x2631, 0xcac: 0x2649, 0xcad: 0x2661, 0xcae: 0x2679, 0xcaf: 0x2691, + 0xcb0: 0x26a9, 0xcb1: 0x26c1, 0xcb2: 0x26d9, 0xcb3: 0x26f1, 0xcb4: 0x0a06, 0xcb5: 0x0a26, + 0xcb6: 0x0a46, 0xcb7: 0x0a66, 0xcb8: 0x0a86, 0xcb9: 0x0aa6, 0xcba: 0x0ac6, 0xcbb: 0x0ae6, + 0xcbc: 0x0b06, 0xcbd: 0x270a, 0xcbe: 0x2732, 0xcbf: 0x275a, + // Block 0x33, offset 0xcc0 + 0xcc0: 0x2782, 0xcc1: 0x27aa, 0xcc2: 0x27d2, 0xcc3: 0x27fa, 0xcc4: 0x2822, 0xcc5: 0x284a, + 0xcc6: 0x2872, 0xcc7: 0x289a, 0xcc8: 0x0040, 0xcc9: 0x0040, 0xcca: 0x0040, 0xccb: 0x0040, + 0xccc: 0x0040, 0xccd: 0x0040, 0xcce: 0x0040, 0xccf: 0x0040, 0xcd0: 0x0040, 0xcd1: 0x0040, + 0xcd2: 0x0040, 0xcd3: 0x0040, 0xcd4: 0x0040, 0xcd5: 0x0040, 0xcd6: 0x0040, 0xcd7: 0x0040, + 0xcd8: 0x0040, 0xcd9: 0x0040, 0xcda: 0x0040, 0xcdb: 0x0040, 0xcdc: 0x0b26, 0xcdd: 0x0b46, + 0xcde: 0x0b66, 0xcdf: 0x0b86, 0xce0: 0x0ba6, 0xce1: 0x0bc6, 0xce2: 0x0be6, 0xce3: 0x0c06, + 0xce4: 0x0c26, 0xce5: 0x0c46, 0xce6: 0x0c66, 0xce7: 0x0c86, 0xce8: 0x0ca6, 0xce9: 0x0cc6, + 0xcea: 0x0ce6, 0xceb: 0x0d06, 0xcec: 0x0d26, 0xced: 0x0d46, 0xcee: 0x0d66, 0xcef: 0x0d86, + 0xcf0: 0x0da6, 0xcf1: 0x0dc6, 0xcf2: 0x0de6, 0xcf3: 0x0e06, 0xcf4: 0x0e26, 0xcf5: 0x0e46, + 0xcf6: 0x0039, 0xcf7: 0x0ee9, 0xcf8: 0x1159, 0xcf9: 0x0ef9, 0xcfa: 0x0f09, 0xcfb: 0x1199, + 0xcfc: 0x0f31, 0xcfd: 0x0249, 0xcfe: 0x0f41, 0xcff: 0x0259, + // Block 0x34, offset 0xd00 + 0xd00: 0x0f51, 0xd01: 0x0359, 0xd02: 0x0f61, 0xd03: 0x0f71, 0xd04: 0x00d9, 0xd05: 0x0f99, + 0xd06: 0x2039, 0xd07: 0x0269, 0xd08: 0x01d9, 0xd09: 0x0fa9, 0xd0a: 0x0fb9, 0xd0b: 0x1089, + 0xd0c: 0x0279, 0xd0d: 0x0369, 0xd0e: 0x0289, 0xd0f: 0x13d1, 0xd10: 0x0039, 0xd11: 0x0ee9, + 0xd12: 0x1159, 0xd13: 0x0ef9, 0xd14: 0x0f09, 0xd15: 0x1199, 0xd16: 0x0f31, 0xd17: 0x0249, + 0xd18: 0x0f41, 0xd19: 0x0259, 0xd1a: 0x0f51, 0xd1b: 0x0359, 0xd1c: 0x0f61, 0xd1d: 0x0f71, + 0xd1e: 0x00d9, 0xd1f: 0x0f99, 0xd20: 0x2039, 0xd21: 0x0269, 0xd22: 0x01d9, 0xd23: 0x0fa9, + 0xd24: 0x0fb9, 0xd25: 0x1089, 0xd26: 0x0279, 0xd27: 0x0369, 0xd28: 0x0289, 0xd29: 0x13d1, + 0xd2a: 0x1f41, 0xd2b: 0x0018, 0xd2c: 0x0018, 0xd2d: 0x0018, 0xd2e: 0x0018, 0xd2f: 0x0018, + 0xd30: 0x0018, 0xd31: 0x0018, 0xd32: 0x0018, 0xd33: 0x0018, 0xd34: 0x0018, 0xd35: 0x0018, + 0xd36: 0x0018, 0xd37: 0x0018, 0xd38: 0x0018, 0xd39: 0x0018, 0xd3a: 0x0018, 0xd3b: 0x0018, + 0xd3c: 0x0018, 0xd3d: 0x0018, 0xd3e: 0x0018, 0xd3f: 0x0018, + // Block 0x35, offset 0xd40 + 0xd40: 0x0008, 0xd41: 0x0008, 0xd42: 0x0008, 0xd43: 0x0008, 0xd44: 0x0008, 0xd45: 0x0008, + 0xd46: 0x0008, 0xd47: 0x0008, 0xd48: 0x0008, 0xd49: 0x0008, 0xd4a: 0x0008, 0xd4b: 0x0008, + 0xd4c: 0x0008, 0xd4d: 0x0008, 0xd4e: 0x0008, 0xd4f: 0x0008, 0xd50: 0x0008, 0xd51: 0x0008, + 0xd52: 0x0008, 0xd53: 0x0008, 0xd54: 0x0008, 0xd55: 0x0008, 0xd56: 0x0008, 0xd57: 0x0008, + 0xd58: 0x0008, 0xd59: 0x0008, 0xd5a: 0x0008, 0xd5b: 0x0008, 0xd5c: 0x0008, 0xd5d: 0x0008, + 0xd5e: 0x0008, 0xd5f: 0x0040, 0xd60: 0xe00d, 0xd61: 0x0008, 0xd62: 0x2971, 0xd63: 0x0ebd, + 0xd64: 0x2989, 0xd65: 0x0008, 0xd66: 0x0008, 0xd67: 0xe07d, 0xd68: 0x0008, 0xd69: 0xe01d, + 0xd6a: 0x0008, 0xd6b: 0xe03d, 0xd6c: 0x0008, 0xd6d: 0x0fe1, 0xd6e: 0x1281, 0xd6f: 0x0fc9, + 0xd70: 0x1141, 0xd71: 0x0008, 0xd72: 0xe00d, 0xd73: 0x0008, 0xd74: 0x0008, 0xd75: 0xe01d, + 0xd76: 0x0008, 0xd77: 0x0008, 0xd78: 0x0008, 0xd79: 0x0008, 0xd7a: 0x0008, 0xd7b: 0x0008, + 0xd7c: 0x0259, 0xd7d: 0x1089, 0xd7e: 0x29a1, 0xd7f: 0x29b9, + // Block 0x36, offset 0xd80 + 0xd80: 0xe00d, 0xd81: 0x0008, 0xd82: 0xe00d, 0xd83: 0x0008, 0xd84: 0xe00d, 0xd85: 0x0008, + 0xd86: 0xe00d, 0xd87: 0x0008, 0xd88: 0xe00d, 0xd89: 0x0008, 0xd8a: 0xe00d, 0xd8b: 0x0008, + 0xd8c: 0xe00d, 0xd8d: 0x0008, 0xd8e: 0xe00d, 0xd8f: 0x0008, 0xd90: 0xe00d, 0xd91: 0x0008, + 0xd92: 0xe00d, 0xd93: 0x0008, 0xd94: 0xe00d, 0xd95: 0x0008, 0xd96: 0xe00d, 0xd97: 0x0008, + 0xd98: 0xe00d, 0xd99: 0x0008, 0xd9a: 0xe00d, 0xd9b: 0x0008, 0xd9c: 0xe00d, 0xd9d: 0x0008, + 0xd9e: 0xe00d, 0xd9f: 0x0008, 0xda0: 0xe00d, 0xda1: 0x0008, 0xda2: 0xe00d, 0xda3: 0x0008, + 0xda4: 0x0008, 0xda5: 0x0018, 0xda6: 0x0018, 0xda7: 0x0018, 0xda8: 0x0018, 0xda9: 0x0018, + 0xdaa: 0x0018, 0xdab: 0xe03d, 0xdac: 0x0008, 0xdad: 0xe01d, 0xdae: 0x0008, 0xdaf: 0x1308, + 0xdb0: 0x1308, 0xdb1: 0x1308, 0xdb2: 0xe00d, 0xdb3: 0x0008, 0xdb4: 0x0040, 0xdb5: 0x0040, + 0xdb6: 0x0040, 0xdb7: 0x0040, 0xdb8: 0x0040, 0xdb9: 0x0018, 0xdba: 0x0018, 0xdbb: 0x0018, + 0xdbc: 0x0018, 0xdbd: 0x0018, 0xdbe: 0x0018, 0xdbf: 0x0018, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x26fd, 0xdc1: 0x271d, 0xdc2: 0x273d, 0xdc3: 0x275d, 0xdc4: 0x277d, 0xdc5: 0x279d, + 0xdc6: 0x27bd, 0xdc7: 0x27dd, 0xdc8: 0x27fd, 0xdc9: 0x281d, 0xdca: 0x283d, 0xdcb: 0x285d, + 0xdcc: 0x287d, 0xdcd: 0x289d, 0xdce: 0x28bd, 0xdcf: 0x28dd, 0xdd0: 0x28fd, 0xdd1: 0x291d, + 0xdd2: 0x293d, 0xdd3: 0x295d, 0xdd4: 0x297d, 0xdd5: 0x299d, 0xdd6: 0x0040, 0xdd7: 0x0040, + 0xdd8: 0x0040, 0xdd9: 0x0040, 0xdda: 0x0040, 0xddb: 0x0040, 0xddc: 0x0040, 0xddd: 0x0040, + 0xdde: 0x0040, 0xddf: 0x0040, 0xde0: 0x0040, 0xde1: 0x0040, 0xde2: 0x0040, 0xde3: 0x0040, + 0xde4: 0x0040, 0xde5: 0x0040, 0xde6: 0x0040, 0xde7: 0x0040, 0xde8: 0x0040, 0xde9: 0x0040, + 0xdea: 0x0040, 0xdeb: 0x0040, 0xdec: 0x0040, 0xded: 0x0040, 0xdee: 0x0040, 0xdef: 0x0040, + 0xdf0: 0x0040, 0xdf1: 0x0040, 0xdf2: 0x0040, 0xdf3: 0x0040, 0xdf4: 0x0040, 0xdf5: 0x0040, + 0xdf6: 0x0040, 0xdf7: 0x0040, 0xdf8: 0x0040, 0xdf9: 0x0040, 0xdfa: 0x0040, 0xdfb: 0x0040, + 0xdfc: 0x0040, 0xdfd: 0x0040, 0xdfe: 0x0040, 0xdff: 0x0040, + // Block 0x38, offset 0xe00 + 0xe00: 0x000a, 0xe01: 0x0018, 0xe02: 0x29d1, 0xe03: 0x0018, 0xe04: 0x0018, 0xe05: 0x0008, + 0xe06: 0x0008, 0xe07: 0x0008, 0xe08: 0x0018, 0xe09: 0x0018, 0xe0a: 0x0018, 0xe0b: 0x0018, + 0xe0c: 0x0018, 0xe0d: 0x0018, 0xe0e: 0x0018, 0xe0f: 0x0018, 0xe10: 0x0018, 0xe11: 0x0018, + 0xe12: 0x0018, 0xe13: 0x0018, 0xe14: 0x0018, 0xe15: 0x0018, 0xe16: 0x0018, 0xe17: 0x0018, + 0xe18: 0x0018, 0xe19: 0x0018, 0xe1a: 0x0018, 0xe1b: 0x0018, 0xe1c: 0x0018, 0xe1d: 0x0018, + 0xe1e: 0x0018, 0xe1f: 0x0018, 0xe20: 0x0018, 0xe21: 0x0018, 0xe22: 0x0018, 0xe23: 0x0018, + 0xe24: 0x0018, 0xe25: 0x0018, 0xe26: 0x0018, 0xe27: 0x0018, 0xe28: 0x0018, 0xe29: 0x0018, + 0xe2a: 0x1308, 0xe2b: 0x1308, 0xe2c: 0x1308, 0xe2d: 0x1308, 0xe2e: 0x1018, 0xe2f: 0x1018, + 0xe30: 0x0018, 0xe31: 0x0018, 0xe32: 0x0018, 0xe33: 0x0018, 0xe34: 0x0018, 0xe35: 0x0018, + 0xe36: 0xe125, 0xe37: 0x0018, 0xe38: 0x29bd, 0xe39: 0x29dd, 0xe3a: 0x29fd, 0xe3b: 0x0018, + 0xe3c: 0x0008, 0xe3d: 0x0018, 0xe3e: 0x0018, 0xe3f: 0x0018, + // Block 0x39, offset 0xe40 + 0xe40: 0x2b3d, 0xe41: 0x2b5d, 0xe42: 0x2b7d, 0xe43: 0x2b9d, 0xe44: 0x2bbd, 0xe45: 0x2bdd, + 0xe46: 0x2bdd, 0xe47: 0x2bdd, 0xe48: 0x2bfd, 0xe49: 0x2bfd, 0xe4a: 0x2bfd, 0xe4b: 0x2bfd, + 0xe4c: 0x2c1d, 0xe4d: 0x2c1d, 0xe4e: 0x2c1d, 0xe4f: 0x2c3d, 0xe50: 0x2c5d, 0xe51: 0x2c5d, + 0xe52: 0x2a7d, 0xe53: 0x2a7d, 0xe54: 0x2c5d, 0xe55: 0x2c5d, 0xe56: 0x2c7d, 0xe57: 0x2c7d, + 0xe58: 0x2c5d, 0xe59: 0x2c5d, 0xe5a: 0x2a7d, 0xe5b: 0x2a7d, 0xe5c: 0x2c5d, 0xe5d: 0x2c5d, + 0xe5e: 0x2c3d, 0xe5f: 0x2c3d, 0xe60: 0x2c9d, 0xe61: 0x2c9d, 0xe62: 0x2cbd, 0xe63: 0x2cbd, + 0xe64: 0x0040, 0xe65: 0x2cdd, 0xe66: 0x2cfd, 0xe67: 0x2d1d, 0xe68: 0x2d1d, 0xe69: 0x2d3d, + 0xe6a: 0x2d5d, 0xe6b: 0x2d7d, 0xe6c: 0x2d9d, 0xe6d: 0x2dbd, 0xe6e: 0x2ddd, 0xe6f: 0x2dfd, + 0xe70: 0x2e1d, 0xe71: 0x2e3d, 0xe72: 0x2e3d, 0xe73: 0x2e5d, 0xe74: 0x2e7d, 0xe75: 0x2e7d, + 0xe76: 0x2e9d, 0xe77: 0x2ebd, 0xe78: 0x2e5d, 0xe79: 0x2edd, 0xe7a: 0x2efd, 0xe7b: 0x2edd, + 0xe7c: 0x2e5d, 0xe7d: 0x2f1d, 0xe7e: 0x2f3d, 0xe7f: 0x2f5d, + // Block 0x3a, offset 0xe80 + 0xe80: 0x2f7d, 0xe81: 0x2f9d, 0xe82: 0x2cfd, 0xe83: 0x2cdd, 0xe84: 0x2fbd, 0xe85: 0x2fdd, + 0xe86: 0x2ffd, 0xe87: 0x301d, 0xe88: 0x303d, 0xe89: 0x305d, 0xe8a: 0x307d, 0xe8b: 0x309d, + 0xe8c: 0x30bd, 0xe8d: 0x30dd, 0xe8e: 0x30fd, 0xe8f: 0x0040, 0xe90: 0x0018, 0xe91: 0x0018, + 0xe92: 0x311d, 0xe93: 0x313d, 0xe94: 0x315d, 0xe95: 0x317d, 0xe96: 0x319d, 0xe97: 0x31bd, + 0xe98: 0x31dd, 0xe99: 0x31fd, 0xe9a: 0x321d, 0xe9b: 0x323d, 0xe9c: 0x315d, 0xe9d: 0x325d, + 0xe9e: 0x327d, 0xe9f: 0x329d, 0xea0: 0x0008, 0xea1: 0x0008, 0xea2: 0x0008, 0xea3: 0x0008, + 0xea4: 0x0008, 0xea5: 0x0008, 0xea6: 0x0008, 0xea7: 0x0008, 0xea8: 0x0008, 0xea9: 0x0008, + 0xeaa: 0x0008, 0xeab: 0x0008, 0xeac: 0x0008, 0xead: 0x0008, 0xeae: 0x0008, 0xeaf: 0x0008, + 0xeb0: 0x0008, 0xeb1: 0x0008, 0xeb2: 0x0008, 0xeb3: 0x0008, 0xeb4: 0x0008, 0xeb5: 0x0008, + 0xeb6: 0x0008, 0xeb7: 0x0008, 0xeb8: 0x0008, 0xeb9: 0x0008, 0xeba: 0x0008, 0xebb: 0x0040, + 0xebc: 0x0040, 0xebd: 0x0040, 0xebe: 0x0040, 0xebf: 0x0040, + // Block 0x3b, offset 0xec0 + 0xec0: 0x36a2, 0xec1: 0x36d2, 0xec2: 0x3702, 0xec3: 0x3732, 0xec4: 0x32bd, 0xec5: 0x32dd, + 0xec6: 0x32fd, 0xec7: 0x331d, 0xec8: 0x0018, 0xec9: 0x0018, 0xeca: 0x0018, 0xecb: 0x0018, + 0xecc: 0x0018, 0xecd: 0x0018, 0xece: 0x0018, 0xecf: 0x0018, 0xed0: 0x333d, 0xed1: 0x3761, + 0xed2: 0x3779, 0xed3: 0x3791, 0xed4: 0x37a9, 0xed5: 0x37c1, 0xed6: 0x37d9, 0xed7: 0x37f1, + 0xed8: 0x3809, 0xed9: 0x3821, 0xeda: 0x3839, 0xedb: 0x3851, 0xedc: 0x3869, 0xedd: 0x3881, + 0xede: 0x3899, 0xedf: 0x38b1, 0xee0: 0x335d, 0xee1: 0x337d, 0xee2: 0x339d, 0xee3: 0x33bd, + 0xee4: 0x33dd, 0xee5: 0x33dd, 0xee6: 0x33fd, 0xee7: 0x341d, 0xee8: 0x343d, 0xee9: 0x345d, + 0xeea: 0x347d, 0xeeb: 0x349d, 0xeec: 0x34bd, 0xeed: 0x34dd, 0xeee: 0x34fd, 0xeef: 0x351d, + 0xef0: 0x353d, 0xef1: 0x355d, 0xef2: 0x357d, 0xef3: 0x359d, 0xef4: 0x35bd, 0xef5: 0x35dd, + 0xef6: 0x35fd, 0xef7: 0x361d, 0xef8: 0x363d, 0xef9: 0x365d, 0xefa: 0x367d, 0xefb: 0x369d, + 0xefc: 0x38c9, 0xefd: 0x3901, 0xefe: 0x36bd, 0xeff: 0x0018, + // Block 0x3c, offset 0xf00 + 0xf00: 0x36dd, 0xf01: 0x36fd, 0xf02: 0x371d, 0xf03: 0x373d, 0xf04: 0x375d, 0xf05: 0x377d, + 0xf06: 0x379d, 0xf07: 0x37bd, 0xf08: 0x37dd, 0xf09: 0x37fd, 0xf0a: 0x381d, 0xf0b: 0x383d, + 0xf0c: 0x385d, 0xf0d: 0x387d, 0xf0e: 0x389d, 0xf0f: 0x38bd, 0xf10: 0x38dd, 0xf11: 0x38fd, + 0xf12: 0x391d, 0xf13: 0x393d, 0xf14: 0x395d, 0xf15: 0x397d, 0xf16: 0x399d, 0xf17: 0x39bd, + 0xf18: 0x39dd, 0xf19: 0x39fd, 0xf1a: 0x3a1d, 0xf1b: 0x3a3d, 0xf1c: 0x3a5d, 0xf1d: 0x3a7d, + 0xf1e: 0x3a9d, 0xf1f: 0x3abd, 0xf20: 0x3add, 0xf21: 0x3afd, 0xf22: 0x3b1d, 0xf23: 0x3b3d, + 0xf24: 0x3b5d, 0xf25: 0x3b7d, 0xf26: 0x127d, 0xf27: 0x3b9d, 0xf28: 0x3bbd, 0xf29: 0x3bdd, + 0xf2a: 0x3bfd, 0xf2b: 0x3c1d, 0xf2c: 0x3c3d, 0xf2d: 0x3c5d, 0xf2e: 0x239d, 0xf2f: 0x3c7d, + 0xf30: 0x3c9d, 0xf31: 0x3939, 0xf32: 0x3951, 0xf33: 0x3969, 0xf34: 0x3981, 0xf35: 0x3999, + 0xf36: 0x39b1, 0xf37: 0x39c9, 0xf38: 0x39e1, 0xf39: 0x39f9, 0xf3a: 0x3a11, 0xf3b: 0x3a29, + 0xf3c: 0x3a41, 0xf3d: 0x3a59, 0xf3e: 0x3a71, 0xf3f: 0x3a89, + // Block 0x3d, offset 0xf40 + 0xf40: 0x3aa1, 0xf41: 0x3ac9, 0xf42: 0x3af1, 0xf43: 0x3b19, 0xf44: 0x3b41, 0xf45: 0x3b69, + 0xf46: 0x3b91, 0xf47: 0x3bb9, 0xf48: 0x3be1, 0xf49: 0x3c09, 0xf4a: 0x3c39, 0xf4b: 0x3c69, + 0xf4c: 0x3c99, 0xf4d: 0x3cbd, 0xf4e: 0x3cb1, 0xf4f: 0x3cdd, 0xf50: 0x3cfd, 0xf51: 0x3d15, + 0xf52: 0x3d2d, 0xf53: 0x3d45, 0xf54: 0x3d5d, 0xf55: 0x3d5d, 0xf56: 0x3d45, 0xf57: 0x3d75, + 0xf58: 0x07bd, 0xf59: 0x3d8d, 0xf5a: 0x3da5, 0xf5b: 0x3dbd, 0xf5c: 0x3dd5, 0xf5d: 0x3ded, + 0xf5e: 0x3e05, 0xf5f: 0x3e1d, 0xf60: 0x3e35, 0xf61: 0x3e4d, 0xf62: 0x3e65, 0xf63: 0x3e7d, + 0xf64: 0x3e95, 0xf65: 0x3e95, 0xf66: 0x3ead, 0xf67: 0x3ead, 0xf68: 0x3ec5, 0xf69: 0x3ec5, + 0xf6a: 0x3edd, 0xf6b: 0x3ef5, 0xf6c: 0x3f0d, 0xf6d: 0x3f25, 0xf6e: 0x3f3d, 0xf6f: 0x3f3d, + 0xf70: 0x3f55, 0xf71: 0x3f55, 0xf72: 0x3f55, 0xf73: 0x3f6d, 0xf74: 0x3f85, 0xf75: 0x3f9d, + 0xf76: 0x3fb5, 0xf77: 0x3f9d, 0xf78: 0x3fcd, 0xf79: 0x3fe5, 0xf7a: 0x3f6d, 0xf7b: 0x3ffd, + 0xf7c: 0x4015, 0xf7d: 0x4015, 0xf7e: 0x4015, 0xf7f: 0x0040, + // Block 0x3e, offset 0xf80 + 0xf80: 0x3cc9, 0xf81: 0x3d31, 0xf82: 0x3d99, 0xf83: 0x3e01, 0xf84: 0x3e51, 0xf85: 0x3eb9, + 0xf86: 0x3f09, 0xf87: 0x3f59, 0xf88: 0x3fd9, 0xf89: 0x4041, 0xf8a: 0x4091, 0xf8b: 0x40e1, + 0xf8c: 0x4131, 0xf8d: 0x4199, 0xf8e: 0x4201, 0xf8f: 0x4251, 0xf90: 0x42a1, 0xf91: 0x42d9, + 0xf92: 0x4329, 0xf93: 0x4391, 0xf94: 0x43f9, 0xf95: 0x4431, 0xf96: 0x44b1, 0xf97: 0x4549, + 0xf98: 0x45c9, 0xf99: 0x4619, 0xf9a: 0x4699, 0xf9b: 0x4719, 0xf9c: 0x4781, 0xf9d: 0x47d1, + 0xf9e: 0x4821, 0xf9f: 0x4871, 0xfa0: 0x48d9, 0xfa1: 0x4959, 0xfa2: 0x49c1, 0xfa3: 0x4a11, + 0xfa4: 0x4a61, 0xfa5: 0x4ab1, 0xfa6: 0x4ae9, 0xfa7: 0x4b21, 0xfa8: 0x4b59, 0xfa9: 0x4b91, + 0xfaa: 0x4be1, 0xfab: 0x4c31, 0xfac: 0x4cb1, 0xfad: 0x4d01, 0xfae: 0x4d69, 0xfaf: 0x4de9, + 0xfb0: 0x4e39, 0xfb1: 0x4e71, 0xfb2: 0x4ea9, 0xfb3: 0x4f29, 0xfb4: 0x4f91, 0xfb5: 0x5011, + 0xfb6: 0x5061, 0xfb7: 0x50e1, 0xfb8: 0x5119, 0xfb9: 0x5169, 0xfba: 0x51b9, 0xfbb: 0x5209, + 0xfbc: 0x5259, 0xfbd: 0x52a9, 0xfbe: 0x5311, 0xfbf: 0x5361, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x5399, 0xfc1: 0x53e9, 0xfc2: 0x5439, 0xfc3: 0x5489, 0xfc4: 0x54f1, 0xfc5: 0x5541, + 0xfc6: 0x5591, 0xfc7: 0x55e1, 0xfc8: 0x5661, 0xfc9: 0x56c9, 0xfca: 0x5701, 0xfcb: 0x5781, + 0xfcc: 0x57b9, 0xfcd: 0x5821, 0xfce: 0x5889, 0xfcf: 0x58d9, 0xfd0: 0x5929, 0xfd1: 0x5979, + 0xfd2: 0x59e1, 0xfd3: 0x5a19, 0xfd4: 0x5a69, 0xfd5: 0x5ad1, 0xfd6: 0x5b09, 0xfd7: 0x5b89, + 0xfd8: 0x5bd9, 0xfd9: 0x5c01, 0xfda: 0x5c29, 0xfdb: 0x5c51, 0xfdc: 0x5c79, 0xfdd: 0x5ca1, + 0xfde: 0x5cc9, 0xfdf: 0x5cf1, 0xfe0: 0x5d19, 0xfe1: 0x5d41, 0xfe2: 0x5d69, 0xfe3: 0x5d99, + 0xfe4: 0x5dc9, 0xfe5: 0x5df9, 0xfe6: 0x5e29, 0xfe7: 0x5e59, 0xfe8: 0x5e89, 0xfe9: 0x5eb9, + 0xfea: 0x5ee9, 0xfeb: 0x5f19, 0xfec: 0x5f49, 0xfed: 0x5f79, 0xfee: 0x5fa9, 0xfef: 0x5fd9, + 0xff0: 0x6009, 0xff1: 0x402d, 0xff2: 0x6039, 0xff3: 0x6051, 0xff4: 0x404d, 0xff5: 0x6069, + 0xff6: 0x6081, 0xff7: 0x6099, 0xff8: 0x406d, 0xff9: 0x406d, 0xffa: 0x60b1, 0xffb: 0x60c9, + 0xffc: 0x6101, 0xffd: 0x6139, 0xffe: 0x6171, 0xfff: 0x61a9, + // Block 0x40, offset 0x1000 + 0x1000: 0x6211, 0x1001: 0x6229, 0x1002: 0x408d, 0x1003: 0x6241, 0x1004: 0x6259, 0x1005: 0x6271, + 0x1006: 0x6289, 0x1007: 0x62a1, 0x1008: 0x40ad, 0x1009: 0x62b9, 0x100a: 0x62e1, 0x100b: 0x62f9, + 0x100c: 0x40cd, 0x100d: 0x40cd, 0x100e: 0x6311, 0x100f: 0x6329, 0x1010: 0x6341, 0x1011: 0x40ed, + 0x1012: 0x410d, 0x1013: 0x412d, 0x1014: 0x414d, 0x1015: 0x416d, 0x1016: 0x6359, 0x1017: 0x6371, + 0x1018: 0x6389, 0x1019: 0x63a1, 0x101a: 0x63b9, 0x101b: 0x418d, 0x101c: 0x63d1, 0x101d: 0x63e9, + 0x101e: 0x6401, 0x101f: 0x41ad, 0x1020: 0x41cd, 0x1021: 0x6419, 0x1022: 0x41ed, 0x1023: 0x420d, + 0x1024: 0x422d, 0x1025: 0x6431, 0x1026: 0x424d, 0x1027: 0x6449, 0x1028: 0x6479, 0x1029: 0x6211, + 0x102a: 0x426d, 0x102b: 0x428d, 0x102c: 0x42ad, 0x102d: 0x42cd, 0x102e: 0x64b1, 0x102f: 0x64f1, + 0x1030: 0x6539, 0x1031: 0x6551, 0x1032: 0x42ed, 0x1033: 0x6569, 0x1034: 0x6581, 0x1035: 0x6599, + 0x1036: 0x430d, 0x1037: 0x65b1, 0x1038: 0x65c9, 0x1039: 0x65b1, 0x103a: 0x65e1, 0x103b: 0x65f9, + 0x103c: 0x432d, 0x103d: 0x6611, 0x103e: 0x6629, 0x103f: 0x6611, + // Block 0x41, offset 0x1040 + 0x1040: 0x434d, 0x1041: 0x436d, 0x1042: 0x0040, 0x1043: 0x6641, 0x1044: 0x6659, 0x1045: 0x6671, + 0x1046: 0x6689, 0x1047: 0x0040, 0x1048: 0x66c1, 0x1049: 0x66d9, 0x104a: 0x66f1, 0x104b: 0x6709, + 0x104c: 0x6721, 0x104d: 0x6739, 0x104e: 0x6401, 0x104f: 0x6751, 0x1050: 0x6769, 0x1051: 0x6781, + 0x1052: 0x438d, 0x1053: 0x6799, 0x1054: 0x6289, 0x1055: 0x43ad, 0x1056: 0x43cd, 0x1057: 0x67b1, + 0x1058: 0x0040, 0x1059: 0x43ed, 0x105a: 0x67c9, 0x105b: 0x67e1, 0x105c: 0x67f9, 0x105d: 0x6811, + 0x105e: 0x6829, 0x105f: 0x6859, 0x1060: 0x6889, 0x1061: 0x68b1, 0x1062: 0x68d9, 0x1063: 0x6901, + 0x1064: 0x6929, 0x1065: 0x6951, 0x1066: 0x6979, 0x1067: 0x69a1, 0x1068: 0x69c9, 0x1069: 0x69f1, + 0x106a: 0x6a21, 0x106b: 0x6a51, 0x106c: 0x6a81, 0x106d: 0x6ab1, 0x106e: 0x6ae1, 0x106f: 0x6b11, + 0x1070: 0x6b41, 0x1071: 0x6b71, 0x1072: 0x6ba1, 0x1073: 0x6bd1, 0x1074: 0x6c01, 0x1075: 0x6c31, + 0x1076: 0x6c61, 0x1077: 0x6c91, 0x1078: 0x6cc1, 0x1079: 0x6cf1, 0x107a: 0x6d21, 0x107b: 0x6d51, + 0x107c: 0x6d81, 0x107d: 0x6db1, 0x107e: 0x6de1, 0x107f: 0x440d, + // Block 0x42, offset 0x1080 + 0x1080: 0xe00d, 0x1081: 0x0008, 0x1082: 0xe00d, 0x1083: 0x0008, 0x1084: 0xe00d, 0x1085: 0x0008, + 0x1086: 0xe00d, 0x1087: 0x0008, 0x1088: 0xe00d, 0x1089: 0x0008, 0x108a: 0xe00d, 0x108b: 0x0008, + 0x108c: 0xe00d, 0x108d: 0x0008, 0x108e: 0xe00d, 0x108f: 0x0008, 0x1090: 0xe00d, 0x1091: 0x0008, + 0x1092: 0xe00d, 0x1093: 0x0008, 0x1094: 0xe00d, 0x1095: 0x0008, 0x1096: 0xe00d, 0x1097: 0x0008, + 0x1098: 0xe00d, 0x1099: 0x0008, 0x109a: 0xe00d, 0x109b: 0x0008, 0x109c: 0xe00d, 0x109d: 0x0008, + 0x109e: 0xe00d, 0x109f: 0x0008, 0x10a0: 0xe00d, 0x10a1: 0x0008, 0x10a2: 0xe00d, 0x10a3: 0x0008, + 0x10a4: 0xe00d, 0x10a5: 0x0008, 0x10a6: 0xe00d, 0x10a7: 0x0008, 0x10a8: 0xe00d, 0x10a9: 0x0008, + 0x10aa: 0xe00d, 0x10ab: 0x0008, 0x10ac: 0xe00d, 0x10ad: 0x0008, 0x10ae: 0x0008, 0x10af: 0x1308, + 0x10b0: 0x1318, 0x10b1: 0x1318, 0x10b2: 0x1318, 0x10b3: 0x0018, 0x10b4: 0x1308, 0x10b5: 0x1308, + 0x10b6: 0x1308, 0x10b7: 0x1308, 0x10b8: 0x1308, 0x10b9: 0x1308, 0x10ba: 0x1308, 0x10bb: 0x1308, + 0x10bc: 0x1308, 0x10bd: 0x1308, 0x10be: 0x0018, 0x10bf: 0x0008, + // Block 0x43, offset 0x10c0 + 0x10c0: 0xe00d, 0x10c1: 0x0008, 0x10c2: 0xe00d, 0x10c3: 0x0008, 0x10c4: 0xe00d, 0x10c5: 0x0008, + 0x10c6: 0xe00d, 0x10c7: 0x0008, 0x10c8: 0xe00d, 0x10c9: 0x0008, 0x10ca: 0xe00d, 0x10cb: 0x0008, + 0x10cc: 0xe00d, 0x10cd: 0x0008, 0x10ce: 0xe00d, 0x10cf: 0x0008, 0x10d0: 0xe00d, 0x10d1: 0x0008, + 0x10d2: 0xe00d, 0x10d3: 0x0008, 0x10d4: 0xe00d, 0x10d5: 0x0008, 0x10d6: 0xe00d, 0x10d7: 0x0008, + 0x10d8: 0xe00d, 0x10d9: 0x0008, 0x10da: 0xe00d, 0x10db: 0x0008, 0x10dc: 0x0ea1, 0x10dd: 0x6e11, + 0x10de: 0x1308, 0x10df: 0x1308, 0x10e0: 0x0008, 0x10e1: 0x0008, 0x10e2: 0x0008, 0x10e3: 0x0008, + 0x10e4: 0x0008, 0x10e5: 0x0008, 0x10e6: 0x0008, 0x10e7: 0x0008, 0x10e8: 0x0008, 0x10e9: 0x0008, + 0x10ea: 0x0008, 0x10eb: 0x0008, 0x10ec: 0x0008, 0x10ed: 0x0008, 0x10ee: 0x0008, 0x10ef: 0x0008, + 0x10f0: 0x0008, 0x10f1: 0x0008, 0x10f2: 0x0008, 0x10f3: 0x0008, 0x10f4: 0x0008, 0x10f5: 0x0008, + 0x10f6: 0x0008, 0x10f7: 0x0008, 0x10f8: 0x0008, 0x10f9: 0x0008, 0x10fa: 0x0008, 0x10fb: 0x0008, + 0x10fc: 0x0008, 0x10fd: 0x0008, 0x10fe: 0x0008, 0x10ff: 0x0008, + // Block 0x44, offset 0x1100 + 0x1100: 0x0018, 0x1101: 0x0018, 0x1102: 0x0018, 0x1103: 0x0018, 0x1104: 0x0018, 0x1105: 0x0018, + 0x1106: 0x0018, 0x1107: 0x0018, 0x1108: 0x0018, 0x1109: 0x0018, 0x110a: 0x0018, 0x110b: 0x0018, + 0x110c: 0x0018, 0x110d: 0x0018, 0x110e: 0x0018, 0x110f: 0x0018, 0x1110: 0x0018, 0x1111: 0x0018, + 0x1112: 0x0018, 0x1113: 0x0018, 0x1114: 0x0018, 0x1115: 0x0018, 0x1116: 0x0018, 0x1117: 0x0008, + 0x1118: 0x0008, 0x1119: 0x0008, 0x111a: 0x0008, 0x111b: 0x0008, 0x111c: 0x0008, 0x111d: 0x0008, + 0x111e: 0x0008, 0x111f: 0x0008, 0x1120: 0x0018, 0x1121: 0x0018, 0x1122: 0xe00d, 0x1123: 0x0008, + 0x1124: 0xe00d, 0x1125: 0x0008, 0x1126: 0xe00d, 0x1127: 0x0008, 0x1128: 0xe00d, 0x1129: 0x0008, + 0x112a: 0xe00d, 0x112b: 0x0008, 0x112c: 0xe00d, 0x112d: 0x0008, 0x112e: 0xe00d, 0x112f: 0x0008, + 0x1130: 0x0008, 0x1131: 0x0008, 0x1132: 0xe00d, 0x1133: 0x0008, 0x1134: 0xe00d, 0x1135: 0x0008, + 0x1136: 0xe00d, 0x1137: 0x0008, 0x1138: 0xe00d, 0x1139: 0x0008, 0x113a: 0xe00d, 0x113b: 0x0008, + 0x113c: 0xe00d, 0x113d: 0x0008, 0x113e: 0xe00d, 0x113f: 0x0008, + // Block 0x45, offset 0x1140 + 0x1140: 0xe00d, 0x1141: 0x0008, 0x1142: 0xe00d, 0x1143: 0x0008, 0x1144: 0xe00d, 0x1145: 0x0008, + 0x1146: 0xe00d, 0x1147: 0x0008, 0x1148: 0xe00d, 0x1149: 0x0008, 0x114a: 0xe00d, 0x114b: 0x0008, + 0x114c: 0xe00d, 0x114d: 0x0008, 0x114e: 0xe00d, 0x114f: 0x0008, 0x1150: 0xe00d, 0x1151: 0x0008, + 0x1152: 0xe00d, 0x1153: 0x0008, 0x1154: 0xe00d, 0x1155: 0x0008, 0x1156: 0xe00d, 0x1157: 0x0008, + 0x1158: 0xe00d, 0x1159: 0x0008, 0x115a: 0xe00d, 0x115b: 0x0008, 0x115c: 0xe00d, 0x115d: 0x0008, + 0x115e: 0xe00d, 0x115f: 0x0008, 0x1160: 0xe00d, 0x1161: 0x0008, 0x1162: 0xe00d, 0x1163: 0x0008, + 0x1164: 0xe00d, 0x1165: 0x0008, 0x1166: 0xe00d, 0x1167: 0x0008, 0x1168: 0xe00d, 0x1169: 0x0008, + 0x116a: 0xe00d, 0x116b: 0x0008, 0x116c: 0xe00d, 0x116d: 0x0008, 0x116e: 0xe00d, 0x116f: 0x0008, + 0x1170: 0xe0fd, 0x1171: 0x0008, 0x1172: 0x0008, 0x1173: 0x0008, 0x1174: 0x0008, 0x1175: 0x0008, + 0x1176: 0x0008, 0x1177: 0x0008, 0x1178: 0x0008, 0x1179: 0xe01d, 0x117a: 0x0008, 0x117b: 0xe03d, + 0x117c: 0x0008, 0x117d: 0x442d, 0x117e: 0xe00d, 0x117f: 0x0008, + // Block 0x46, offset 0x1180 + 0x1180: 0xe00d, 0x1181: 0x0008, 0x1182: 0xe00d, 0x1183: 0x0008, 0x1184: 0xe00d, 0x1185: 0x0008, + 0x1186: 0xe00d, 0x1187: 0x0008, 0x1188: 0x0008, 0x1189: 0x0018, 0x118a: 0x0018, 0x118b: 0xe03d, + 0x118c: 0x0008, 0x118d: 0x11d9, 0x118e: 0x0008, 0x118f: 0x0008, 0x1190: 0xe00d, 0x1191: 0x0008, + 0x1192: 0xe00d, 0x1193: 0x0008, 0x1194: 0x0008, 0x1195: 0x0008, 0x1196: 0xe00d, 0x1197: 0x0008, + 0x1198: 0xe00d, 0x1199: 0x0008, 0x119a: 0xe00d, 0x119b: 0x0008, 0x119c: 0xe00d, 0x119d: 0x0008, + 0x119e: 0xe00d, 0x119f: 0x0008, 0x11a0: 0xe00d, 0x11a1: 0x0008, 0x11a2: 0xe00d, 0x11a3: 0x0008, + 0x11a4: 0xe00d, 0x11a5: 0x0008, 0x11a6: 0xe00d, 0x11a7: 0x0008, 0x11a8: 0xe00d, 0x11a9: 0x0008, + 0x11aa: 0x6e29, 0x11ab: 0x1029, 0x11ac: 0x11c1, 0x11ad: 0x6e41, 0x11ae: 0x1221, 0x11af: 0x0040, + 0x11b0: 0x6e59, 0x11b1: 0x6e71, 0x11b2: 0x1239, 0x11b3: 0x444d, 0x11b4: 0xe00d, 0x11b5: 0x0008, + 0x11b6: 0xe00d, 0x11b7: 0x0008, 0x11b8: 0x0040, 0x11b9: 0x0040, 0x11ba: 0x0040, 0x11bb: 0x0040, + 0x11bc: 0x0040, 0x11bd: 0x0040, 0x11be: 0x0040, 0x11bf: 0x0040, + // Block 0x47, offset 0x11c0 + 0x11c0: 0x64d5, 0x11c1: 0x64f5, 0x11c2: 0x6515, 0x11c3: 0x6535, 0x11c4: 0x6555, 0x11c5: 0x6575, + 0x11c6: 0x6595, 0x11c7: 0x65b5, 0x11c8: 0x65d5, 0x11c9: 0x65f5, 0x11ca: 0x6615, 0x11cb: 0x6635, + 0x11cc: 0x6655, 0x11cd: 0x6675, 0x11ce: 0x0008, 0x11cf: 0x0008, 0x11d0: 0x6695, 0x11d1: 0x0008, + 0x11d2: 0x66b5, 0x11d3: 0x0008, 0x11d4: 0x0008, 0x11d5: 0x66d5, 0x11d6: 0x66f5, 0x11d7: 0x6715, + 0x11d8: 0x6735, 0x11d9: 0x6755, 0x11da: 0x6775, 0x11db: 0x6795, 0x11dc: 0x67b5, 0x11dd: 0x67d5, + 0x11de: 0x67f5, 0x11df: 0x0008, 0x11e0: 0x6815, 0x11e1: 0x0008, 0x11e2: 0x6835, 0x11e3: 0x0008, + 0x11e4: 0x0008, 0x11e5: 0x6855, 0x11e6: 0x6875, 0x11e7: 0x0008, 0x11e8: 0x0008, 0x11e9: 0x0008, + 0x11ea: 0x6895, 0x11eb: 0x68b5, 0x11ec: 0x68d5, 0x11ed: 0x68f5, 0x11ee: 0x6915, 0x11ef: 0x6935, + 0x11f0: 0x6955, 0x11f1: 0x6975, 0x11f2: 0x6995, 0x11f3: 0x69b5, 0x11f4: 0x69d5, 0x11f5: 0x69f5, + 0x11f6: 0x6a15, 0x11f7: 0x6a35, 0x11f8: 0x6a55, 0x11f9: 0x6a75, 0x11fa: 0x6a95, 0x11fb: 0x6ab5, + 0x11fc: 0x6ad5, 0x11fd: 0x6af5, 0x11fe: 0x6b15, 0x11ff: 0x6b35, + // Block 0x48, offset 0x1200 + 0x1200: 0x7a95, 0x1201: 0x7ab5, 0x1202: 0x7ad5, 0x1203: 0x7af5, 0x1204: 0x7b15, 0x1205: 0x7b35, + 0x1206: 0x7b55, 0x1207: 0x7b75, 0x1208: 0x7b95, 0x1209: 0x7bb5, 0x120a: 0x7bd5, 0x120b: 0x7bf5, + 0x120c: 0x7c15, 0x120d: 0x7c35, 0x120e: 0x7c55, 0x120f: 0x6ec9, 0x1210: 0x6ef1, 0x1211: 0x6f19, + 0x1212: 0x7c75, 0x1213: 0x7c95, 0x1214: 0x7cb5, 0x1215: 0x6f41, 0x1216: 0x6f69, 0x1217: 0x6f91, + 0x1218: 0x7cd5, 0x1219: 0x7cf5, 0x121a: 0x0040, 0x121b: 0x0040, 0x121c: 0x0040, 0x121d: 0x0040, + 0x121e: 0x0040, 0x121f: 0x0040, 0x1220: 0x0040, 0x1221: 0x0040, 0x1222: 0x0040, 0x1223: 0x0040, + 0x1224: 0x0040, 0x1225: 0x0040, 0x1226: 0x0040, 0x1227: 0x0040, 0x1228: 0x0040, 0x1229: 0x0040, + 0x122a: 0x0040, 0x122b: 0x0040, 0x122c: 0x0040, 0x122d: 0x0040, 0x122e: 0x0040, 0x122f: 0x0040, + 0x1230: 0x0040, 0x1231: 0x0040, 0x1232: 0x0040, 0x1233: 0x0040, 0x1234: 0x0040, 0x1235: 0x0040, + 0x1236: 0x0040, 0x1237: 0x0040, 0x1238: 0x0040, 0x1239: 0x0040, 0x123a: 0x0040, 0x123b: 0x0040, + 0x123c: 0x0040, 0x123d: 0x0040, 0x123e: 0x0040, 0x123f: 0x0040, + // Block 0x49, offset 0x1240 + 0x1240: 0x6fb9, 0x1241: 0x6fd1, 0x1242: 0x6fe9, 0x1243: 0x7d15, 0x1244: 0x7d35, 0x1245: 0x7001, + 0x1246: 0x7001, 0x1247: 0x0040, 0x1248: 0x0040, 0x1249: 0x0040, 0x124a: 0x0040, 0x124b: 0x0040, + 0x124c: 0x0040, 0x124d: 0x0040, 0x124e: 0x0040, 0x124f: 0x0040, 0x1250: 0x0040, 0x1251: 0x0040, + 0x1252: 0x0040, 0x1253: 0x7019, 0x1254: 0x7041, 0x1255: 0x7069, 0x1256: 0x7091, 0x1257: 0x70b9, + 0x1258: 0x0040, 0x1259: 0x0040, 0x125a: 0x0040, 0x125b: 0x0040, 0x125c: 0x0040, 0x125d: 0x70e1, + 0x125e: 0x1308, 0x125f: 0x7109, 0x1260: 0x7131, 0x1261: 0x20a9, 0x1262: 0x20f1, 0x1263: 0x7149, + 0x1264: 0x7161, 0x1265: 0x7179, 0x1266: 0x7191, 0x1267: 0x71a9, 0x1268: 0x71c1, 0x1269: 0x1fb2, + 0x126a: 0x71d9, 0x126b: 0x7201, 0x126c: 0x7229, 0x126d: 0x7261, 0x126e: 0x7299, 0x126f: 0x72c1, + 0x1270: 0x72e9, 0x1271: 0x7311, 0x1272: 0x7339, 0x1273: 0x7361, 0x1274: 0x7389, 0x1275: 0x73b1, + 0x1276: 0x73d9, 0x1277: 0x0040, 0x1278: 0x7401, 0x1279: 0x7429, 0x127a: 0x7451, 0x127b: 0x7479, + 0x127c: 0x74a1, 0x127d: 0x0040, 0x127e: 0x74c9, 0x127f: 0x0040, + // Block 0x4a, offset 0x1280 + 0x1280: 0x74f1, 0x1281: 0x7519, 0x1282: 0x0040, 0x1283: 0x7541, 0x1284: 0x7569, 0x1285: 0x0040, + 0x1286: 0x7591, 0x1287: 0x75b9, 0x1288: 0x75e1, 0x1289: 0x7609, 0x128a: 0x7631, 0x128b: 0x7659, + 0x128c: 0x7681, 0x128d: 0x76a9, 0x128e: 0x76d1, 0x128f: 0x76f9, 0x1290: 0x7721, 0x1291: 0x7721, + 0x1292: 0x7739, 0x1293: 0x7739, 0x1294: 0x7739, 0x1295: 0x7739, 0x1296: 0x7751, 0x1297: 0x7751, + 0x1298: 0x7751, 0x1299: 0x7751, 0x129a: 0x7769, 0x129b: 0x7769, 0x129c: 0x7769, 0x129d: 0x7769, + 0x129e: 0x7781, 0x129f: 0x7781, 0x12a0: 0x7781, 0x12a1: 0x7781, 0x12a2: 0x7799, 0x12a3: 0x7799, + 0x12a4: 0x7799, 0x12a5: 0x7799, 0x12a6: 0x77b1, 0x12a7: 0x77b1, 0x12a8: 0x77b1, 0x12a9: 0x77b1, + 0x12aa: 0x77c9, 0x12ab: 0x77c9, 0x12ac: 0x77c9, 0x12ad: 0x77c9, 0x12ae: 0x77e1, 0x12af: 0x77e1, + 0x12b0: 0x77e1, 0x12b1: 0x77e1, 0x12b2: 0x77f9, 0x12b3: 0x77f9, 0x12b4: 0x77f9, 0x12b5: 0x77f9, + 0x12b6: 0x7811, 0x12b7: 0x7811, 0x12b8: 0x7811, 0x12b9: 0x7811, 0x12ba: 0x7829, 0x12bb: 0x7829, + 0x12bc: 0x7829, 0x12bd: 0x7829, 0x12be: 0x7841, 0x12bf: 0x7841, + // Block 0x4b, offset 0x12c0 + 0x12c0: 0x7841, 0x12c1: 0x7841, 0x12c2: 0x7859, 0x12c3: 0x7859, 0x12c4: 0x7871, 0x12c5: 0x7871, + 0x12c6: 0x7889, 0x12c7: 0x7889, 0x12c8: 0x78a1, 0x12c9: 0x78a1, 0x12ca: 0x78b9, 0x12cb: 0x78b9, + 0x12cc: 0x78d1, 0x12cd: 0x78d1, 0x12ce: 0x78e9, 0x12cf: 0x78e9, 0x12d0: 0x78e9, 0x12d1: 0x78e9, + 0x12d2: 0x7901, 0x12d3: 0x7901, 0x12d4: 0x7901, 0x12d5: 0x7901, 0x12d6: 0x7919, 0x12d7: 0x7919, + 0x12d8: 0x7919, 0x12d9: 0x7919, 0x12da: 0x7931, 0x12db: 0x7931, 0x12dc: 0x7931, 0x12dd: 0x7931, + 0x12de: 0x7949, 0x12df: 0x7949, 0x12e0: 0x7961, 0x12e1: 0x7961, 0x12e2: 0x7961, 0x12e3: 0x7961, + 0x12e4: 0x7979, 0x12e5: 0x7979, 0x12e6: 0x7991, 0x12e7: 0x7991, 0x12e8: 0x7991, 0x12e9: 0x7991, + 0x12ea: 0x79a9, 0x12eb: 0x79a9, 0x12ec: 0x79a9, 0x12ed: 0x79a9, 0x12ee: 0x79c1, 0x12ef: 0x79c1, + 0x12f0: 0x79d9, 0x12f1: 0x79d9, 0x12f2: 0x0018, 0x12f3: 0x0018, 0x12f4: 0x0018, 0x12f5: 0x0018, + 0x12f6: 0x0018, 0x12f7: 0x0018, 0x12f8: 0x0018, 0x12f9: 0x0018, 0x12fa: 0x0018, 0x12fb: 0x0018, + 0x12fc: 0x0018, 0x12fd: 0x0018, 0x12fe: 0x0018, 0x12ff: 0x0018, + // Block 0x4c, offset 0x1300 + 0x1300: 0x0018, 0x1301: 0x0018, 0x1302: 0x0040, 0x1303: 0x0040, 0x1304: 0x0040, 0x1305: 0x0040, + 0x1306: 0x0040, 0x1307: 0x0040, 0x1308: 0x0040, 0x1309: 0x0040, 0x130a: 0x0040, 0x130b: 0x0040, + 0x130c: 0x0040, 0x130d: 0x0040, 0x130e: 0x0040, 0x130f: 0x0040, 0x1310: 0x0040, 0x1311: 0x0040, + 0x1312: 0x0040, 0x1313: 0x79f1, 0x1314: 0x79f1, 0x1315: 0x79f1, 0x1316: 0x79f1, 0x1317: 0x7a09, + 0x1318: 0x7a09, 0x1319: 0x7a21, 0x131a: 0x7a21, 0x131b: 0x7a39, 0x131c: 0x7a39, 0x131d: 0x0479, + 0x131e: 0x7a51, 0x131f: 0x7a51, 0x1320: 0x7a69, 0x1321: 0x7a69, 0x1322: 0x7a81, 0x1323: 0x7a81, + 0x1324: 0x7a99, 0x1325: 0x7a99, 0x1326: 0x7a99, 0x1327: 0x7a99, 0x1328: 0x7ab1, 0x1329: 0x7ab1, + 0x132a: 0x7ac9, 0x132b: 0x7ac9, 0x132c: 0x7af1, 0x132d: 0x7af1, 0x132e: 0x7b19, 0x132f: 0x7b19, + 0x1330: 0x7b41, 0x1331: 0x7b41, 0x1332: 0x7b69, 0x1333: 0x7b69, 0x1334: 0x7b91, 0x1335: 0x7b91, + 0x1336: 0x7bb9, 0x1337: 0x7bb9, 0x1338: 0x7bb9, 0x1339: 0x7be1, 0x133a: 0x7be1, 0x133b: 0x7be1, + 0x133c: 0x7c09, 0x133d: 0x7c09, 0x133e: 0x7c09, 0x133f: 0x7c09, + // Block 0x4d, offset 0x1340 + 0x1340: 0x85f9, 0x1341: 0x8621, 0x1342: 0x8649, 0x1343: 0x8671, 0x1344: 0x8699, 0x1345: 0x86c1, + 0x1346: 0x86e9, 0x1347: 0x8711, 0x1348: 0x8739, 0x1349: 0x8761, 0x134a: 0x8789, 0x134b: 0x87b1, + 0x134c: 0x87d9, 0x134d: 0x8801, 0x134e: 0x8829, 0x134f: 0x8851, 0x1350: 0x8879, 0x1351: 0x88a1, + 0x1352: 0x88c9, 0x1353: 0x88f1, 0x1354: 0x8919, 0x1355: 0x8941, 0x1356: 0x8969, 0x1357: 0x8991, + 0x1358: 0x89b9, 0x1359: 0x89e1, 0x135a: 0x8a09, 0x135b: 0x8a31, 0x135c: 0x8a59, 0x135d: 0x8a81, + 0x135e: 0x8aaa, 0x135f: 0x8ada, 0x1360: 0x8b0a, 0x1361: 0x8b3a, 0x1362: 0x8b6a, 0x1363: 0x8b9a, + 0x1364: 0x8bc9, 0x1365: 0x8bf1, 0x1366: 0x7c71, 0x1367: 0x8c19, 0x1368: 0x7be1, 0x1369: 0x7c99, + 0x136a: 0x8c41, 0x136b: 0x8c69, 0x136c: 0x7d39, 0x136d: 0x8c91, 0x136e: 0x7d61, 0x136f: 0x7d89, + 0x1370: 0x8cb9, 0x1371: 0x8ce1, 0x1372: 0x7e29, 0x1373: 0x8d09, 0x1374: 0x7e51, 0x1375: 0x7e79, + 0x1376: 0x8d31, 0x1377: 0x8d59, 0x1378: 0x7ec9, 0x1379: 0x8d81, 0x137a: 0x7ef1, 0x137b: 0x7f19, + 0x137c: 0x83a1, 0x137d: 0x83c9, 0x137e: 0x8441, 0x137f: 0x8469, + // Block 0x4e, offset 0x1380 + 0x1380: 0x8491, 0x1381: 0x8531, 0x1382: 0x8559, 0x1383: 0x8581, 0x1384: 0x85a9, 0x1385: 0x8649, + 0x1386: 0x8671, 0x1387: 0x8699, 0x1388: 0x8da9, 0x1389: 0x8739, 0x138a: 0x8dd1, 0x138b: 0x8df9, + 0x138c: 0x8829, 0x138d: 0x8e21, 0x138e: 0x8851, 0x138f: 0x8879, 0x1390: 0x8a81, 0x1391: 0x8e49, + 0x1392: 0x8e71, 0x1393: 0x89b9, 0x1394: 0x8e99, 0x1395: 0x89e1, 0x1396: 0x8a09, 0x1397: 0x7c21, + 0x1398: 0x7c49, 0x1399: 0x8ec1, 0x139a: 0x7c71, 0x139b: 0x8ee9, 0x139c: 0x7cc1, 0x139d: 0x7ce9, + 0x139e: 0x7d11, 0x139f: 0x7d39, 0x13a0: 0x8f11, 0x13a1: 0x7db1, 0x13a2: 0x7dd9, 0x13a3: 0x7e01, + 0x13a4: 0x7e29, 0x13a5: 0x8f39, 0x13a6: 0x7ec9, 0x13a7: 0x7f41, 0x13a8: 0x7f69, 0x13a9: 0x7f91, + 0x13aa: 0x7fb9, 0x13ab: 0x7fe1, 0x13ac: 0x8031, 0x13ad: 0x8059, 0x13ae: 0x8081, 0x13af: 0x80a9, + 0x13b0: 0x80d1, 0x13b1: 0x80f9, 0x13b2: 0x8f61, 0x13b3: 0x8121, 0x13b4: 0x8149, 0x13b5: 0x8171, + 0x13b6: 0x8199, 0x13b7: 0x81c1, 0x13b8: 0x81e9, 0x13b9: 0x8239, 0x13ba: 0x8261, 0x13bb: 0x8289, + 0x13bc: 0x82b1, 0x13bd: 0x82d9, 0x13be: 0x8301, 0x13bf: 0x8329, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x8351, 0x13c1: 0x8379, 0x13c2: 0x83f1, 0x13c3: 0x8419, 0x13c4: 0x84b9, 0x13c5: 0x84e1, + 0x13c6: 0x8509, 0x13c7: 0x8531, 0x13c8: 0x8559, 0x13c9: 0x85d1, 0x13ca: 0x85f9, 0x13cb: 0x8621, + 0x13cc: 0x8649, 0x13cd: 0x8f89, 0x13ce: 0x86c1, 0x13cf: 0x86e9, 0x13d0: 0x8711, 0x13d1: 0x8739, + 0x13d2: 0x87b1, 0x13d3: 0x87d9, 0x13d4: 0x8801, 0x13d5: 0x8829, 0x13d6: 0x8fb1, 0x13d7: 0x88a1, + 0x13d8: 0x88c9, 0x13d9: 0x8fd9, 0x13da: 0x8941, 0x13db: 0x8969, 0x13dc: 0x8991, 0x13dd: 0x89b9, + 0x13de: 0x9001, 0x13df: 0x7c71, 0x13e0: 0x8ee9, 0x13e1: 0x7d39, 0x13e2: 0x8f11, 0x13e3: 0x7e29, + 0x13e4: 0x8f39, 0x13e5: 0x7ec9, 0x13e6: 0x9029, 0x13e7: 0x80d1, 0x13e8: 0x9051, 0x13e9: 0x9079, + 0x13ea: 0x90a1, 0x13eb: 0x8531, 0x13ec: 0x8559, 0x13ed: 0x8649, 0x13ee: 0x8829, 0x13ef: 0x8fb1, + 0x13f0: 0x89b9, 0x13f1: 0x9001, 0x13f2: 0x90c9, 0x13f3: 0x9101, 0x13f4: 0x9139, 0x13f5: 0x9171, + 0x13f6: 0x9199, 0x13f7: 0x91c1, 0x13f8: 0x91e9, 0x13f9: 0x9211, 0x13fa: 0x9239, 0x13fb: 0x9261, + 0x13fc: 0x9289, 0x13fd: 0x92b1, 0x13fe: 0x92d9, 0x13ff: 0x9301, + // Block 0x50, offset 0x1400 + 0x1400: 0x9329, 0x1401: 0x9351, 0x1402: 0x9379, 0x1403: 0x93a1, 0x1404: 0x93c9, 0x1405: 0x93f1, + 0x1406: 0x9419, 0x1407: 0x9441, 0x1408: 0x9469, 0x1409: 0x9491, 0x140a: 0x94b9, 0x140b: 0x94e1, + 0x140c: 0x9079, 0x140d: 0x9509, 0x140e: 0x9531, 0x140f: 0x9559, 0x1410: 0x9581, 0x1411: 0x9171, + 0x1412: 0x9199, 0x1413: 0x91c1, 0x1414: 0x91e9, 0x1415: 0x9211, 0x1416: 0x9239, 0x1417: 0x9261, + 0x1418: 0x9289, 0x1419: 0x92b1, 0x141a: 0x92d9, 0x141b: 0x9301, 0x141c: 0x9329, 0x141d: 0x9351, + 0x141e: 0x9379, 0x141f: 0x93a1, 0x1420: 0x93c9, 0x1421: 0x93f1, 0x1422: 0x9419, 0x1423: 0x9441, + 0x1424: 0x9469, 0x1425: 0x9491, 0x1426: 0x94b9, 0x1427: 0x94e1, 0x1428: 0x9079, 0x1429: 0x9509, + 0x142a: 0x9531, 0x142b: 0x9559, 0x142c: 0x9581, 0x142d: 0x9491, 0x142e: 0x94b9, 0x142f: 0x94e1, + 0x1430: 0x9079, 0x1431: 0x9051, 0x1432: 0x90a1, 0x1433: 0x8211, 0x1434: 0x8059, 0x1435: 0x8081, + 0x1436: 0x80a9, 0x1437: 0x9491, 0x1438: 0x94b9, 0x1439: 0x94e1, 0x143a: 0x8211, 0x143b: 0x8239, + 0x143c: 0x95a9, 0x143d: 0x95a9, 0x143e: 0x0018, 0x143f: 0x0018, + // Block 0x51, offset 0x1440 + 0x1440: 0x0040, 0x1441: 0x0040, 0x1442: 0x0040, 0x1443: 0x0040, 0x1444: 0x0040, 0x1445: 0x0040, + 0x1446: 0x0040, 0x1447: 0x0040, 0x1448: 0x0040, 0x1449: 0x0040, 0x144a: 0x0040, 0x144b: 0x0040, + 0x144c: 0x0040, 0x144d: 0x0040, 0x144e: 0x0040, 0x144f: 0x0040, 0x1450: 0x95d1, 0x1451: 0x9609, + 0x1452: 0x9609, 0x1453: 0x9641, 0x1454: 0x9679, 0x1455: 0x96b1, 0x1456: 0x96e9, 0x1457: 0x9721, + 0x1458: 0x9759, 0x1459: 0x9759, 0x145a: 0x9791, 0x145b: 0x97c9, 0x145c: 0x9801, 0x145d: 0x9839, + 0x145e: 0x9871, 0x145f: 0x98a9, 0x1460: 0x98a9, 0x1461: 0x98e1, 0x1462: 0x9919, 0x1463: 0x9919, + 0x1464: 0x9951, 0x1465: 0x9951, 0x1466: 0x9989, 0x1467: 0x99c1, 0x1468: 0x99c1, 0x1469: 0x99f9, + 0x146a: 0x9a31, 0x146b: 0x9a31, 0x146c: 0x9a69, 0x146d: 0x9a69, 0x146e: 0x9aa1, 0x146f: 0x9ad9, + 0x1470: 0x9ad9, 0x1471: 0x9b11, 0x1472: 0x9b11, 0x1473: 0x9b49, 0x1474: 0x9b81, 0x1475: 0x9bb9, + 0x1476: 0x9bf1, 0x1477: 0x9bf1, 0x1478: 0x9c29, 0x1479: 0x9c61, 0x147a: 0x9c99, 0x147b: 0x9cd1, + 0x147c: 0x9d09, 0x147d: 0x9d09, 0x147e: 0x9d41, 0x147f: 0x9d79, + // Block 0x52, offset 0x1480 + 0x1480: 0xa949, 0x1481: 0xa981, 0x1482: 0xa9b9, 0x1483: 0xa8a1, 0x1484: 0x9bb9, 0x1485: 0x9989, + 0x1486: 0xa9f1, 0x1487: 0xaa29, 0x1488: 0x0040, 0x1489: 0x0040, 0x148a: 0x0040, 0x148b: 0x0040, + 0x148c: 0x0040, 0x148d: 0x0040, 0x148e: 0x0040, 0x148f: 0x0040, 0x1490: 0x0040, 0x1491: 0x0040, + 0x1492: 0x0040, 0x1493: 0x0040, 0x1494: 0x0040, 0x1495: 0x0040, 0x1496: 0x0040, 0x1497: 0x0040, + 0x1498: 0x0040, 0x1499: 0x0040, 0x149a: 0x0040, 0x149b: 0x0040, 0x149c: 0x0040, 0x149d: 0x0040, + 0x149e: 0x0040, 0x149f: 0x0040, 0x14a0: 0x0040, 0x14a1: 0x0040, 0x14a2: 0x0040, 0x14a3: 0x0040, + 0x14a4: 0x0040, 0x14a5: 0x0040, 0x14a6: 0x0040, 0x14a7: 0x0040, 0x14a8: 0x0040, 0x14a9: 0x0040, + 0x14aa: 0x0040, 0x14ab: 0x0040, 0x14ac: 0x0040, 0x14ad: 0x0040, 0x14ae: 0x0040, 0x14af: 0x0040, + 0x14b0: 0xaa61, 0x14b1: 0xaa99, 0x14b2: 0xaad1, 0x14b3: 0xab19, 0x14b4: 0xab61, 0x14b5: 0xaba9, + 0x14b6: 0xabf1, 0x14b7: 0xac39, 0x14b8: 0xac81, 0x14b9: 0xacc9, 0x14ba: 0xad02, 0x14bb: 0xae12, + 0x14bc: 0xae91, 0x14bd: 0x0018, 0x14be: 0x0040, 0x14bf: 0x0040, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x13c0, 0x14c1: 0x13c0, 0x14c2: 0x13c0, 0x14c3: 0x13c0, 0x14c4: 0x13c0, 0x14c5: 0x13c0, + 0x14c6: 0x13c0, 0x14c7: 0x13c0, 0x14c8: 0x13c0, 0x14c9: 0x13c0, 0x14ca: 0x13c0, 0x14cb: 0x13c0, + 0x14cc: 0x13c0, 0x14cd: 0x13c0, 0x14ce: 0x13c0, 0x14cf: 0x13c0, 0x14d0: 0xaeda, 0x14d1: 0x7d55, + 0x14d2: 0x0040, 0x14d3: 0xaeea, 0x14d4: 0x03c2, 0x14d5: 0xaefa, 0x14d6: 0xaf0a, 0x14d7: 0x7d75, + 0x14d8: 0x7d95, 0x14d9: 0x0040, 0x14da: 0x0040, 0x14db: 0x0040, 0x14dc: 0x0040, 0x14dd: 0x0040, + 0x14de: 0x0040, 0x14df: 0x0040, 0x14e0: 0x1308, 0x14e1: 0x1308, 0x14e2: 0x1308, 0x14e3: 0x1308, + 0x14e4: 0x1308, 0x14e5: 0x1308, 0x14e6: 0x1308, 0x14e7: 0x1308, 0x14e8: 0x1308, 0x14e9: 0x1308, + 0x14ea: 0x1308, 0x14eb: 0x1308, 0x14ec: 0x1308, 0x14ed: 0x1308, 0x14ee: 0x1308, 0x14ef: 0x1308, + 0x14f0: 0x0040, 0x14f1: 0x7db5, 0x14f2: 0x7dd5, 0x14f3: 0xaf1a, 0x14f4: 0xaf1a, 0x14f5: 0x1fd2, + 0x14f6: 0x1fe2, 0x14f7: 0xaf2a, 0x14f8: 0xaf3a, 0x14f9: 0x7df5, 0x14fa: 0x7e15, 0x14fb: 0x7e35, + 0x14fc: 0x7df5, 0x14fd: 0x7e55, 0x14fe: 0x7e75, 0x14ff: 0x7e55, + // Block 0x54, offset 0x1500 + 0x1500: 0x7e95, 0x1501: 0x7eb5, 0x1502: 0x7ed5, 0x1503: 0x7eb5, 0x1504: 0x7ef5, 0x1505: 0x0018, + 0x1506: 0x0018, 0x1507: 0xaf4a, 0x1508: 0xaf5a, 0x1509: 0x7f16, 0x150a: 0x7f36, 0x150b: 0x7f56, + 0x150c: 0x7f76, 0x150d: 0xaf1a, 0x150e: 0xaf1a, 0x150f: 0xaf1a, 0x1510: 0xaeda, 0x1511: 0x7f95, + 0x1512: 0x0040, 0x1513: 0x0040, 0x1514: 0x03c2, 0x1515: 0xaeea, 0x1516: 0xaf0a, 0x1517: 0xaefa, + 0x1518: 0x7fb5, 0x1519: 0x1fd2, 0x151a: 0x1fe2, 0x151b: 0xaf2a, 0x151c: 0xaf3a, 0x151d: 0x7e95, + 0x151e: 0x7ef5, 0x151f: 0xaf6a, 0x1520: 0xaf7a, 0x1521: 0xaf8a, 0x1522: 0x1fb2, 0x1523: 0xaf99, + 0x1524: 0xafaa, 0x1525: 0xafba, 0x1526: 0x1fc2, 0x1527: 0x0040, 0x1528: 0xafca, 0x1529: 0xafda, + 0x152a: 0xafea, 0x152b: 0xaffa, 0x152c: 0x0040, 0x152d: 0x0040, 0x152e: 0x0040, 0x152f: 0x0040, + 0x1530: 0x7fd6, 0x1531: 0xb009, 0x1532: 0x7ff6, 0x1533: 0x0008, 0x1534: 0x8016, 0x1535: 0x0040, + 0x1536: 0x8036, 0x1537: 0xb031, 0x1538: 0x8056, 0x1539: 0xb059, 0x153a: 0x8076, 0x153b: 0xb081, + 0x153c: 0x8096, 0x153d: 0xb0a9, 0x153e: 0x80b6, 0x153f: 0xb0d1, + // Block 0x55, offset 0x1540 + 0x1540: 0xb0f9, 0x1541: 0xb111, 0x1542: 0xb111, 0x1543: 0xb129, 0x1544: 0xb129, 0x1545: 0xb141, + 0x1546: 0xb141, 0x1547: 0xb159, 0x1548: 0xb159, 0x1549: 0xb171, 0x154a: 0xb171, 0x154b: 0xb171, + 0x154c: 0xb171, 0x154d: 0xb189, 0x154e: 0xb189, 0x154f: 0xb1a1, 0x1550: 0xb1a1, 0x1551: 0xb1a1, + 0x1552: 0xb1a1, 0x1553: 0xb1b9, 0x1554: 0xb1b9, 0x1555: 0xb1d1, 0x1556: 0xb1d1, 0x1557: 0xb1d1, + 0x1558: 0xb1d1, 0x1559: 0xb1e9, 0x155a: 0xb1e9, 0x155b: 0xb1e9, 0x155c: 0xb1e9, 0x155d: 0xb201, + 0x155e: 0xb201, 0x155f: 0xb201, 0x1560: 0xb201, 0x1561: 0xb219, 0x1562: 0xb219, 0x1563: 0xb219, + 0x1564: 0xb219, 0x1565: 0xb231, 0x1566: 0xb231, 0x1567: 0xb231, 0x1568: 0xb231, 0x1569: 0xb249, + 0x156a: 0xb249, 0x156b: 0xb261, 0x156c: 0xb261, 0x156d: 0xb279, 0x156e: 0xb279, 0x156f: 0xb291, + 0x1570: 0xb291, 0x1571: 0xb2a9, 0x1572: 0xb2a9, 0x1573: 0xb2a9, 0x1574: 0xb2a9, 0x1575: 0xb2c1, + 0x1576: 0xb2c1, 0x1577: 0xb2c1, 0x1578: 0xb2c1, 0x1579: 0xb2d9, 0x157a: 0xb2d9, 0x157b: 0xb2d9, + 0x157c: 0xb2d9, 0x157d: 0xb2f1, 0x157e: 0xb2f1, 0x157f: 0xb2f1, + // Block 0x56, offset 0x1580 + 0x1580: 0xb2f1, 0x1581: 0xb309, 0x1582: 0xb309, 0x1583: 0xb309, 0x1584: 0xb309, 0x1585: 0xb321, + 0x1586: 0xb321, 0x1587: 0xb321, 0x1588: 0xb321, 0x1589: 0xb339, 0x158a: 0xb339, 0x158b: 0xb339, + 0x158c: 0xb339, 0x158d: 0xb351, 0x158e: 0xb351, 0x158f: 0xb351, 0x1590: 0xb351, 0x1591: 0xb369, + 0x1592: 0xb369, 0x1593: 0xb369, 0x1594: 0xb369, 0x1595: 0xb381, 0x1596: 0xb381, 0x1597: 0xb381, + 0x1598: 0xb381, 0x1599: 0xb399, 0x159a: 0xb399, 0x159b: 0xb399, 0x159c: 0xb399, 0x159d: 0xb3b1, + 0x159e: 0xb3b1, 0x159f: 0xb3b1, 0x15a0: 0xb3b1, 0x15a1: 0xb3c9, 0x15a2: 0xb3c9, 0x15a3: 0xb3c9, + 0x15a4: 0xb3c9, 0x15a5: 0xb3e1, 0x15a6: 0xb3e1, 0x15a7: 0xb3e1, 0x15a8: 0xb3e1, 0x15a9: 0xb3f9, + 0x15aa: 0xb3f9, 0x15ab: 0xb3f9, 0x15ac: 0xb3f9, 0x15ad: 0xb411, 0x15ae: 0xb411, 0x15af: 0x7ab1, + 0x15b0: 0x7ab1, 0x15b1: 0xb429, 0x15b2: 0xb429, 0x15b3: 0xb429, 0x15b4: 0xb429, 0x15b5: 0xb441, + 0x15b6: 0xb441, 0x15b7: 0xb469, 0x15b8: 0xb469, 0x15b9: 0xb491, 0x15ba: 0xb491, 0x15bb: 0xb4b9, + 0x15bc: 0xb4b9, 0x15bd: 0x0040, 0x15be: 0x0040, 0x15bf: 0x03c0, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x0040, 0x15c1: 0xaefa, 0x15c2: 0xb4e2, 0x15c3: 0xaf6a, 0x15c4: 0xafda, 0x15c5: 0xafea, + 0x15c6: 0xaf7a, 0x15c7: 0xb4f2, 0x15c8: 0x1fd2, 0x15c9: 0x1fe2, 0x15ca: 0xaf8a, 0x15cb: 0x1fb2, + 0x15cc: 0xaeda, 0x15cd: 0xaf99, 0x15ce: 0x29d1, 0x15cf: 0xb502, 0x15d0: 0x1f41, 0x15d1: 0x00c9, + 0x15d2: 0x0069, 0x15d3: 0x0079, 0x15d4: 0x1f51, 0x15d5: 0x1f61, 0x15d6: 0x1f71, 0x15d7: 0x1f81, + 0x15d8: 0x1f91, 0x15d9: 0x1fa1, 0x15da: 0xaeea, 0x15db: 0x03c2, 0x15dc: 0xafaa, 0x15dd: 0x1fc2, + 0x15de: 0xafba, 0x15df: 0xaf0a, 0x15e0: 0xaffa, 0x15e1: 0x0039, 0x15e2: 0x0ee9, 0x15e3: 0x1159, + 0x15e4: 0x0ef9, 0x15e5: 0x0f09, 0x15e6: 0x1199, 0x15e7: 0x0f31, 0x15e8: 0x0249, 0x15e9: 0x0f41, + 0x15ea: 0x0259, 0x15eb: 0x0f51, 0x15ec: 0x0359, 0x15ed: 0x0f61, 0x15ee: 0x0f71, 0x15ef: 0x00d9, + 0x15f0: 0x0f99, 0x15f1: 0x2039, 0x15f2: 0x0269, 0x15f3: 0x01d9, 0x15f4: 0x0fa9, 0x15f5: 0x0fb9, + 0x15f6: 0x1089, 0x15f7: 0x0279, 0x15f8: 0x0369, 0x15f9: 0x0289, 0x15fa: 0x13d1, 0x15fb: 0xaf4a, + 0x15fc: 0xafca, 0x15fd: 0xaf5a, 0x15fe: 0xb512, 0x15ff: 0xaf1a, + // Block 0x58, offset 0x1600 + 0x1600: 0x1caa, 0x1601: 0x0039, 0x1602: 0x0ee9, 0x1603: 0x1159, 0x1604: 0x0ef9, 0x1605: 0x0f09, + 0x1606: 0x1199, 0x1607: 0x0f31, 0x1608: 0x0249, 0x1609: 0x0f41, 0x160a: 0x0259, 0x160b: 0x0f51, + 0x160c: 0x0359, 0x160d: 0x0f61, 0x160e: 0x0f71, 0x160f: 0x00d9, 0x1610: 0x0f99, 0x1611: 0x2039, + 0x1612: 0x0269, 0x1613: 0x01d9, 0x1614: 0x0fa9, 0x1615: 0x0fb9, 0x1616: 0x1089, 0x1617: 0x0279, + 0x1618: 0x0369, 0x1619: 0x0289, 0x161a: 0x13d1, 0x161b: 0xaf2a, 0x161c: 0xb522, 0x161d: 0xaf3a, + 0x161e: 0xb532, 0x161f: 0x80d5, 0x1620: 0x80f5, 0x1621: 0x29d1, 0x1622: 0x8115, 0x1623: 0x8115, + 0x1624: 0x8135, 0x1625: 0x8155, 0x1626: 0x8175, 0x1627: 0x8195, 0x1628: 0x81b5, 0x1629: 0x81d5, + 0x162a: 0x81f5, 0x162b: 0x8215, 0x162c: 0x8235, 0x162d: 0x8255, 0x162e: 0x8275, 0x162f: 0x8295, + 0x1630: 0x82b5, 0x1631: 0x82d5, 0x1632: 0x82f5, 0x1633: 0x8315, 0x1634: 0x8335, 0x1635: 0x8355, + 0x1636: 0x8375, 0x1637: 0x8395, 0x1638: 0x83b5, 0x1639: 0x83d5, 0x163a: 0x83f5, 0x163b: 0x8415, + 0x163c: 0x81b5, 0x163d: 0x8435, 0x163e: 0x8455, 0x163f: 0x8215, + // Block 0x59, offset 0x1640 + 0x1640: 0x8475, 0x1641: 0x8495, 0x1642: 0x84b5, 0x1643: 0x84d5, 0x1644: 0x84f5, 0x1645: 0x8515, + 0x1646: 0x8535, 0x1647: 0x8555, 0x1648: 0x84d5, 0x1649: 0x8575, 0x164a: 0x84d5, 0x164b: 0x8595, + 0x164c: 0x8595, 0x164d: 0x85b5, 0x164e: 0x85b5, 0x164f: 0x85d5, 0x1650: 0x8515, 0x1651: 0x85f5, + 0x1652: 0x8615, 0x1653: 0x85f5, 0x1654: 0x8635, 0x1655: 0x8615, 0x1656: 0x8655, 0x1657: 0x8655, + 0x1658: 0x8675, 0x1659: 0x8675, 0x165a: 0x8695, 0x165b: 0x8695, 0x165c: 0x8615, 0x165d: 0x8115, + 0x165e: 0x86b5, 0x165f: 0x86d5, 0x1660: 0x0040, 0x1661: 0x86f5, 0x1662: 0x8715, 0x1663: 0x8735, + 0x1664: 0x8755, 0x1665: 0x8735, 0x1666: 0x8775, 0x1667: 0x8795, 0x1668: 0x87b5, 0x1669: 0x87b5, + 0x166a: 0x87d5, 0x166b: 0x87d5, 0x166c: 0x87f5, 0x166d: 0x87f5, 0x166e: 0x87d5, 0x166f: 0x87d5, + 0x1670: 0x8815, 0x1671: 0x8835, 0x1672: 0x8855, 0x1673: 0x8875, 0x1674: 0x8895, 0x1675: 0x88b5, + 0x1676: 0x88b5, 0x1677: 0x88b5, 0x1678: 0x88d5, 0x1679: 0x88d5, 0x167a: 0x88d5, 0x167b: 0x88d5, + 0x167c: 0x87b5, 0x167d: 0x87b5, 0x167e: 0x87b5, 0x167f: 0x0040, + // Block 0x5a, offset 0x1680 + 0x1680: 0x0040, 0x1681: 0x0040, 0x1682: 0x8715, 0x1683: 0x86f5, 0x1684: 0x88f5, 0x1685: 0x86f5, + 0x1686: 0x8715, 0x1687: 0x86f5, 0x1688: 0x0040, 0x1689: 0x0040, 0x168a: 0x8915, 0x168b: 0x8715, + 0x168c: 0x8935, 0x168d: 0x88f5, 0x168e: 0x8935, 0x168f: 0x8715, 0x1690: 0x0040, 0x1691: 0x0040, + 0x1692: 0x8955, 0x1693: 0x8975, 0x1694: 0x8875, 0x1695: 0x8935, 0x1696: 0x88f5, 0x1697: 0x8935, + 0x1698: 0x0040, 0x1699: 0x0040, 0x169a: 0x8995, 0x169b: 0x89b5, 0x169c: 0x8995, 0x169d: 0x0040, + 0x169e: 0x0040, 0x169f: 0x0040, 0x16a0: 0xb541, 0x16a1: 0xb559, 0x16a2: 0xb571, 0x16a3: 0x89d6, + 0x16a4: 0xb589, 0x16a5: 0xb5a1, 0x16a6: 0x89f5, 0x16a7: 0x0040, 0x16a8: 0x8a15, 0x16a9: 0x8a35, + 0x16aa: 0x8a55, 0x16ab: 0x8a35, 0x16ac: 0x8a75, 0x16ad: 0x8a95, 0x16ae: 0x8ab5, 0x16af: 0x0040, + 0x16b0: 0x0040, 0x16b1: 0x0040, 0x16b2: 0x0040, 0x16b3: 0x0040, 0x16b4: 0x0040, 0x16b5: 0x0040, + 0x16b6: 0x0040, 0x16b7: 0x0040, 0x16b8: 0x0040, 0x16b9: 0x0340, 0x16ba: 0x0340, 0x16bb: 0x0340, + 0x16bc: 0x0040, 0x16bd: 0x0040, 0x16be: 0x0040, 0x16bf: 0x0040, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x0208, 0x16c1: 0x0208, 0x16c2: 0x0208, 0x16c3: 0x0208, 0x16c4: 0x0208, 0x16c5: 0x0408, + 0x16c6: 0x0008, 0x16c7: 0x0408, 0x16c8: 0x0018, 0x16c9: 0x0408, 0x16ca: 0x0408, 0x16cb: 0x0008, + 0x16cc: 0x0008, 0x16cd: 0x0108, 0x16ce: 0x0408, 0x16cf: 0x0408, 0x16d0: 0x0408, 0x16d1: 0x0408, + 0x16d2: 0x0408, 0x16d3: 0x0208, 0x16d4: 0x0208, 0x16d5: 0x0208, 0x16d6: 0x0208, 0x16d7: 0x0108, + 0x16d8: 0x0208, 0x16d9: 0x0208, 0x16da: 0x0208, 0x16db: 0x0208, 0x16dc: 0x0208, 0x16dd: 0x0408, + 0x16de: 0x0208, 0x16df: 0x0208, 0x16e0: 0x0208, 0x16e1: 0x0408, 0x16e2: 0x0008, 0x16e3: 0x0008, + 0x16e4: 0x0408, 0x16e5: 0x1308, 0x16e6: 0x1308, 0x16e7: 0x0040, 0x16e8: 0x0040, 0x16e9: 0x0040, + 0x16ea: 0x0040, 0x16eb: 0x0218, 0x16ec: 0x0218, 0x16ed: 0x0218, 0x16ee: 0x0218, 0x16ef: 0x0418, + 0x16f0: 0x0018, 0x16f1: 0x0018, 0x16f2: 0x0018, 0x16f3: 0x0018, 0x16f4: 0x0018, 0x16f5: 0x0018, + 0x16f6: 0x0018, 0x16f7: 0x0040, 0x16f8: 0x0040, 0x16f9: 0x0040, 0x16fa: 0x0040, 0x16fb: 0x0040, + 0x16fc: 0x0040, 0x16fd: 0x0040, 0x16fe: 0x0040, 0x16ff: 0x0040, + // Block 0x5c, offset 0x1700 + 0x1700: 0x0208, 0x1701: 0x0408, 0x1702: 0x0208, 0x1703: 0x0408, 0x1704: 0x0408, 0x1705: 0x0408, + 0x1706: 0x0208, 0x1707: 0x0208, 0x1708: 0x0208, 0x1709: 0x0408, 0x170a: 0x0208, 0x170b: 0x0208, + 0x170c: 0x0408, 0x170d: 0x0208, 0x170e: 0x0408, 0x170f: 0x0408, 0x1710: 0x0208, 0x1711: 0x0408, + 0x1712: 0x0040, 0x1713: 0x0040, 0x1714: 0x0040, 0x1715: 0x0040, 0x1716: 0x0040, 0x1717: 0x0040, + 0x1718: 0x0040, 0x1719: 0x0018, 0x171a: 0x0018, 0x171b: 0x0018, 0x171c: 0x0018, 0x171d: 0x0040, + 0x171e: 0x0040, 0x171f: 0x0040, 0x1720: 0x0040, 0x1721: 0x0040, 0x1722: 0x0040, 0x1723: 0x0040, + 0x1724: 0x0040, 0x1725: 0x0040, 0x1726: 0x0040, 0x1727: 0x0040, 0x1728: 0x0040, 0x1729: 0x0418, + 0x172a: 0x0418, 0x172b: 0x0418, 0x172c: 0x0418, 0x172d: 0x0218, 0x172e: 0x0218, 0x172f: 0x0018, + 0x1730: 0x0040, 0x1731: 0x0040, 0x1732: 0x0040, 0x1733: 0x0040, 0x1734: 0x0040, 0x1735: 0x0040, + 0x1736: 0x0040, 0x1737: 0x0040, 0x1738: 0x0040, 0x1739: 0x0040, 0x173a: 0x0040, 0x173b: 0x0040, + 0x173c: 0x0040, 0x173d: 0x0040, 0x173e: 0x0040, 0x173f: 0x0040, + // Block 0x5d, offset 0x1740 + 0x1740: 0x1308, 0x1741: 0x1308, 0x1742: 0x1008, 0x1743: 0x1008, 0x1744: 0x0040, 0x1745: 0x0008, + 0x1746: 0x0008, 0x1747: 0x0008, 0x1748: 0x0008, 0x1749: 0x0008, 0x174a: 0x0008, 0x174b: 0x0008, + 0x174c: 0x0008, 0x174d: 0x0040, 0x174e: 0x0040, 0x174f: 0x0008, 0x1750: 0x0008, 0x1751: 0x0040, + 0x1752: 0x0040, 0x1753: 0x0008, 0x1754: 0x0008, 0x1755: 0x0008, 0x1756: 0x0008, 0x1757: 0x0008, + 0x1758: 0x0008, 0x1759: 0x0008, 0x175a: 0x0008, 0x175b: 0x0008, 0x175c: 0x0008, 0x175d: 0x0008, + 0x175e: 0x0008, 0x175f: 0x0008, 0x1760: 0x0008, 0x1761: 0x0008, 0x1762: 0x0008, 0x1763: 0x0008, + 0x1764: 0x0008, 0x1765: 0x0008, 0x1766: 0x0008, 0x1767: 0x0008, 0x1768: 0x0008, 0x1769: 0x0040, + 0x176a: 0x0008, 0x176b: 0x0008, 0x176c: 0x0008, 0x176d: 0x0008, 0x176e: 0x0008, 0x176f: 0x0008, + 0x1770: 0x0008, 0x1771: 0x0040, 0x1772: 0x0008, 0x1773: 0x0008, 0x1774: 0x0040, 0x1775: 0x0008, + 0x1776: 0x0008, 0x1777: 0x0008, 0x1778: 0x0008, 0x1779: 0x0008, 0x177a: 0x0040, 0x177b: 0x0040, + 0x177c: 0x1308, 0x177d: 0x0008, 0x177e: 0x1008, 0x177f: 0x1008, + // Block 0x5e, offset 0x1780 + 0x1780: 0x1308, 0x1781: 0x1008, 0x1782: 0x1008, 0x1783: 0x1008, 0x1784: 0x1008, 0x1785: 0x0040, + 0x1786: 0x0040, 0x1787: 0x1008, 0x1788: 0x1008, 0x1789: 0x0040, 0x178a: 0x0040, 0x178b: 0x1008, + 0x178c: 0x1008, 0x178d: 0x1808, 0x178e: 0x0040, 0x178f: 0x0040, 0x1790: 0x0008, 0x1791: 0x0040, + 0x1792: 0x0040, 0x1793: 0x0040, 0x1794: 0x0040, 0x1795: 0x0040, 0x1796: 0x0040, 0x1797: 0x1008, + 0x1798: 0x0040, 0x1799: 0x0040, 0x179a: 0x0040, 0x179b: 0x0040, 0x179c: 0x0040, 0x179d: 0x0008, + 0x179e: 0x0008, 0x179f: 0x0008, 0x17a0: 0x0008, 0x17a1: 0x0008, 0x17a2: 0x1008, 0x17a3: 0x1008, + 0x17a4: 0x0040, 0x17a5: 0x0040, 0x17a6: 0x1308, 0x17a7: 0x1308, 0x17a8: 0x1308, 0x17a9: 0x1308, + 0x17aa: 0x1308, 0x17ab: 0x1308, 0x17ac: 0x1308, 0x17ad: 0x0040, 0x17ae: 0x0040, 0x17af: 0x0040, + 0x17b0: 0x1308, 0x17b1: 0x1308, 0x17b2: 0x1308, 0x17b3: 0x1308, 0x17b4: 0x1308, 0x17b5: 0x0040, + 0x17b6: 0x0040, 0x17b7: 0x0040, 0x17b8: 0x0040, 0x17b9: 0x0040, 0x17ba: 0x0040, 0x17bb: 0x0040, + 0x17bc: 0x0040, 0x17bd: 0x0040, 0x17be: 0x0040, 0x17bf: 0x0040, + // Block 0x5f, offset 0x17c0 + 0x17c0: 0x0039, 0x17c1: 0x0ee9, 0x17c2: 0x1159, 0x17c3: 0x0ef9, 0x17c4: 0x0f09, 0x17c5: 0x1199, + 0x17c6: 0x0f31, 0x17c7: 0x0249, 0x17c8: 0x0f41, 0x17c9: 0x0259, 0x17ca: 0x0f51, 0x17cb: 0x0359, + 0x17cc: 0x0f61, 0x17cd: 0x0f71, 0x17ce: 0x00d9, 0x17cf: 0x0f99, 0x17d0: 0x2039, 0x17d1: 0x0269, + 0x17d2: 0x01d9, 0x17d3: 0x0fa9, 0x17d4: 0x0fb9, 0x17d5: 0x1089, 0x17d6: 0x0279, 0x17d7: 0x0369, + 0x17d8: 0x0289, 0x17d9: 0x13d1, 0x17da: 0x0039, 0x17db: 0x0ee9, 0x17dc: 0x1159, 0x17dd: 0x0ef9, + 0x17de: 0x0f09, 0x17df: 0x1199, 0x17e0: 0x0f31, 0x17e1: 0x0249, 0x17e2: 0x0f41, 0x17e3: 0x0259, + 0x17e4: 0x0f51, 0x17e5: 0x0359, 0x17e6: 0x0f61, 0x17e7: 0x0f71, 0x17e8: 0x00d9, 0x17e9: 0x0f99, + 0x17ea: 0x2039, 0x17eb: 0x0269, 0x17ec: 0x01d9, 0x17ed: 0x0fa9, 0x17ee: 0x0fb9, 0x17ef: 0x1089, + 0x17f0: 0x0279, 0x17f1: 0x0369, 0x17f2: 0x0289, 0x17f3: 0x13d1, 0x17f4: 0x0039, 0x17f5: 0x0ee9, + 0x17f6: 0x1159, 0x17f7: 0x0ef9, 0x17f8: 0x0f09, 0x17f9: 0x1199, 0x17fa: 0x0f31, 0x17fb: 0x0249, + 0x17fc: 0x0f41, 0x17fd: 0x0259, 0x17fe: 0x0f51, 0x17ff: 0x0359, + // Block 0x60, offset 0x1800 + 0x1800: 0x0f61, 0x1801: 0x0f71, 0x1802: 0x00d9, 0x1803: 0x0f99, 0x1804: 0x2039, 0x1805: 0x0269, + 0x1806: 0x01d9, 0x1807: 0x0fa9, 0x1808: 0x0fb9, 0x1809: 0x1089, 0x180a: 0x0279, 0x180b: 0x0369, + 0x180c: 0x0289, 0x180d: 0x13d1, 0x180e: 0x0039, 0x180f: 0x0ee9, 0x1810: 0x1159, 0x1811: 0x0ef9, + 0x1812: 0x0f09, 0x1813: 0x1199, 0x1814: 0x0f31, 0x1815: 0x0040, 0x1816: 0x0f41, 0x1817: 0x0259, + 0x1818: 0x0f51, 0x1819: 0x0359, 0x181a: 0x0f61, 0x181b: 0x0f71, 0x181c: 0x00d9, 0x181d: 0x0f99, + 0x181e: 0x2039, 0x181f: 0x0269, 0x1820: 0x01d9, 0x1821: 0x0fa9, 0x1822: 0x0fb9, 0x1823: 0x1089, + 0x1824: 0x0279, 0x1825: 0x0369, 0x1826: 0x0289, 0x1827: 0x13d1, 0x1828: 0x0039, 0x1829: 0x0ee9, + 0x182a: 0x1159, 0x182b: 0x0ef9, 0x182c: 0x0f09, 0x182d: 0x1199, 0x182e: 0x0f31, 0x182f: 0x0249, + 0x1830: 0x0f41, 0x1831: 0x0259, 0x1832: 0x0f51, 0x1833: 0x0359, 0x1834: 0x0f61, 0x1835: 0x0f71, + 0x1836: 0x00d9, 0x1837: 0x0f99, 0x1838: 0x2039, 0x1839: 0x0269, 0x183a: 0x01d9, 0x183b: 0x0fa9, + 0x183c: 0x0fb9, 0x183d: 0x1089, 0x183e: 0x0279, 0x183f: 0x0369, + // Block 0x61, offset 0x1840 + 0x1840: 0x0289, 0x1841: 0x13d1, 0x1842: 0x0039, 0x1843: 0x0ee9, 0x1844: 0x1159, 0x1845: 0x0ef9, + 0x1846: 0x0f09, 0x1847: 0x1199, 0x1848: 0x0f31, 0x1849: 0x0249, 0x184a: 0x0f41, 0x184b: 0x0259, + 0x184c: 0x0f51, 0x184d: 0x0359, 0x184e: 0x0f61, 0x184f: 0x0f71, 0x1850: 0x00d9, 0x1851: 0x0f99, + 0x1852: 0x2039, 0x1853: 0x0269, 0x1854: 0x01d9, 0x1855: 0x0fa9, 0x1856: 0x0fb9, 0x1857: 0x1089, + 0x1858: 0x0279, 0x1859: 0x0369, 0x185a: 0x0289, 0x185b: 0x13d1, 0x185c: 0x0039, 0x185d: 0x0040, + 0x185e: 0x1159, 0x185f: 0x0ef9, 0x1860: 0x0040, 0x1861: 0x0040, 0x1862: 0x0f31, 0x1863: 0x0040, + 0x1864: 0x0040, 0x1865: 0x0259, 0x1866: 0x0f51, 0x1867: 0x0040, 0x1868: 0x0040, 0x1869: 0x0f71, + 0x186a: 0x00d9, 0x186b: 0x0f99, 0x186c: 0x2039, 0x186d: 0x0040, 0x186e: 0x01d9, 0x186f: 0x0fa9, + 0x1870: 0x0fb9, 0x1871: 0x1089, 0x1872: 0x0279, 0x1873: 0x0369, 0x1874: 0x0289, 0x1875: 0x13d1, + 0x1876: 0x0039, 0x1877: 0x0ee9, 0x1878: 0x1159, 0x1879: 0x0ef9, 0x187a: 0x0040, 0x187b: 0x1199, + 0x187c: 0x0040, 0x187d: 0x0249, 0x187e: 0x0f41, 0x187f: 0x0259, + // Block 0x62, offset 0x1880 + 0x1880: 0x0f51, 0x1881: 0x0359, 0x1882: 0x0f61, 0x1883: 0x0f71, 0x1884: 0x0040, 0x1885: 0x0f99, + 0x1886: 0x2039, 0x1887: 0x0269, 0x1888: 0x01d9, 0x1889: 0x0fa9, 0x188a: 0x0fb9, 0x188b: 0x1089, + 0x188c: 0x0279, 0x188d: 0x0369, 0x188e: 0x0289, 0x188f: 0x13d1, 0x1890: 0x0039, 0x1891: 0x0ee9, + 0x1892: 0x1159, 0x1893: 0x0ef9, 0x1894: 0x0f09, 0x1895: 0x1199, 0x1896: 0x0f31, 0x1897: 0x0249, + 0x1898: 0x0f41, 0x1899: 0x0259, 0x189a: 0x0f51, 0x189b: 0x0359, 0x189c: 0x0f61, 0x189d: 0x0f71, + 0x189e: 0x00d9, 0x189f: 0x0f99, 0x18a0: 0x2039, 0x18a1: 0x0269, 0x18a2: 0x01d9, 0x18a3: 0x0fa9, + 0x18a4: 0x0fb9, 0x18a5: 0x1089, 0x18a6: 0x0279, 0x18a7: 0x0369, 0x18a8: 0x0289, 0x18a9: 0x13d1, + 0x18aa: 0x0039, 0x18ab: 0x0ee9, 0x18ac: 0x1159, 0x18ad: 0x0ef9, 0x18ae: 0x0f09, 0x18af: 0x1199, + 0x18b0: 0x0f31, 0x18b1: 0x0249, 0x18b2: 0x0f41, 0x18b3: 0x0259, 0x18b4: 0x0f51, 0x18b5: 0x0359, + 0x18b6: 0x0f61, 0x18b7: 0x0f71, 0x18b8: 0x00d9, 0x18b9: 0x0f99, 0x18ba: 0x2039, 0x18bb: 0x0269, + 0x18bc: 0x01d9, 0x18bd: 0x0fa9, 0x18be: 0x0fb9, 0x18bf: 0x1089, + // Block 0x63, offset 0x18c0 + 0x18c0: 0x0279, 0x18c1: 0x0369, 0x18c2: 0x0289, 0x18c3: 0x13d1, 0x18c4: 0x0039, 0x18c5: 0x0ee9, + 0x18c6: 0x0040, 0x18c7: 0x0ef9, 0x18c8: 0x0f09, 0x18c9: 0x1199, 0x18ca: 0x0f31, 0x18cb: 0x0040, + 0x18cc: 0x0040, 0x18cd: 0x0259, 0x18ce: 0x0f51, 0x18cf: 0x0359, 0x18d0: 0x0f61, 0x18d1: 0x0f71, + 0x18d2: 0x00d9, 0x18d3: 0x0f99, 0x18d4: 0x2039, 0x18d5: 0x0040, 0x18d6: 0x01d9, 0x18d7: 0x0fa9, + 0x18d8: 0x0fb9, 0x18d9: 0x1089, 0x18da: 0x0279, 0x18db: 0x0369, 0x18dc: 0x0289, 0x18dd: 0x0040, + 0x18de: 0x0039, 0x18df: 0x0ee9, 0x18e0: 0x1159, 0x18e1: 0x0ef9, 0x18e2: 0x0f09, 0x18e3: 0x1199, + 0x18e4: 0x0f31, 0x18e5: 0x0249, 0x18e6: 0x0f41, 0x18e7: 0x0259, 0x18e8: 0x0f51, 0x18e9: 0x0359, + 0x18ea: 0x0f61, 0x18eb: 0x0f71, 0x18ec: 0x00d9, 0x18ed: 0x0f99, 0x18ee: 0x2039, 0x18ef: 0x0269, + 0x18f0: 0x01d9, 0x18f1: 0x0fa9, 0x18f2: 0x0fb9, 0x18f3: 0x1089, 0x18f4: 0x0279, 0x18f5: 0x0369, + 0x18f6: 0x0289, 0x18f7: 0x13d1, 0x18f8: 0x0039, 0x18f9: 0x0ee9, 0x18fa: 0x0040, 0x18fb: 0x0ef9, + 0x18fc: 0x0f09, 0x18fd: 0x1199, 0x18fe: 0x0f31, 0x18ff: 0x0040, + // Block 0x64, offset 0x1900 + 0x1900: 0x0f41, 0x1901: 0x0259, 0x1902: 0x0f51, 0x1903: 0x0359, 0x1904: 0x0f61, 0x1905: 0x0040, + 0x1906: 0x00d9, 0x1907: 0x0040, 0x1908: 0x0040, 0x1909: 0x0040, 0x190a: 0x01d9, 0x190b: 0x0fa9, + 0x190c: 0x0fb9, 0x190d: 0x1089, 0x190e: 0x0279, 0x190f: 0x0369, 0x1910: 0x0289, 0x1911: 0x0040, + 0x1912: 0x0039, 0x1913: 0x0ee9, 0x1914: 0x1159, 0x1915: 0x0ef9, 0x1916: 0x0f09, 0x1917: 0x1199, + 0x1918: 0x0f31, 0x1919: 0x0249, 0x191a: 0x0f41, 0x191b: 0x0259, 0x191c: 0x0f51, 0x191d: 0x0359, + 0x191e: 0x0f61, 0x191f: 0x0f71, 0x1920: 0x00d9, 0x1921: 0x0f99, 0x1922: 0x2039, 0x1923: 0x0269, + 0x1924: 0x01d9, 0x1925: 0x0fa9, 0x1926: 0x0fb9, 0x1927: 0x1089, 0x1928: 0x0279, 0x1929: 0x0369, + 0x192a: 0x0289, 0x192b: 0x13d1, 0x192c: 0x0039, 0x192d: 0x0ee9, 0x192e: 0x1159, 0x192f: 0x0ef9, + 0x1930: 0x0f09, 0x1931: 0x1199, 0x1932: 0x0f31, 0x1933: 0x0249, 0x1934: 0x0f41, 0x1935: 0x0259, + 0x1936: 0x0f51, 0x1937: 0x0359, 0x1938: 0x0f61, 0x1939: 0x0f71, 0x193a: 0x00d9, 0x193b: 0x0f99, + 0x193c: 0x2039, 0x193d: 0x0269, 0x193e: 0x01d9, 0x193f: 0x0fa9, + // Block 0x65, offset 0x1940 + 0x1940: 0x0fb9, 0x1941: 0x1089, 0x1942: 0x0279, 0x1943: 0x0369, 0x1944: 0x0289, 0x1945: 0x13d1, + 0x1946: 0x0039, 0x1947: 0x0ee9, 0x1948: 0x1159, 0x1949: 0x0ef9, 0x194a: 0x0f09, 0x194b: 0x1199, + 0x194c: 0x0f31, 0x194d: 0x0249, 0x194e: 0x0f41, 0x194f: 0x0259, 0x1950: 0x0f51, 0x1951: 0x0359, + 0x1952: 0x0f61, 0x1953: 0x0f71, 0x1954: 0x00d9, 0x1955: 0x0f99, 0x1956: 0x2039, 0x1957: 0x0269, + 0x1958: 0x01d9, 0x1959: 0x0fa9, 0x195a: 0x0fb9, 0x195b: 0x1089, 0x195c: 0x0279, 0x195d: 0x0369, + 0x195e: 0x0289, 0x195f: 0x13d1, 0x1960: 0x0039, 0x1961: 0x0ee9, 0x1962: 0x1159, 0x1963: 0x0ef9, + 0x1964: 0x0f09, 0x1965: 0x1199, 0x1966: 0x0f31, 0x1967: 0x0249, 0x1968: 0x0f41, 0x1969: 0x0259, + 0x196a: 0x0f51, 0x196b: 0x0359, 0x196c: 0x0f61, 0x196d: 0x0f71, 0x196e: 0x00d9, 0x196f: 0x0f99, + 0x1970: 0x2039, 0x1971: 0x0269, 0x1972: 0x01d9, 0x1973: 0x0fa9, 0x1974: 0x0fb9, 0x1975: 0x1089, + 0x1976: 0x0279, 0x1977: 0x0369, 0x1978: 0x0289, 0x1979: 0x13d1, 0x197a: 0x0039, 0x197b: 0x0ee9, + 0x197c: 0x1159, 0x197d: 0x0ef9, 0x197e: 0x0f09, 0x197f: 0x1199, + // Block 0x66, offset 0x1980 + 0x1980: 0x0f31, 0x1981: 0x0249, 0x1982: 0x0f41, 0x1983: 0x0259, 0x1984: 0x0f51, 0x1985: 0x0359, + 0x1986: 0x0f61, 0x1987: 0x0f71, 0x1988: 0x00d9, 0x1989: 0x0f99, 0x198a: 0x2039, 0x198b: 0x0269, + 0x198c: 0x01d9, 0x198d: 0x0fa9, 0x198e: 0x0fb9, 0x198f: 0x1089, 0x1990: 0x0279, 0x1991: 0x0369, + 0x1992: 0x0289, 0x1993: 0x13d1, 0x1994: 0x0039, 0x1995: 0x0ee9, 0x1996: 0x1159, 0x1997: 0x0ef9, + 0x1998: 0x0f09, 0x1999: 0x1199, 0x199a: 0x0f31, 0x199b: 0x0249, 0x199c: 0x0f41, 0x199d: 0x0259, + 0x199e: 0x0f51, 0x199f: 0x0359, 0x19a0: 0x0f61, 0x19a1: 0x0f71, 0x19a2: 0x00d9, 0x19a3: 0x0f99, + 0x19a4: 0x2039, 0x19a5: 0x0269, 0x19a6: 0x01d9, 0x19a7: 0x0fa9, 0x19a8: 0x0fb9, 0x19a9: 0x1089, + 0x19aa: 0x0279, 0x19ab: 0x0369, 0x19ac: 0x0289, 0x19ad: 0x13d1, 0x19ae: 0x0039, 0x19af: 0x0ee9, + 0x19b0: 0x1159, 0x19b1: 0x0ef9, 0x19b2: 0x0f09, 0x19b3: 0x1199, 0x19b4: 0x0f31, 0x19b5: 0x0249, + 0x19b6: 0x0f41, 0x19b7: 0x0259, 0x19b8: 0x0f51, 0x19b9: 0x0359, 0x19ba: 0x0f61, 0x19bb: 0x0f71, + 0x19bc: 0x00d9, 0x19bd: 0x0f99, 0x19be: 0x2039, 0x19bf: 0x0269, + // Block 0x67, offset 0x19c0 + 0x19c0: 0x01d9, 0x19c1: 0x0fa9, 0x19c2: 0x0fb9, 0x19c3: 0x1089, 0x19c4: 0x0279, 0x19c5: 0x0369, + 0x19c6: 0x0289, 0x19c7: 0x13d1, 0x19c8: 0x0039, 0x19c9: 0x0ee9, 0x19ca: 0x1159, 0x19cb: 0x0ef9, + 0x19cc: 0x0f09, 0x19cd: 0x1199, 0x19ce: 0x0f31, 0x19cf: 0x0249, 0x19d0: 0x0f41, 0x19d1: 0x0259, + 0x19d2: 0x0f51, 0x19d3: 0x0359, 0x19d4: 0x0f61, 0x19d5: 0x0f71, 0x19d6: 0x00d9, 0x19d7: 0x0f99, + 0x19d8: 0x2039, 0x19d9: 0x0269, 0x19da: 0x01d9, 0x19db: 0x0fa9, 0x19dc: 0x0fb9, 0x19dd: 0x1089, + 0x19de: 0x0279, 0x19df: 0x0369, 0x19e0: 0x0289, 0x19e1: 0x13d1, 0x19e2: 0x0039, 0x19e3: 0x0ee9, + 0x19e4: 0x1159, 0x19e5: 0x0ef9, 0x19e6: 0x0f09, 0x19e7: 0x1199, 0x19e8: 0x0f31, 0x19e9: 0x0249, + 0x19ea: 0x0f41, 0x19eb: 0x0259, 0x19ec: 0x0f51, 0x19ed: 0x0359, 0x19ee: 0x0f61, 0x19ef: 0x0f71, + 0x19f0: 0x00d9, 0x19f1: 0x0f99, 0x19f2: 0x2039, 0x19f3: 0x0269, 0x19f4: 0x01d9, 0x19f5: 0x0fa9, + 0x19f6: 0x0fb9, 0x19f7: 0x1089, 0x19f8: 0x0279, 0x19f9: 0x0369, 0x19fa: 0x0289, 0x19fb: 0x13d1, + 0x19fc: 0x0039, 0x19fd: 0x0ee9, 0x19fe: 0x1159, 0x19ff: 0x0ef9, + // Block 0x68, offset 0x1a00 + 0x1a00: 0x0f09, 0x1a01: 0x1199, 0x1a02: 0x0f31, 0x1a03: 0x0249, 0x1a04: 0x0f41, 0x1a05: 0x0259, + 0x1a06: 0x0f51, 0x1a07: 0x0359, 0x1a08: 0x0f61, 0x1a09: 0x0f71, 0x1a0a: 0x00d9, 0x1a0b: 0x0f99, + 0x1a0c: 0x2039, 0x1a0d: 0x0269, 0x1a0e: 0x01d9, 0x1a0f: 0x0fa9, 0x1a10: 0x0fb9, 0x1a11: 0x1089, + 0x1a12: 0x0279, 0x1a13: 0x0369, 0x1a14: 0x0289, 0x1a15: 0x13d1, 0x1a16: 0x0039, 0x1a17: 0x0ee9, + 0x1a18: 0x1159, 0x1a19: 0x0ef9, 0x1a1a: 0x0f09, 0x1a1b: 0x1199, 0x1a1c: 0x0f31, 0x1a1d: 0x0249, + 0x1a1e: 0x0f41, 0x1a1f: 0x0259, 0x1a20: 0x0f51, 0x1a21: 0x0359, 0x1a22: 0x0f61, 0x1a23: 0x0f71, + 0x1a24: 0x00d9, 0x1a25: 0x0f99, 0x1a26: 0x2039, 0x1a27: 0x0269, 0x1a28: 0x01d9, 0x1a29: 0x0fa9, + 0x1a2a: 0x0fb9, 0x1a2b: 0x1089, 0x1a2c: 0x0279, 0x1a2d: 0x0369, 0x1a2e: 0x0289, 0x1a2f: 0x13d1, + 0x1a30: 0x0039, 0x1a31: 0x0ee9, 0x1a32: 0x1159, 0x1a33: 0x0ef9, 0x1a34: 0x0f09, 0x1a35: 0x1199, + 0x1a36: 0x0f31, 0x1a37: 0x0249, 0x1a38: 0x0f41, 0x1a39: 0x0259, 0x1a3a: 0x0f51, 0x1a3b: 0x0359, + 0x1a3c: 0x0f61, 0x1a3d: 0x0f71, 0x1a3e: 0x00d9, 0x1a3f: 0x0f99, + // Block 0x69, offset 0x1a40 + 0x1a40: 0x2039, 0x1a41: 0x0269, 0x1a42: 0x01d9, 0x1a43: 0x0fa9, 0x1a44: 0x0fb9, 0x1a45: 0x1089, + 0x1a46: 0x0279, 0x1a47: 0x0369, 0x1a48: 0x0289, 0x1a49: 0x13d1, 0x1a4a: 0x0039, 0x1a4b: 0x0ee9, + 0x1a4c: 0x1159, 0x1a4d: 0x0ef9, 0x1a4e: 0x0f09, 0x1a4f: 0x1199, 0x1a50: 0x0f31, 0x1a51: 0x0249, + 0x1a52: 0x0f41, 0x1a53: 0x0259, 0x1a54: 0x0f51, 0x1a55: 0x0359, 0x1a56: 0x0f61, 0x1a57: 0x0f71, + 0x1a58: 0x00d9, 0x1a59: 0x0f99, 0x1a5a: 0x2039, 0x1a5b: 0x0269, 0x1a5c: 0x01d9, 0x1a5d: 0x0fa9, + 0x1a5e: 0x0fb9, 0x1a5f: 0x1089, 0x1a60: 0x0279, 0x1a61: 0x0369, 0x1a62: 0x0289, 0x1a63: 0x13d1, + 0x1a64: 0xba81, 0x1a65: 0xba99, 0x1a66: 0x0040, 0x1a67: 0x0040, 0x1a68: 0xbab1, 0x1a69: 0x1099, + 0x1a6a: 0x10b1, 0x1a6b: 0x10c9, 0x1a6c: 0xbac9, 0x1a6d: 0xbae1, 0x1a6e: 0xbaf9, 0x1a6f: 0x1429, + 0x1a70: 0x1a31, 0x1a71: 0xbb11, 0x1a72: 0xbb29, 0x1a73: 0xbb41, 0x1a74: 0xbb59, 0x1a75: 0xbb71, + 0x1a76: 0xbb89, 0x1a77: 0x2109, 0x1a78: 0x1111, 0x1a79: 0x1429, 0x1a7a: 0xbba1, 0x1a7b: 0xbbb9, + 0x1a7c: 0xbbd1, 0x1a7d: 0x10e1, 0x1a7e: 0x10f9, 0x1a7f: 0xbbe9, + // Block 0x6a, offset 0x1a80 + 0x1a80: 0x2079, 0x1a81: 0xbc01, 0x1a82: 0xbab1, 0x1a83: 0x1099, 0x1a84: 0x10b1, 0x1a85: 0x10c9, + 0x1a86: 0xbac9, 0x1a87: 0xbae1, 0x1a88: 0xbaf9, 0x1a89: 0x1429, 0x1a8a: 0x1a31, 0x1a8b: 0xbb11, + 0x1a8c: 0xbb29, 0x1a8d: 0xbb41, 0x1a8e: 0xbb59, 0x1a8f: 0xbb71, 0x1a90: 0xbb89, 0x1a91: 0x2109, + 0x1a92: 0x1111, 0x1a93: 0xbba1, 0x1a94: 0xbba1, 0x1a95: 0xbbb9, 0x1a96: 0xbbd1, 0x1a97: 0x10e1, + 0x1a98: 0x10f9, 0x1a99: 0xbbe9, 0x1a9a: 0x2079, 0x1a9b: 0xbc21, 0x1a9c: 0xbac9, 0x1a9d: 0x1429, + 0x1a9e: 0xbb11, 0x1a9f: 0x10e1, 0x1aa0: 0x1111, 0x1aa1: 0x2109, 0x1aa2: 0xbab1, 0x1aa3: 0x1099, + 0x1aa4: 0x10b1, 0x1aa5: 0x10c9, 0x1aa6: 0xbac9, 0x1aa7: 0xbae1, 0x1aa8: 0xbaf9, 0x1aa9: 0x1429, + 0x1aaa: 0x1a31, 0x1aab: 0xbb11, 0x1aac: 0xbb29, 0x1aad: 0xbb41, 0x1aae: 0xbb59, 0x1aaf: 0xbb71, + 0x1ab0: 0xbb89, 0x1ab1: 0x2109, 0x1ab2: 0x1111, 0x1ab3: 0x1429, 0x1ab4: 0xbba1, 0x1ab5: 0xbbb9, + 0x1ab6: 0xbbd1, 0x1ab7: 0x10e1, 0x1ab8: 0x10f9, 0x1ab9: 0xbbe9, 0x1aba: 0x2079, 0x1abb: 0xbc01, + 0x1abc: 0xbab1, 0x1abd: 0x1099, 0x1abe: 0x10b1, 0x1abf: 0x10c9, + // Block 0x6b, offset 0x1ac0 + 0x1ac0: 0xbac9, 0x1ac1: 0xbae1, 0x1ac2: 0xbaf9, 0x1ac3: 0x1429, 0x1ac4: 0x1a31, 0x1ac5: 0xbb11, + 0x1ac6: 0xbb29, 0x1ac7: 0xbb41, 0x1ac8: 0xbb59, 0x1ac9: 0xbb71, 0x1aca: 0xbb89, 0x1acb: 0x2109, + 0x1acc: 0x1111, 0x1acd: 0xbba1, 0x1ace: 0xbba1, 0x1acf: 0xbbb9, 0x1ad0: 0xbbd1, 0x1ad1: 0x10e1, + 0x1ad2: 0x10f9, 0x1ad3: 0xbbe9, 0x1ad4: 0x2079, 0x1ad5: 0xbc21, 0x1ad6: 0xbac9, 0x1ad7: 0x1429, + 0x1ad8: 0xbb11, 0x1ad9: 0x10e1, 0x1ada: 0x1111, 0x1adb: 0x2109, 0x1adc: 0xbab1, 0x1add: 0x1099, + 0x1ade: 0x10b1, 0x1adf: 0x10c9, 0x1ae0: 0xbac9, 0x1ae1: 0xbae1, 0x1ae2: 0xbaf9, 0x1ae3: 0x1429, + 0x1ae4: 0x1a31, 0x1ae5: 0xbb11, 0x1ae6: 0xbb29, 0x1ae7: 0xbb41, 0x1ae8: 0xbb59, 0x1ae9: 0xbb71, + 0x1aea: 0xbb89, 0x1aeb: 0x2109, 0x1aec: 0x1111, 0x1aed: 0x1429, 0x1aee: 0xbba1, 0x1aef: 0xbbb9, + 0x1af0: 0xbbd1, 0x1af1: 0x10e1, 0x1af2: 0x10f9, 0x1af3: 0xbbe9, 0x1af4: 0x2079, 0x1af5: 0xbc01, + 0x1af6: 0xbab1, 0x1af7: 0x1099, 0x1af8: 0x10b1, 0x1af9: 0x10c9, 0x1afa: 0xbac9, 0x1afb: 0xbae1, + 0x1afc: 0xbaf9, 0x1afd: 0x1429, 0x1afe: 0x1a31, 0x1aff: 0xbb11, + // Block 0x6c, offset 0x1b00 + 0x1b00: 0xbb29, 0x1b01: 0xbb41, 0x1b02: 0xbb59, 0x1b03: 0xbb71, 0x1b04: 0xbb89, 0x1b05: 0x2109, + 0x1b06: 0x1111, 0x1b07: 0xbba1, 0x1b08: 0xbba1, 0x1b09: 0xbbb9, 0x1b0a: 0xbbd1, 0x1b0b: 0x10e1, + 0x1b0c: 0x10f9, 0x1b0d: 0xbbe9, 0x1b0e: 0x2079, 0x1b0f: 0xbc21, 0x1b10: 0xbac9, 0x1b11: 0x1429, + 0x1b12: 0xbb11, 0x1b13: 0x10e1, 0x1b14: 0x1111, 0x1b15: 0x2109, 0x1b16: 0xbab1, 0x1b17: 0x1099, + 0x1b18: 0x10b1, 0x1b19: 0x10c9, 0x1b1a: 0xbac9, 0x1b1b: 0xbae1, 0x1b1c: 0xbaf9, 0x1b1d: 0x1429, + 0x1b1e: 0x1a31, 0x1b1f: 0xbb11, 0x1b20: 0xbb29, 0x1b21: 0xbb41, 0x1b22: 0xbb59, 0x1b23: 0xbb71, + 0x1b24: 0xbb89, 0x1b25: 0x2109, 0x1b26: 0x1111, 0x1b27: 0x1429, 0x1b28: 0xbba1, 0x1b29: 0xbbb9, + 0x1b2a: 0xbbd1, 0x1b2b: 0x10e1, 0x1b2c: 0x10f9, 0x1b2d: 0xbbe9, 0x1b2e: 0x2079, 0x1b2f: 0xbc01, + 0x1b30: 0xbab1, 0x1b31: 0x1099, 0x1b32: 0x10b1, 0x1b33: 0x10c9, 0x1b34: 0xbac9, 0x1b35: 0xbae1, + 0x1b36: 0xbaf9, 0x1b37: 0x1429, 0x1b38: 0x1a31, 0x1b39: 0xbb11, 0x1b3a: 0xbb29, 0x1b3b: 0xbb41, + 0x1b3c: 0xbb59, 0x1b3d: 0xbb71, 0x1b3e: 0xbb89, 0x1b3f: 0x2109, + // Block 0x6d, offset 0x1b40 + 0x1b40: 0x1111, 0x1b41: 0xbba1, 0x1b42: 0xbba1, 0x1b43: 0xbbb9, 0x1b44: 0xbbd1, 0x1b45: 0x10e1, + 0x1b46: 0x10f9, 0x1b47: 0xbbe9, 0x1b48: 0x2079, 0x1b49: 0xbc21, 0x1b4a: 0xbac9, 0x1b4b: 0x1429, + 0x1b4c: 0xbb11, 0x1b4d: 0x10e1, 0x1b4e: 0x1111, 0x1b4f: 0x2109, 0x1b50: 0xbab1, 0x1b51: 0x1099, + 0x1b52: 0x10b1, 0x1b53: 0x10c9, 0x1b54: 0xbac9, 0x1b55: 0xbae1, 0x1b56: 0xbaf9, 0x1b57: 0x1429, + 0x1b58: 0x1a31, 0x1b59: 0xbb11, 0x1b5a: 0xbb29, 0x1b5b: 0xbb41, 0x1b5c: 0xbb59, 0x1b5d: 0xbb71, + 0x1b5e: 0xbb89, 0x1b5f: 0x2109, 0x1b60: 0x1111, 0x1b61: 0x1429, 0x1b62: 0xbba1, 0x1b63: 0xbbb9, + 0x1b64: 0xbbd1, 0x1b65: 0x10e1, 0x1b66: 0x10f9, 0x1b67: 0xbbe9, 0x1b68: 0x2079, 0x1b69: 0xbc01, + 0x1b6a: 0xbab1, 0x1b6b: 0x1099, 0x1b6c: 0x10b1, 0x1b6d: 0x10c9, 0x1b6e: 0xbac9, 0x1b6f: 0xbae1, + 0x1b70: 0xbaf9, 0x1b71: 0x1429, 0x1b72: 0x1a31, 0x1b73: 0xbb11, 0x1b74: 0xbb29, 0x1b75: 0xbb41, + 0x1b76: 0xbb59, 0x1b77: 0xbb71, 0x1b78: 0xbb89, 0x1b79: 0x2109, 0x1b7a: 0x1111, 0x1b7b: 0xbba1, + 0x1b7c: 0xbba1, 0x1b7d: 0xbbb9, 0x1b7e: 0xbbd1, 0x1b7f: 0x10e1, + // Block 0x6e, offset 0x1b80 + 0x1b80: 0x10f9, 0x1b81: 0xbbe9, 0x1b82: 0x2079, 0x1b83: 0xbc21, 0x1b84: 0xbac9, 0x1b85: 0x1429, + 0x1b86: 0xbb11, 0x1b87: 0x10e1, 0x1b88: 0x1111, 0x1b89: 0x2109, 0x1b8a: 0xbc41, 0x1b8b: 0xbc41, + 0x1b8c: 0x0040, 0x1b8d: 0x0040, 0x1b8e: 0x1f41, 0x1b8f: 0x00c9, 0x1b90: 0x0069, 0x1b91: 0x0079, + 0x1b92: 0x1f51, 0x1b93: 0x1f61, 0x1b94: 0x1f71, 0x1b95: 0x1f81, 0x1b96: 0x1f91, 0x1b97: 0x1fa1, + 0x1b98: 0x1f41, 0x1b99: 0x00c9, 0x1b9a: 0x0069, 0x1b9b: 0x0079, 0x1b9c: 0x1f51, 0x1b9d: 0x1f61, + 0x1b9e: 0x1f71, 0x1b9f: 0x1f81, 0x1ba0: 0x1f91, 0x1ba1: 0x1fa1, 0x1ba2: 0x1f41, 0x1ba3: 0x00c9, + 0x1ba4: 0x0069, 0x1ba5: 0x0079, 0x1ba6: 0x1f51, 0x1ba7: 0x1f61, 0x1ba8: 0x1f71, 0x1ba9: 0x1f81, + 0x1baa: 0x1f91, 0x1bab: 0x1fa1, 0x1bac: 0x1f41, 0x1bad: 0x00c9, 0x1bae: 0x0069, 0x1baf: 0x0079, + 0x1bb0: 0x1f51, 0x1bb1: 0x1f61, 0x1bb2: 0x1f71, 0x1bb3: 0x1f81, 0x1bb4: 0x1f91, 0x1bb5: 0x1fa1, + 0x1bb6: 0x1f41, 0x1bb7: 0x00c9, 0x1bb8: 0x0069, 0x1bb9: 0x0079, 0x1bba: 0x1f51, 0x1bbb: 0x1f61, + 0x1bbc: 0x1f71, 0x1bbd: 0x1f81, 0x1bbe: 0x1f91, 0x1bbf: 0x1fa1, + // Block 0x6f, offset 0x1bc0 + 0x1bc0: 0xe115, 0x1bc1: 0xe115, 0x1bc2: 0xe135, 0x1bc3: 0xe135, 0x1bc4: 0xe115, 0x1bc5: 0xe115, + 0x1bc6: 0xe175, 0x1bc7: 0xe175, 0x1bc8: 0xe115, 0x1bc9: 0xe115, 0x1bca: 0xe135, 0x1bcb: 0xe135, + 0x1bcc: 0xe115, 0x1bcd: 0xe115, 0x1bce: 0xe1f5, 0x1bcf: 0xe1f5, 0x1bd0: 0xe115, 0x1bd1: 0xe115, + 0x1bd2: 0xe135, 0x1bd3: 0xe135, 0x1bd4: 0xe115, 0x1bd5: 0xe115, 0x1bd6: 0xe175, 0x1bd7: 0xe175, + 0x1bd8: 0xe115, 0x1bd9: 0xe115, 0x1bda: 0xe135, 0x1bdb: 0xe135, 0x1bdc: 0xe115, 0x1bdd: 0xe115, + 0x1bde: 0x8b05, 0x1bdf: 0x8b05, 0x1be0: 0x04b5, 0x1be1: 0x04b5, 0x1be2: 0x0208, 0x1be3: 0x0208, + 0x1be4: 0x0208, 0x1be5: 0x0208, 0x1be6: 0x0208, 0x1be7: 0x0208, 0x1be8: 0x0208, 0x1be9: 0x0208, + 0x1bea: 0x0208, 0x1beb: 0x0208, 0x1bec: 0x0208, 0x1bed: 0x0208, 0x1bee: 0x0208, 0x1bef: 0x0208, + 0x1bf0: 0x0208, 0x1bf1: 0x0208, 0x1bf2: 0x0208, 0x1bf3: 0x0208, 0x1bf4: 0x0208, 0x1bf5: 0x0208, + 0x1bf6: 0x0208, 0x1bf7: 0x0208, 0x1bf8: 0x0208, 0x1bf9: 0x0208, 0x1bfa: 0x0208, 0x1bfb: 0x0208, + 0x1bfc: 0x0208, 0x1bfd: 0x0208, 0x1bfe: 0x0208, 0x1bff: 0x0208, + // Block 0x70, offset 0x1c00 + 0x1c00: 0xb189, 0x1c01: 0xb1a1, 0x1c02: 0xb201, 0x1c03: 0xb249, 0x1c04: 0x0040, 0x1c05: 0xb411, + 0x1c06: 0xb291, 0x1c07: 0xb219, 0x1c08: 0xb309, 0x1c09: 0xb429, 0x1c0a: 0xb399, 0x1c0b: 0xb3b1, + 0x1c0c: 0xb3c9, 0x1c0d: 0xb3e1, 0x1c0e: 0xb2a9, 0x1c0f: 0xb339, 0x1c10: 0xb369, 0x1c11: 0xb2d9, + 0x1c12: 0xb381, 0x1c13: 0xb279, 0x1c14: 0xb2c1, 0x1c15: 0xb1d1, 0x1c16: 0xb1e9, 0x1c17: 0xb231, + 0x1c18: 0xb261, 0x1c19: 0xb2f1, 0x1c1a: 0xb321, 0x1c1b: 0xb351, 0x1c1c: 0xbc59, 0x1c1d: 0x7949, + 0x1c1e: 0xbc71, 0x1c1f: 0xbc89, 0x1c20: 0x0040, 0x1c21: 0xb1a1, 0x1c22: 0xb201, 0x1c23: 0x0040, + 0x1c24: 0xb3f9, 0x1c25: 0x0040, 0x1c26: 0x0040, 0x1c27: 0xb219, 0x1c28: 0x0040, 0x1c29: 0xb429, + 0x1c2a: 0xb399, 0x1c2b: 0xb3b1, 0x1c2c: 0xb3c9, 0x1c2d: 0xb3e1, 0x1c2e: 0xb2a9, 0x1c2f: 0xb339, + 0x1c30: 0xb369, 0x1c31: 0xb2d9, 0x1c32: 0xb381, 0x1c33: 0x0040, 0x1c34: 0xb2c1, 0x1c35: 0xb1d1, + 0x1c36: 0xb1e9, 0x1c37: 0xb231, 0x1c38: 0x0040, 0x1c39: 0xb2f1, 0x1c3a: 0x0040, 0x1c3b: 0xb351, + 0x1c3c: 0x0040, 0x1c3d: 0x0040, 0x1c3e: 0x0040, 0x1c3f: 0x0040, + // Block 0x71, offset 0x1c40 + 0x1c40: 0x0040, 0x1c41: 0x0040, 0x1c42: 0xb201, 0x1c43: 0x0040, 0x1c44: 0x0040, 0x1c45: 0x0040, + 0x1c46: 0x0040, 0x1c47: 0xb219, 0x1c48: 0x0040, 0x1c49: 0xb429, 0x1c4a: 0x0040, 0x1c4b: 0xb3b1, + 0x1c4c: 0x0040, 0x1c4d: 0xb3e1, 0x1c4e: 0xb2a9, 0x1c4f: 0xb339, 0x1c50: 0x0040, 0x1c51: 0xb2d9, + 0x1c52: 0xb381, 0x1c53: 0x0040, 0x1c54: 0xb2c1, 0x1c55: 0x0040, 0x1c56: 0x0040, 0x1c57: 0xb231, + 0x1c58: 0x0040, 0x1c59: 0xb2f1, 0x1c5a: 0x0040, 0x1c5b: 0xb351, 0x1c5c: 0x0040, 0x1c5d: 0x7949, + 0x1c5e: 0x0040, 0x1c5f: 0xbc89, 0x1c60: 0x0040, 0x1c61: 0xb1a1, 0x1c62: 0xb201, 0x1c63: 0x0040, + 0x1c64: 0xb3f9, 0x1c65: 0x0040, 0x1c66: 0x0040, 0x1c67: 0xb219, 0x1c68: 0xb309, 0x1c69: 0xb429, + 0x1c6a: 0xb399, 0x1c6b: 0x0040, 0x1c6c: 0xb3c9, 0x1c6d: 0xb3e1, 0x1c6e: 0xb2a9, 0x1c6f: 0xb339, + 0x1c70: 0xb369, 0x1c71: 0xb2d9, 0x1c72: 0xb381, 0x1c73: 0x0040, 0x1c74: 0xb2c1, 0x1c75: 0xb1d1, + 0x1c76: 0xb1e9, 0x1c77: 0xb231, 0x1c78: 0x0040, 0x1c79: 0xb2f1, 0x1c7a: 0xb321, 0x1c7b: 0xb351, + 0x1c7c: 0xbc59, 0x1c7d: 0x0040, 0x1c7e: 0xbc71, 0x1c7f: 0x0040, + // Block 0x72, offset 0x1c80 + 0x1c80: 0xb189, 0x1c81: 0xb1a1, 0x1c82: 0xb201, 0x1c83: 0xb249, 0x1c84: 0xb3f9, 0x1c85: 0xb411, + 0x1c86: 0xb291, 0x1c87: 0xb219, 0x1c88: 0xb309, 0x1c89: 0xb429, 0x1c8a: 0x0040, 0x1c8b: 0xb3b1, + 0x1c8c: 0xb3c9, 0x1c8d: 0xb3e1, 0x1c8e: 0xb2a9, 0x1c8f: 0xb339, 0x1c90: 0xb369, 0x1c91: 0xb2d9, + 0x1c92: 0xb381, 0x1c93: 0xb279, 0x1c94: 0xb2c1, 0x1c95: 0xb1d1, 0x1c96: 0xb1e9, 0x1c97: 0xb231, + 0x1c98: 0xb261, 0x1c99: 0xb2f1, 0x1c9a: 0xb321, 0x1c9b: 0xb351, 0x1c9c: 0x0040, 0x1c9d: 0x0040, + 0x1c9e: 0x0040, 0x1c9f: 0x0040, 0x1ca0: 0x0040, 0x1ca1: 0xb1a1, 0x1ca2: 0xb201, 0x1ca3: 0xb249, + 0x1ca4: 0x0040, 0x1ca5: 0xb411, 0x1ca6: 0xb291, 0x1ca7: 0xb219, 0x1ca8: 0xb309, 0x1ca9: 0xb429, + 0x1caa: 0x0040, 0x1cab: 0xb3b1, 0x1cac: 0xb3c9, 0x1cad: 0xb3e1, 0x1cae: 0xb2a9, 0x1caf: 0xb339, + 0x1cb0: 0xb369, 0x1cb1: 0xb2d9, 0x1cb2: 0xb381, 0x1cb3: 0xb279, 0x1cb4: 0xb2c1, 0x1cb5: 0xb1d1, + 0x1cb6: 0xb1e9, 0x1cb7: 0xb231, 0x1cb8: 0xb261, 0x1cb9: 0xb2f1, 0x1cba: 0xb321, 0x1cbb: 0xb351, + 0x1cbc: 0x0040, 0x1cbd: 0x0040, 0x1cbe: 0x0040, 0x1cbf: 0x0040, + // Block 0x73, offset 0x1cc0 + 0x1cc0: 0x0040, 0x1cc1: 0xbca2, 0x1cc2: 0xbcba, 0x1cc3: 0xbcd2, 0x1cc4: 0xbcea, 0x1cc5: 0xbd02, + 0x1cc6: 0xbd1a, 0x1cc7: 0xbd32, 0x1cc8: 0xbd4a, 0x1cc9: 0xbd62, 0x1cca: 0xbd7a, 0x1ccb: 0x0018, + 0x1ccc: 0x0018, 0x1ccd: 0x0040, 0x1cce: 0x0040, 0x1ccf: 0x0040, 0x1cd0: 0xbd92, 0x1cd1: 0xbdb2, + 0x1cd2: 0xbdd2, 0x1cd3: 0xbdf2, 0x1cd4: 0xbe12, 0x1cd5: 0xbe32, 0x1cd6: 0xbe52, 0x1cd7: 0xbe72, + 0x1cd8: 0xbe92, 0x1cd9: 0xbeb2, 0x1cda: 0xbed2, 0x1cdb: 0xbef2, 0x1cdc: 0xbf12, 0x1cdd: 0xbf32, + 0x1cde: 0xbf52, 0x1cdf: 0xbf72, 0x1ce0: 0xbf92, 0x1ce1: 0xbfb2, 0x1ce2: 0xbfd2, 0x1ce3: 0xbff2, + 0x1ce4: 0xc012, 0x1ce5: 0xc032, 0x1ce6: 0xc052, 0x1ce7: 0xc072, 0x1ce8: 0xc092, 0x1ce9: 0xc0b2, + 0x1cea: 0xc0d1, 0x1ceb: 0x1159, 0x1cec: 0x0269, 0x1ced: 0x6671, 0x1cee: 0xc111, 0x1cef: 0x0040, + 0x1cf0: 0x0039, 0x1cf1: 0x0ee9, 0x1cf2: 0x1159, 0x1cf3: 0x0ef9, 0x1cf4: 0x0f09, 0x1cf5: 0x1199, + 0x1cf6: 0x0f31, 0x1cf7: 0x0249, 0x1cf8: 0x0f41, 0x1cf9: 0x0259, 0x1cfa: 0x0f51, 0x1cfb: 0x0359, + 0x1cfc: 0x0f61, 0x1cfd: 0x0f71, 0x1cfe: 0x00d9, 0x1cff: 0x0f99, + // Block 0x74, offset 0x1d00 + 0x1d00: 0x2039, 0x1d01: 0x0269, 0x1d02: 0x01d9, 0x1d03: 0x0fa9, 0x1d04: 0x0fb9, 0x1d05: 0x1089, + 0x1d06: 0x0279, 0x1d07: 0x0369, 0x1d08: 0x0289, 0x1d09: 0x13d1, 0x1d0a: 0xc129, 0x1d0b: 0x65b1, + 0x1d0c: 0xc141, 0x1d0d: 0x1441, 0x1d0e: 0xc159, 0x1d0f: 0xc179, 0x1d10: 0x0018, 0x1d11: 0x0018, + 0x1d12: 0x0018, 0x1d13: 0x0018, 0x1d14: 0x0018, 0x1d15: 0x0018, 0x1d16: 0x0018, 0x1d17: 0x0018, + 0x1d18: 0x0018, 0x1d19: 0x0018, 0x1d1a: 0x0018, 0x1d1b: 0x0018, 0x1d1c: 0x0018, 0x1d1d: 0x0018, + 0x1d1e: 0x0018, 0x1d1f: 0x0018, 0x1d20: 0x0018, 0x1d21: 0x0018, 0x1d22: 0x0018, 0x1d23: 0x0018, + 0x1d24: 0x0018, 0x1d25: 0x0018, 0x1d26: 0x0018, 0x1d27: 0x0018, 0x1d28: 0x0018, 0x1d29: 0x0018, + 0x1d2a: 0xc191, 0x1d2b: 0xc1a9, 0x1d2c: 0x0040, 0x1d2d: 0x0040, 0x1d2e: 0x0040, 0x1d2f: 0x0040, + 0x1d30: 0x0018, 0x1d31: 0x0018, 0x1d32: 0x0018, 0x1d33: 0x0018, 0x1d34: 0x0018, 0x1d35: 0x0018, + 0x1d36: 0x0018, 0x1d37: 0x0018, 0x1d38: 0x0018, 0x1d39: 0x0018, 0x1d3a: 0x0018, 0x1d3b: 0x0018, + 0x1d3c: 0x0018, 0x1d3d: 0x0018, 0x1d3e: 0x0018, 0x1d3f: 0x0018, + // Block 0x75, offset 0x1d40 + 0x1d40: 0xc1d9, 0x1d41: 0xc211, 0x1d42: 0xc249, 0x1d43: 0x0040, 0x1d44: 0x0040, 0x1d45: 0x0040, + 0x1d46: 0x0040, 0x1d47: 0x0040, 0x1d48: 0x0040, 0x1d49: 0x0040, 0x1d4a: 0x0040, 0x1d4b: 0x0040, + 0x1d4c: 0x0040, 0x1d4d: 0x0040, 0x1d4e: 0x0040, 0x1d4f: 0x0040, 0x1d50: 0xc269, 0x1d51: 0xc289, + 0x1d52: 0xc2a9, 0x1d53: 0xc2c9, 0x1d54: 0xc2e9, 0x1d55: 0xc309, 0x1d56: 0xc329, 0x1d57: 0xc349, + 0x1d58: 0xc369, 0x1d59: 0xc389, 0x1d5a: 0xc3a9, 0x1d5b: 0xc3c9, 0x1d5c: 0xc3e9, 0x1d5d: 0xc409, + 0x1d5e: 0xc429, 0x1d5f: 0xc449, 0x1d60: 0xc469, 0x1d61: 0xc489, 0x1d62: 0xc4a9, 0x1d63: 0xc4c9, + 0x1d64: 0xc4e9, 0x1d65: 0xc509, 0x1d66: 0xc529, 0x1d67: 0xc549, 0x1d68: 0xc569, 0x1d69: 0xc589, + 0x1d6a: 0xc5a9, 0x1d6b: 0xc5c9, 0x1d6c: 0xc5e9, 0x1d6d: 0xc609, 0x1d6e: 0xc629, 0x1d6f: 0xc649, + 0x1d70: 0xc669, 0x1d71: 0xc689, 0x1d72: 0xc6a9, 0x1d73: 0xc6c9, 0x1d74: 0xc6e9, 0x1d75: 0xc709, + 0x1d76: 0xc729, 0x1d77: 0xc749, 0x1d78: 0xc769, 0x1d79: 0xc789, 0x1d7a: 0xc7a9, 0x1d7b: 0xc7c9, + 0x1d7c: 0x0040, 0x1d7d: 0x0040, 0x1d7e: 0x0040, 0x1d7f: 0x0040, + // Block 0x76, offset 0x1d80 + 0x1d80: 0xcaf9, 0x1d81: 0xcb19, 0x1d82: 0xcb39, 0x1d83: 0x8b1d, 0x1d84: 0xcb59, 0x1d85: 0xcb79, + 0x1d86: 0xcb99, 0x1d87: 0xcbb9, 0x1d88: 0xcbd9, 0x1d89: 0xcbf9, 0x1d8a: 0xcc19, 0x1d8b: 0xcc39, + 0x1d8c: 0xcc59, 0x1d8d: 0x8b3d, 0x1d8e: 0xcc79, 0x1d8f: 0xcc99, 0x1d90: 0xccb9, 0x1d91: 0xccd9, + 0x1d92: 0x8b5d, 0x1d93: 0xccf9, 0x1d94: 0xcd19, 0x1d95: 0xc429, 0x1d96: 0x8b7d, 0x1d97: 0xcd39, + 0x1d98: 0xcd59, 0x1d99: 0xcd79, 0x1d9a: 0xcd99, 0x1d9b: 0xcdb9, 0x1d9c: 0x8b9d, 0x1d9d: 0xcdd9, + 0x1d9e: 0xcdf9, 0x1d9f: 0xce19, 0x1da0: 0xce39, 0x1da1: 0xce59, 0x1da2: 0xc789, 0x1da3: 0xce79, + 0x1da4: 0xce99, 0x1da5: 0xceb9, 0x1da6: 0xced9, 0x1da7: 0xcef9, 0x1da8: 0xcf19, 0x1da9: 0xcf39, + 0x1daa: 0xcf59, 0x1dab: 0xcf79, 0x1dac: 0xcf99, 0x1dad: 0xcfb9, 0x1dae: 0xcfd9, 0x1daf: 0xcff9, + 0x1db0: 0xd019, 0x1db1: 0xd039, 0x1db2: 0xd039, 0x1db3: 0xd039, 0x1db4: 0x8bbd, 0x1db5: 0xd059, + 0x1db6: 0xd079, 0x1db7: 0xd099, 0x1db8: 0x8bdd, 0x1db9: 0xd0b9, 0x1dba: 0xd0d9, 0x1dbb: 0xd0f9, + 0x1dbc: 0xd119, 0x1dbd: 0xd139, 0x1dbe: 0xd159, 0x1dbf: 0xd179, + // Block 0x77, offset 0x1dc0 + 0x1dc0: 0xd199, 0x1dc1: 0xd1b9, 0x1dc2: 0xd1d9, 0x1dc3: 0xd1f9, 0x1dc4: 0xd219, 0x1dc5: 0xd239, + 0x1dc6: 0xd239, 0x1dc7: 0xd259, 0x1dc8: 0xd279, 0x1dc9: 0xd299, 0x1dca: 0xd2b9, 0x1dcb: 0xd2d9, + 0x1dcc: 0xd2f9, 0x1dcd: 0xd319, 0x1dce: 0xd339, 0x1dcf: 0xd359, 0x1dd0: 0xd379, 0x1dd1: 0xd399, + 0x1dd2: 0xd3b9, 0x1dd3: 0xd3d9, 0x1dd4: 0xd3f9, 0x1dd5: 0xd419, 0x1dd6: 0xd439, 0x1dd7: 0xd459, + 0x1dd8: 0xd479, 0x1dd9: 0x8bfd, 0x1dda: 0xd499, 0x1ddb: 0xd4b9, 0x1ddc: 0xd4d9, 0x1ddd: 0xc309, + 0x1dde: 0xd4f9, 0x1ddf: 0xd519, 0x1de0: 0x8c1d, 0x1de1: 0x8c3d, 0x1de2: 0xd539, 0x1de3: 0xd559, + 0x1de4: 0xd579, 0x1de5: 0xd599, 0x1de6: 0xd5b9, 0x1de7: 0xd5d9, 0x1de8: 0x0040, 0x1de9: 0xd5f9, + 0x1dea: 0xd619, 0x1deb: 0xd619, 0x1dec: 0x8c5d, 0x1ded: 0xd639, 0x1dee: 0xd659, 0x1def: 0xd679, + 0x1df0: 0xd699, 0x1df1: 0x8c7d, 0x1df2: 0xd6b9, 0x1df3: 0xd6d9, 0x1df4: 0x0040, 0x1df5: 0xd6f9, + 0x1df6: 0xd719, 0x1df7: 0xd739, 0x1df8: 0xd759, 0x1df9: 0xd779, 0x1dfa: 0xd799, 0x1dfb: 0x8c9d, + 0x1dfc: 0xd7b9, 0x1dfd: 0x8cbd, 0x1dfe: 0xd7d9, 0x1dff: 0xd7f9, + // Block 0x78, offset 0x1e00 + 0x1e00: 0xd819, 0x1e01: 0xd839, 0x1e02: 0xd859, 0x1e03: 0xd879, 0x1e04: 0xd899, 0x1e05: 0xd8b9, + 0x1e06: 0xd8d9, 0x1e07: 0xd8f9, 0x1e08: 0xd919, 0x1e09: 0x8cdd, 0x1e0a: 0xd939, 0x1e0b: 0xd959, + 0x1e0c: 0xd979, 0x1e0d: 0xd999, 0x1e0e: 0xd9b9, 0x1e0f: 0x8cfd, 0x1e10: 0xd9d9, 0x1e11: 0x8d1d, + 0x1e12: 0x8d3d, 0x1e13: 0xd9f9, 0x1e14: 0xda19, 0x1e15: 0xda19, 0x1e16: 0xda39, 0x1e17: 0x8d5d, + 0x1e18: 0x8d7d, 0x1e19: 0xda59, 0x1e1a: 0xda79, 0x1e1b: 0xda99, 0x1e1c: 0xdab9, 0x1e1d: 0xdad9, + 0x1e1e: 0xdaf9, 0x1e1f: 0xdb19, 0x1e20: 0xdb39, 0x1e21: 0xdb59, 0x1e22: 0xdb79, 0x1e23: 0xdb99, + 0x1e24: 0x8d9d, 0x1e25: 0xdbb9, 0x1e26: 0xdbd9, 0x1e27: 0xdbf9, 0x1e28: 0xdc19, 0x1e29: 0xdbf9, + 0x1e2a: 0xdc39, 0x1e2b: 0xdc59, 0x1e2c: 0xdc79, 0x1e2d: 0xdc99, 0x1e2e: 0xdcb9, 0x1e2f: 0xdcd9, + 0x1e30: 0xdcf9, 0x1e31: 0xdd19, 0x1e32: 0xdd39, 0x1e33: 0xdd59, 0x1e34: 0xdd79, 0x1e35: 0xdd99, + 0x1e36: 0xddb9, 0x1e37: 0xddd9, 0x1e38: 0x8dbd, 0x1e39: 0xddf9, 0x1e3a: 0xde19, 0x1e3b: 0xde39, + 0x1e3c: 0xde59, 0x1e3d: 0xde79, 0x1e3e: 0x8ddd, 0x1e3f: 0xde99, + // Block 0x79, offset 0x1e40 + 0x1e40: 0xe599, 0x1e41: 0xe5b9, 0x1e42: 0xe5d9, 0x1e43: 0xe5f9, 0x1e44: 0xe619, 0x1e45: 0xe639, + 0x1e46: 0x8efd, 0x1e47: 0xe659, 0x1e48: 0xe679, 0x1e49: 0xe699, 0x1e4a: 0xe6b9, 0x1e4b: 0xe6d9, + 0x1e4c: 0xe6f9, 0x1e4d: 0x8f1d, 0x1e4e: 0xe719, 0x1e4f: 0xe739, 0x1e50: 0x8f3d, 0x1e51: 0x8f5d, + 0x1e52: 0xe759, 0x1e53: 0xe779, 0x1e54: 0xe799, 0x1e55: 0xe7b9, 0x1e56: 0xe7d9, 0x1e57: 0xe7f9, + 0x1e58: 0xe819, 0x1e59: 0xe839, 0x1e5a: 0xe859, 0x1e5b: 0x8f7d, 0x1e5c: 0xe879, 0x1e5d: 0x8f9d, + 0x1e5e: 0xe899, 0x1e5f: 0x0040, 0x1e60: 0xe8b9, 0x1e61: 0xe8d9, 0x1e62: 0xe8f9, 0x1e63: 0x8fbd, + 0x1e64: 0xe919, 0x1e65: 0xe939, 0x1e66: 0x8fdd, 0x1e67: 0x8ffd, 0x1e68: 0xe959, 0x1e69: 0xe979, + 0x1e6a: 0xe999, 0x1e6b: 0xe9b9, 0x1e6c: 0xe9d9, 0x1e6d: 0xe9d9, 0x1e6e: 0xe9f9, 0x1e6f: 0xea19, + 0x1e70: 0xea39, 0x1e71: 0xea59, 0x1e72: 0xea79, 0x1e73: 0xea99, 0x1e74: 0xeab9, 0x1e75: 0x901d, + 0x1e76: 0xead9, 0x1e77: 0x903d, 0x1e78: 0xeaf9, 0x1e79: 0x905d, 0x1e7a: 0xeb19, 0x1e7b: 0x907d, + 0x1e7c: 0x909d, 0x1e7d: 0x90bd, 0x1e7e: 0xeb39, 0x1e7f: 0xeb59, + // Block 0x7a, offset 0x1e80 + 0x1e80: 0xeb79, 0x1e81: 0x90dd, 0x1e82: 0x90fd, 0x1e83: 0x911d, 0x1e84: 0x913d, 0x1e85: 0xeb99, + 0x1e86: 0xebb9, 0x1e87: 0xebb9, 0x1e88: 0xebd9, 0x1e89: 0xebf9, 0x1e8a: 0xec19, 0x1e8b: 0xec39, + 0x1e8c: 0xec59, 0x1e8d: 0x915d, 0x1e8e: 0xec79, 0x1e8f: 0xec99, 0x1e90: 0xecb9, 0x1e91: 0xecd9, + 0x1e92: 0x917d, 0x1e93: 0xecf9, 0x1e94: 0x919d, 0x1e95: 0x91bd, 0x1e96: 0xed19, 0x1e97: 0xed39, + 0x1e98: 0xed59, 0x1e99: 0xed79, 0x1e9a: 0xed99, 0x1e9b: 0xedb9, 0x1e9c: 0x91dd, 0x1e9d: 0x91fd, + 0x1e9e: 0x921d, 0x1e9f: 0x0040, 0x1ea0: 0xedd9, 0x1ea1: 0x923d, 0x1ea2: 0xedf9, 0x1ea3: 0xee19, + 0x1ea4: 0xee39, 0x1ea5: 0x925d, 0x1ea6: 0xee59, 0x1ea7: 0xee79, 0x1ea8: 0xee99, 0x1ea9: 0xeeb9, + 0x1eaa: 0xeed9, 0x1eab: 0x927d, 0x1eac: 0xeef9, 0x1ead: 0xef19, 0x1eae: 0xef39, 0x1eaf: 0xef59, + 0x1eb0: 0xef79, 0x1eb1: 0xef99, 0x1eb2: 0x929d, 0x1eb3: 0x92bd, 0x1eb4: 0xefb9, 0x1eb5: 0x92dd, + 0x1eb6: 0xefd9, 0x1eb7: 0x92fd, 0x1eb8: 0xeff9, 0x1eb9: 0xf019, 0x1eba: 0xf039, 0x1ebb: 0x931d, + 0x1ebc: 0x933d, 0x1ebd: 0xf059, 0x1ebe: 0x935d, 0x1ebf: 0xf079, + // Block 0x7b, offset 0x1ec0 + 0x1ec0: 0xf6b9, 0x1ec1: 0xf6d9, 0x1ec2: 0xf6f9, 0x1ec3: 0xf719, 0x1ec4: 0xf739, 0x1ec5: 0x951d, + 0x1ec6: 0xf759, 0x1ec7: 0xf779, 0x1ec8: 0xf799, 0x1ec9: 0xf7b9, 0x1eca: 0xf7d9, 0x1ecb: 0x953d, + 0x1ecc: 0x955d, 0x1ecd: 0xf7f9, 0x1ece: 0xf819, 0x1ecf: 0xf839, 0x1ed0: 0xf859, 0x1ed1: 0xf879, + 0x1ed2: 0xf899, 0x1ed3: 0x957d, 0x1ed4: 0xf8b9, 0x1ed5: 0xf8d9, 0x1ed6: 0xf8f9, 0x1ed7: 0xf919, + 0x1ed8: 0x959d, 0x1ed9: 0x95bd, 0x1eda: 0xf939, 0x1edb: 0xf959, 0x1edc: 0xf979, 0x1edd: 0x95dd, + 0x1ede: 0xf999, 0x1edf: 0xf9b9, 0x1ee0: 0x6815, 0x1ee1: 0x95fd, 0x1ee2: 0xf9d9, 0x1ee3: 0xf9f9, + 0x1ee4: 0xfa19, 0x1ee5: 0x961d, 0x1ee6: 0xfa39, 0x1ee7: 0xfa59, 0x1ee8: 0xfa79, 0x1ee9: 0xfa99, + 0x1eea: 0xfab9, 0x1eeb: 0xfad9, 0x1eec: 0xfaf9, 0x1eed: 0x963d, 0x1eee: 0xfb19, 0x1eef: 0xfb39, + 0x1ef0: 0xfb59, 0x1ef1: 0x965d, 0x1ef2: 0xfb79, 0x1ef3: 0xfb99, 0x1ef4: 0xfbb9, 0x1ef5: 0xfbd9, + 0x1ef6: 0x7b35, 0x1ef7: 0x967d, 0x1ef8: 0xfbf9, 0x1ef9: 0xfc19, 0x1efa: 0xfc39, 0x1efb: 0x969d, + 0x1efc: 0xfc59, 0x1efd: 0x96bd, 0x1efe: 0xfc79, 0x1eff: 0xfc79, + // Block 0x7c, offset 0x1f00 + 0x1f00: 0xfc99, 0x1f01: 0x96dd, 0x1f02: 0xfcb9, 0x1f03: 0xfcd9, 0x1f04: 0xfcf9, 0x1f05: 0xfd19, + 0x1f06: 0xfd39, 0x1f07: 0xfd59, 0x1f08: 0xfd79, 0x1f09: 0x96fd, 0x1f0a: 0xfd99, 0x1f0b: 0xfdb9, + 0x1f0c: 0xfdd9, 0x1f0d: 0xfdf9, 0x1f0e: 0xfe19, 0x1f0f: 0xfe39, 0x1f10: 0x971d, 0x1f11: 0xfe59, + 0x1f12: 0x973d, 0x1f13: 0x975d, 0x1f14: 0x977d, 0x1f15: 0xfe79, 0x1f16: 0xfe99, 0x1f17: 0xfeb9, + 0x1f18: 0xfed9, 0x1f19: 0xfef9, 0x1f1a: 0xff19, 0x1f1b: 0xff39, 0x1f1c: 0xff59, 0x1f1d: 0x979d, + 0x1f1e: 0x0040, 0x1f1f: 0x0040, 0x1f20: 0x0040, 0x1f21: 0x0040, 0x1f22: 0x0040, 0x1f23: 0x0040, + 0x1f24: 0x0040, 0x1f25: 0x0040, 0x1f26: 0x0040, 0x1f27: 0x0040, 0x1f28: 0x0040, 0x1f29: 0x0040, + 0x1f2a: 0x0040, 0x1f2b: 0x0040, 0x1f2c: 0x0040, 0x1f2d: 0x0040, 0x1f2e: 0x0040, 0x1f2f: 0x0040, + 0x1f30: 0x0040, 0x1f31: 0x0040, 0x1f32: 0x0040, 0x1f33: 0x0040, 0x1f34: 0x0040, 0x1f35: 0x0040, + 0x1f36: 0x0040, 0x1f37: 0x0040, 0x1f38: 0x0040, 0x1f39: 0x0040, 0x1f3a: 0x0040, 0x1f3b: 0x0040, + 0x1f3c: 0x0040, 0x1f3d: 0x0040, 0x1f3e: 0x0040, 0x1f3f: 0x0040, +} + +// idnaIndex: 35 blocks, 2240 entries, 4480 bytes +// Block 0 is the zero block. +var idnaIndex = [2240]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x7b, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x04, 0xc7: 0x05, + 0xc8: 0x06, 0xc9: 0x7c, 0xca: 0x7d, 0xcb: 0x07, 0xcc: 0x7e, 0xcd: 0x08, 0xce: 0x09, 0xcf: 0x0a, + 0xd0: 0x7f, 0xd1: 0x0b, 0xd2: 0x0c, 0xd3: 0x0d, 0xd4: 0x0e, 0xd5: 0x80, 0xd6: 0x81, 0xd7: 0x82, + 0xd8: 0x0f, 0xd9: 0x83, 0xda: 0x84, 0xdb: 0x10, 0xdc: 0x11, 0xdd: 0x85, 0xde: 0x86, 0xdf: 0x87, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06, 0xe5: 0x07, 0xe6: 0x07, 0xe7: 0x07, + 0xe8: 0x07, 0xe9: 0x08, 0xea: 0x09, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x0a, 0xee: 0x0b, 0xef: 0x0c, + 0xf0: 0x1c, 0xf1: 0x1d, 0xf2: 0x1d, 0xf3: 0x1f, 0xf4: 0x20, + // Block 0x4, offset 0x100 + 0x120: 0x88, 0x121: 0x89, 0x122: 0x8a, 0x123: 0x8b, 0x124: 0x8c, 0x125: 0x12, 0x126: 0x13, 0x127: 0x14, + 0x128: 0x15, 0x129: 0x16, 0x12a: 0x17, 0x12b: 0x18, 0x12c: 0x19, 0x12d: 0x1a, 0x12e: 0x1b, 0x12f: 0x8d, + 0x130: 0x8e, 0x131: 0x1c, 0x132: 0x1d, 0x133: 0x1e, 0x134: 0x8f, 0x135: 0x1f, 0x136: 0x90, 0x137: 0x91, + 0x138: 0x92, 0x139: 0x93, 0x13a: 0x20, 0x13b: 0x94, 0x13c: 0x95, 0x13d: 0x21, 0x13e: 0x22, 0x13f: 0x96, + // Block 0x5, offset 0x140 + 0x140: 0x97, 0x141: 0x98, 0x142: 0x99, 0x143: 0x9a, 0x144: 0x9b, 0x145: 0x9c, 0x146: 0x9b, 0x147: 0x9b, + 0x148: 0x9d, 0x149: 0x9e, 0x14a: 0x9f, 0x14b: 0xa0, 0x14c: 0xa1, 0x14d: 0xa2, 0x14e: 0xa3, 0x14f: 0xa4, + 0x150: 0xa5, 0x151: 0x9d, 0x152: 0x9d, 0x153: 0x9d, 0x154: 0x9d, 0x155: 0x9d, 0x156: 0x9d, 0x157: 0x9d, + 0x158: 0x9d, 0x159: 0xa6, 0x15a: 0xa7, 0x15b: 0xa8, 0x15c: 0xa9, 0x15d: 0xaa, 0x15e: 0xab, 0x15f: 0xac, + 0x160: 0xad, 0x161: 0xae, 0x162: 0xaf, 0x163: 0xb0, 0x164: 0xb1, 0x165: 0xb2, 0x166: 0xb3, 0x167: 0xb4, + 0x168: 0xb5, 0x169: 0xb6, 0x16a: 0xb7, 0x16b: 0xb8, 0x16c: 0xb9, 0x16d: 0xba, 0x16e: 0xbb, 0x16f: 0xbc, + 0x170: 0xbd, 0x171: 0xbe, 0x172: 0xbf, 0x173: 0xc0, 0x174: 0x23, 0x175: 0x24, 0x176: 0x25, 0x177: 0xc1, + 0x178: 0x26, 0x179: 0x26, 0x17a: 0x27, 0x17b: 0x26, 0x17c: 0xc2, 0x17d: 0x28, 0x17e: 0x29, 0x17f: 0x2a, + // Block 0x6, offset 0x180 + 0x180: 0x2b, 0x181: 0x2c, 0x182: 0x2d, 0x183: 0xc3, 0x184: 0x2e, 0x185: 0x2f, 0x186: 0xc4, 0x187: 0x9b, + 0x188: 0xc5, 0x189: 0xc6, 0x18a: 0x9b, 0x18b: 0x9b, 0x18c: 0xc7, 0x18d: 0x9b, 0x18e: 0x9b, 0x18f: 0xc8, + 0x190: 0xc9, 0x191: 0x30, 0x192: 0x31, 0x193: 0x32, 0x194: 0x9b, 0x195: 0x9b, 0x196: 0x9b, 0x197: 0x9b, + 0x198: 0x9b, 0x199: 0x9b, 0x19a: 0x9b, 0x19b: 0x9b, 0x19c: 0x9b, 0x19d: 0x9b, 0x19e: 0x9b, 0x19f: 0x9b, + 0x1a0: 0x9b, 0x1a1: 0x9b, 0x1a2: 0x9b, 0x1a3: 0x9b, 0x1a4: 0x9b, 0x1a5: 0x9b, 0x1a6: 0x9b, 0x1a7: 0x9b, + 0x1a8: 0xca, 0x1a9: 0xcb, 0x1aa: 0x9b, 0x1ab: 0xcc, 0x1ac: 0x9b, 0x1ad: 0xcd, 0x1ae: 0xce, 0x1af: 0xcf, + 0x1b0: 0xd0, 0x1b1: 0x33, 0x1b2: 0x26, 0x1b3: 0x34, 0x1b4: 0xd1, 0x1b5: 0xd2, 0x1b6: 0xd3, 0x1b7: 0xd4, + 0x1b8: 0xd5, 0x1b9: 0xd6, 0x1ba: 0xd7, 0x1bb: 0xd8, 0x1bc: 0xd9, 0x1bd: 0xda, 0x1be: 0xdb, 0x1bf: 0x35, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x36, 0x1c1: 0xdc, 0x1c2: 0xdd, 0x1c3: 0xde, 0x1c4: 0xdf, 0x1c5: 0x37, 0x1c6: 0x38, 0x1c7: 0xe0, + 0x1c8: 0xe1, 0x1c9: 0x39, 0x1ca: 0x3a, 0x1cb: 0x3b, 0x1cc: 0x3c, 0x1cd: 0x3d, 0x1ce: 0x3e, 0x1cf: 0x3f, + 0x1d0: 0x9d, 0x1d1: 0x9d, 0x1d2: 0x9d, 0x1d3: 0x9d, 0x1d4: 0x9d, 0x1d5: 0x9d, 0x1d6: 0x9d, 0x1d7: 0x9d, + 0x1d8: 0x9d, 0x1d9: 0x9d, 0x1da: 0x9d, 0x1db: 0x9d, 0x1dc: 0x9d, 0x1dd: 0x9d, 0x1de: 0x9d, 0x1df: 0x9d, + 0x1e0: 0x9d, 0x1e1: 0x9d, 0x1e2: 0x9d, 0x1e3: 0x9d, 0x1e4: 0x9d, 0x1e5: 0x9d, 0x1e6: 0x9d, 0x1e7: 0x9d, + 0x1e8: 0x9d, 0x1e9: 0x9d, 0x1ea: 0x9d, 0x1eb: 0x9d, 0x1ec: 0x9d, 0x1ed: 0x9d, 0x1ee: 0x9d, 0x1ef: 0x9d, + 0x1f0: 0x9d, 0x1f1: 0x9d, 0x1f2: 0x9d, 0x1f3: 0x9d, 0x1f4: 0x9d, 0x1f5: 0x9d, 0x1f6: 0x9d, 0x1f7: 0x9d, + 0x1f8: 0x9d, 0x1f9: 0x9d, 0x1fa: 0x9d, 0x1fb: 0x9d, 0x1fc: 0x9d, 0x1fd: 0x9d, 0x1fe: 0x9d, 0x1ff: 0x9d, + // Block 0x8, offset 0x200 + 0x200: 0x9d, 0x201: 0x9d, 0x202: 0x9d, 0x203: 0x9d, 0x204: 0x9d, 0x205: 0x9d, 0x206: 0x9d, 0x207: 0x9d, + 0x208: 0x9d, 0x209: 0x9d, 0x20a: 0x9d, 0x20b: 0x9d, 0x20c: 0x9d, 0x20d: 0x9d, 0x20e: 0x9d, 0x20f: 0x9d, + 0x210: 0x9d, 0x211: 0x9d, 0x212: 0x9d, 0x213: 0x9d, 0x214: 0x9d, 0x215: 0x9d, 0x216: 0x9d, 0x217: 0x9d, + 0x218: 0x9d, 0x219: 0x9d, 0x21a: 0x9d, 0x21b: 0x9d, 0x21c: 0x9d, 0x21d: 0x9d, 0x21e: 0x9d, 0x21f: 0x9d, + 0x220: 0x9d, 0x221: 0x9d, 0x222: 0x9d, 0x223: 0x9d, 0x224: 0x9d, 0x225: 0x9d, 0x226: 0x9d, 0x227: 0x9d, + 0x228: 0x9d, 0x229: 0x9d, 0x22a: 0x9d, 0x22b: 0x9d, 0x22c: 0x9d, 0x22d: 0x9d, 0x22e: 0x9d, 0x22f: 0x9d, + 0x230: 0x9d, 0x231: 0x9d, 0x232: 0x9d, 0x233: 0x9d, 0x234: 0x9d, 0x235: 0x9d, 0x236: 0xb0, 0x237: 0x9b, + 0x238: 0x9d, 0x239: 0x9d, 0x23a: 0x9d, 0x23b: 0x9d, 0x23c: 0x9d, 0x23d: 0x9d, 0x23e: 0x9d, 0x23f: 0x9d, + // Block 0x9, offset 0x240 + 0x240: 0x9d, 0x241: 0x9d, 0x242: 0x9d, 0x243: 0x9d, 0x244: 0x9d, 0x245: 0x9d, 0x246: 0x9d, 0x247: 0x9d, + 0x248: 0x9d, 0x249: 0x9d, 0x24a: 0x9d, 0x24b: 0x9d, 0x24c: 0x9d, 0x24d: 0x9d, 0x24e: 0x9d, 0x24f: 0x9d, + 0x250: 0x9d, 0x251: 0x9d, 0x252: 0x9d, 0x253: 0x9d, 0x254: 0x9d, 0x255: 0x9d, 0x256: 0x9d, 0x257: 0x9d, + 0x258: 0x9d, 0x259: 0x9d, 0x25a: 0x9d, 0x25b: 0x9d, 0x25c: 0x9d, 0x25d: 0x9d, 0x25e: 0x9d, 0x25f: 0x9d, + 0x260: 0x9d, 0x261: 0x9d, 0x262: 0x9d, 0x263: 0x9d, 0x264: 0x9d, 0x265: 0x9d, 0x266: 0x9d, 0x267: 0x9d, + 0x268: 0x9d, 0x269: 0x9d, 0x26a: 0x9d, 0x26b: 0x9d, 0x26c: 0x9d, 0x26d: 0x9d, 0x26e: 0x9d, 0x26f: 0x9d, + 0x270: 0x9d, 0x271: 0x9d, 0x272: 0x9d, 0x273: 0x9d, 0x274: 0x9d, 0x275: 0x9d, 0x276: 0x9d, 0x277: 0x9d, + 0x278: 0x9d, 0x279: 0x9d, 0x27a: 0x9d, 0x27b: 0x9d, 0x27c: 0x9d, 0x27d: 0x9d, 0x27e: 0x9d, 0x27f: 0x9d, + // Block 0xa, offset 0x280 + 0x280: 0x9d, 0x281: 0x9d, 0x282: 0x9d, 0x283: 0x9d, 0x284: 0x9d, 0x285: 0x9d, 0x286: 0x9d, 0x287: 0x9d, + 0x288: 0x9d, 0x289: 0x9d, 0x28a: 0x9d, 0x28b: 0x9d, 0x28c: 0x9d, 0x28d: 0x9d, 0x28e: 0x9d, 0x28f: 0x9d, + 0x290: 0x9d, 0x291: 0x9d, 0x292: 0x9d, 0x293: 0x9d, 0x294: 0x9d, 0x295: 0x9d, 0x296: 0x9d, 0x297: 0x9d, + 0x298: 0x9d, 0x299: 0x9d, 0x29a: 0x9d, 0x29b: 0x9d, 0x29c: 0x9d, 0x29d: 0x9d, 0x29e: 0x9d, 0x29f: 0x9d, + 0x2a0: 0x9d, 0x2a1: 0x9d, 0x2a2: 0x9d, 0x2a3: 0x9d, 0x2a4: 0x9d, 0x2a5: 0x9d, 0x2a6: 0x9d, 0x2a7: 0x9d, + 0x2a8: 0x9d, 0x2a9: 0x9d, 0x2aa: 0x9d, 0x2ab: 0x9d, 0x2ac: 0x9d, 0x2ad: 0x9d, 0x2ae: 0x9d, 0x2af: 0x9d, + 0x2b0: 0x9d, 0x2b1: 0x9d, 0x2b2: 0x9d, 0x2b3: 0x9d, 0x2b4: 0x9d, 0x2b5: 0x9d, 0x2b6: 0x9d, 0x2b7: 0x9d, + 0x2b8: 0x9d, 0x2b9: 0x9d, 0x2ba: 0x9d, 0x2bb: 0x9d, 0x2bc: 0x9d, 0x2bd: 0x9d, 0x2be: 0x9d, 0x2bf: 0xe2, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x9d, 0x2c1: 0x9d, 0x2c2: 0x9d, 0x2c3: 0x9d, 0x2c4: 0x9d, 0x2c5: 0x9d, 0x2c6: 0x9d, 0x2c7: 0x9d, + 0x2c8: 0x9d, 0x2c9: 0x9d, 0x2ca: 0x9d, 0x2cb: 0x9d, 0x2cc: 0x9d, 0x2cd: 0x9d, 0x2ce: 0x9d, 0x2cf: 0x9d, + 0x2d0: 0x9d, 0x2d1: 0x9d, 0x2d2: 0xe3, 0x2d3: 0xe4, 0x2d4: 0x9d, 0x2d5: 0x9d, 0x2d6: 0x9d, 0x2d7: 0x9d, + 0x2d8: 0xe5, 0x2d9: 0x40, 0x2da: 0x41, 0x2db: 0xe6, 0x2dc: 0x42, 0x2dd: 0x43, 0x2de: 0x44, 0x2df: 0xe7, + 0x2e0: 0xe8, 0x2e1: 0xe9, 0x2e2: 0xea, 0x2e3: 0xeb, 0x2e4: 0xec, 0x2e5: 0xed, 0x2e6: 0xee, 0x2e7: 0xef, + 0x2e8: 0xf0, 0x2e9: 0xf1, 0x2ea: 0xf2, 0x2eb: 0xf3, 0x2ec: 0xf4, 0x2ed: 0xf5, 0x2ee: 0xf6, 0x2ef: 0xf7, + 0x2f0: 0x9d, 0x2f1: 0x9d, 0x2f2: 0x9d, 0x2f3: 0x9d, 0x2f4: 0x9d, 0x2f5: 0x9d, 0x2f6: 0x9d, 0x2f7: 0x9d, + 0x2f8: 0x9d, 0x2f9: 0x9d, 0x2fa: 0x9d, 0x2fb: 0x9d, 0x2fc: 0x9d, 0x2fd: 0x9d, 0x2fe: 0x9d, 0x2ff: 0x9d, + // Block 0xc, offset 0x300 + 0x300: 0x9d, 0x301: 0x9d, 0x302: 0x9d, 0x303: 0x9d, 0x304: 0x9d, 0x305: 0x9d, 0x306: 0x9d, 0x307: 0x9d, + 0x308: 0x9d, 0x309: 0x9d, 0x30a: 0x9d, 0x30b: 0x9d, 0x30c: 0x9d, 0x30d: 0x9d, 0x30e: 0x9d, 0x30f: 0x9d, + 0x310: 0x9d, 0x311: 0x9d, 0x312: 0x9d, 0x313: 0x9d, 0x314: 0x9d, 0x315: 0x9d, 0x316: 0x9d, 0x317: 0x9d, + 0x318: 0x9d, 0x319: 0x9d, 0x31a: 0x9d, 0x31b: 0x9d, 0x31c: 0x9d, 0x31d: 0x9d, 0x31e: 0xf8, 0x31f: 0xf9, + // Block 0xd, offset 0x340 + 0x340: 0xb8, 0x341: 0xb8, 0x342: 0xb8, 0x343: 0xb8, 0x344: 0xb8, 0x345: 0xb8, 0x346: 0xb8, 0x347: 0xb8, + 0x348: 0xb8, 0x349: 0xb8, 0x34a: 0xb8, 0x34b: 0xb8, 0x34c: 0xb8, 0x34d: 0xb8, 0x34e: 0xb8, 0x34f: 0xb8, + 0x350: 0xb8, 0x351: 0xb8, 0x352: 0xb8, 0x353: 0xb8, 0x354: 0xb8, 0x355: 0xb8, 0x356: 0xb8, 0x357: 0xb8, + 0x358: 0xb8, 0x359: 0xb8, 0x35a: 0xb8, 0x35b: 0xb8, 0x35c: 0xb8, 0x35d: 0xb8, 0x35e: 0xb8, 0x35f: 0xb8, + 0x360: 0xb8, 0x361: 0xb8, 0x362: 0xb8, 0x363: 0xb8, 0x364: 0xb8, 0x365: 0xb8, 0x366: 0xb8, 0x367: 0xb8, + 0x368: 0xb8, 0x369: 0xb8, 0x36a: 0xb8, 0x36b: 0xb8, 0x36c: 0xb8, 0x36d: 0xb8, 0x36e: 0xb8, 0x36f: 0xb8, + 0x370: 0xb8, 0x371: 0xb8, 0x372: 0xb8, 0x373: 0xb8, 0x374: 0xb8, 0x375: 0xb8, 0x376: 0xb8, 0x377: 0xb8, + 0x378: 0xb8, 0x379: 0xb8, 0x37a: 0xb8, 0x37b: 0xb8, 0x37c: 0xb8, 0x37d: 0xb8, 0x37e: 0xb8, 0x37f: 0xb8, + // Block 0xe, offset 0x380 + 0x380: 0xb8, 0x381: 0xb8, 0x382: 0xb8, 0x383: 0xb8, 0x384: 0xb8, 0x385: 0xb8, 0x386: 0xb8, 0x387: 0xb8, + 0x388: 0xb8, 0x389: 0xb8, 0x38a: 0xb8, 0x38b: 0xb8, 0x38c: 0xb8, 0x38d: 0xb8, 0x38e: 0xb8, 0x38f: 0xb8, + 0x390: 0xb8, 0x391: 0xb8, 0x392: 0xb8, 0x393: 0xb8, 0x394: 0xb8, 0x395: 0xb8, 0x396: 0xb8, 0x397: 0xb8, + 0x398: 0xb8, 0x399: 0xb8, 0x39a: 0xb8, 0x39b: 0xb8, 0x39c: 0xb8, 0x39d: 0xb8, 0x39e: 0xb8, 0x39f: 0xb8, + 0x3a0: 0xb8, 0x3a1: 0xb8, 0x3a2: 0xb8, 0x3a3: 0xb8, 0x3a4: 0xfa, 0x3a5: 0xfb, 0x3a6: 0xfc, 0x3a7: 0xfd, + 0x3a8: 0x45, 0x3a9: 0xfe, 0x3aa: 0xff, 0x3ab: 0x46, 0x3ac: 0x47, 0x3ad: 0x48, 0x3ae: 0x49, 0x3af: 0x4a, + 0x3b0: 0x100, 0x3b1: 0x4b, 0x3b2: 0x4c, 0x3b3: 0x4d, 0x3b4: 0x4e, 0x3b5: 0x4f, 0x3b6: 0x101, 0x3b7: 0x50, + 0x3b8: 0x51, 0x3b9: 0x52, 0x3ba: 0x53, 0x3bb: 0x54, 0x3bc: 0x55, 0x3bd: 0x56, 0x3be: 0x57, 0x3bf: 0x58, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x102, 0x3c1: 0x103, 0x3c2: 0x9d, 0x3c3: 0x104, 0x3c4: 0x105, 0x3c5: 0x9b, 0x3c6: 0x106, 0x3c7: 0x107, + 0x3c8: 0xb8, 0x3c9: 0xb8, 0x3ca: 0x108, 0x3cb: 0x109, 0x3cc: 0x10a, 0x3cd: 0x10b, 0x3ce: 0x10c, 0x3cf: 0x10d, + 0x3d0: 0x10e, 0x3d1: 0x9d, 0x3d2: 0x10f, 0x3d3: 0x110, 0x3d4: 0x111, 0x3d5: 0x112, 0x3d6: 0xb8, 0x3d7: 0xb8, + 0x3d8: 0x9d, 0x3d9: 0x9d, 0x3da: 0x9d, 0x3db: 0x9d, 0x3dc: 0x113, 0x3dd: 0x114, 0x3de: 0xb8, 0x3df: 0xb8, + 0x3e0: 0x115, 0x3e1: 0x116, 0x3e2: 0x117, 0x3e3: 0x118, 0x3e4: 0x119, 0x3e5: 0xb8, 0x3e6: 0x11a, 0x3e7: 0x11b, + 0x3e8: 0x11c, 0x3e9: 0x11d, 0x3ea: 0x11e, 0x3eb: 0x59, 0x3ec: 0x11f, 0x3ed: 0x120, 0x3ee: 0x5a, 0x3ef: 0xb8, + 0x3f0: 0x9d, 0x3f1: 0x121, 0x3f2: 0x122, 0x3f3: 0x123, 0x3f4: 0xb8, 0x3f5: 0xb8, 0x3f6: 0xb8, 0x3f7: 0xb8, + 0x3f8: 0xb8, 0x3f9: 0x124, 0x3fa: 0xb8, 0x3fb: 0xb8, 0x3fc: 0xb8, 0x3fd: 0xb8, 0x3fe: 0xb8, 0x3ff: 0xb8, + // Block 0x10, offset 0x400 + 0x400: 0x125, 0x401: 0x126, 0x402: 0x127, 0x403: 0x128, 0x404: 0x129, 0x405: 0x12a, 0x406: 0x12b, 0x407: 0x12c, + 0x408: 0x12d, 0x409: 0xb8, 0x40a: 0x12e, 0x40b: 0x12f, 0x40c: 0x5b, 0x40d: 0x5c, 0x40e: 0xb8, 0x40f: 0xb8, + 0x410: 0x130, 0x411: 0x131, 0x412: 0x132, 0x413: 0x133, 0x414: 0xb8, 0x415: 0xb8, 0x416: 0x134, 0x417: 0x135, + 0x418: 0x136, 0x419: 0x137, 0x41a: 0x138, 0x41b: 0x139, 0x41c: 0x13a, 0x41d: 0xb8, 0x41e: 0xb8, 0x41f: 0xb8, + 0x420: 0xb8, 0x421: 0xb8, 0x422: 0x13b, 0x423: 0x13c, 0x424: 0xb8, 0x425: 0xb8, 0x426: 0xb8, 0x427: 0xb8, + 0x428: 0xb8, 0x429: 0xb8, 0x42a: 0xb8, 0x42b: 0x13d, 0x42c: 0xb8, 0x42d: 0xb8, 0x42e: 0xb8, 0x42f: 0xb8, + 0x430: 0x13e, 0x431: 0x13f, 0x432: 0x140, 0x433: 0xb8, 0x434: 0xb8, 0x435: 0xb8, 0x436: 0xb8, 0x437: 0xb8, + 0x438: 0xb8, 0x439: 0xb8, 0x43a: 0xb8, 0x43b: 0xb8, 0x43c: 0xb8, 0x43d: 0xb8, 0x43e: 0xb8, 0x43f: 0xb8, + // Block 0x11, offset 0x440 + 0x440: 0x9d, 0x441: 0x9d, 0x442: 0x9d, 0x443: 0x9d, 0x444: 0x9d, 0x445: 0x9d, 0x446: 0x9d, 0x447: 0x9d, + 0x448: 0x9d, 0x449: 0x9d, 0x44a: 0x9d, 0x44b: 0x9d, 0x44c: 0x9d, 0x44d: 0x9d, 0x44e: 0x141, 0x44f: 0xb8, + 0x450: 0x9b, 0x451: 0x142, 0x452: 0x9d, 0x453: 0x9d, 0x454: 0x9d, 0x455: 0x143, 0x456: 0xb8, 0x457: 0xb8, + 0x458: 0xb8, 0x459: 0xb8, 0x45a: 0xb8, 0x45b: 0xb8, 0x45c: 0xb8, 0x45d: 0xb8, 0x45e: 0xb8, 0x45f: 0xb8, + 0x460: 0xb8, 0x461: 0xb8, 0x462: 0xb8, 0x463: 0xb8, 0x464: 0xb8, 0x465: 0xb8, 0x466: 0xb8, 0x467: 0xb8, + 0x468: 0xb8, 0x469: 0xb8, 0x46a: 0xb8, 0x46b: 0xb8, 0x46c: 0xb8, 0x46d: 0xb8, 0x46e: 0xb8, 0x46f: 0xb8, + 0x470: 0xb8, 0x471: 0xb8, 0x472: 0xb8, 0x473: 0xb8, 0x474: 0xb8, 0x475: 0xb8, 0x476: 0xb8, 0x477: 0xb8, + 0x478: 0xb8, 0x479: 0xb8, 0x47a: 0xb8, 0x47b: 0xb8, 0x47c: 0xb8, 0x47d: 0xb8, 0x47e: 0xb8, 0x47f: 0xb8, + // Block 0x12, offset 0x480 + 0x480: 0x9d, 0x481: 0x9d, 0x482: 0x9d, 0x483: 0x9d, 0x484: 0x9d, 0x485: 0x9d, 0x486: 0x9d, 0x487: 0x9d, + 0x488: 0x9d, 0x489: 0x9d, 0x48a: 0x9d, 0x48b: 0x9d, 0x48c: 0x9d, 0x48d: 0x9d, 0x48e: 0x9d, 0x48f: 0x9d, + 0x490: 0x144, 0x491: 0xb8, 0x492: 0xb8, 0x493: 0xb8, 0x494: 0xb8, 0x495: 0xb8, 0x496: 0xb8, 0x497: 0xb8, + 0x498: 0xb8, 0x499: 0xb8, 0x49a: 0xb8, 0x49b: 0xb8, 0x49c: 0xb8, 0x49d: 0xb8, 0x49e: 0xb8, 0x49f: 0xb8, + 0x4a0: 0xb8, 0x4a1: 0xb8, 0x4a2: 0xb8, 0x4a3: 0xb8, 0x4a4: 0xb8, 0x4a5: 0xb8, 0x4a6: 0xb8, 0x4a7: 0xb8, + 0x4a8: 0xb8, 0x4a9: 0xb8, 0x4aa: 0xb8, 0x4ab: 0xb8, 0x4ac: 0xb8, 0x4ad: 0xb8, 0x4ae: 0xb8, 0x4af: 0xb8, + 0x4b0: 0xb8, 0x4b1: 0xb8, 0x4b2: 0xb8, 0x4b3: 0xb8, 0x4b4: 0xb8, 0x4b5: 0xb8, 0x4b6: 0xb8, 0x4b7: 0xb8, + 0x4b8: 0xb8, 0x4b9: 0xb8, 0x4ba: 0xb8, 0x4bb: 0xb8, 0x4bc: 0xb8, 0x4bd: 0xb8, 0x4be: 0xb8, 0x4bf: 0xb8, + // Block 0x13, offset 0x4c0 + 0x4c0: 0xb8, 0x4c1: 0xb8, 0x4c2: 0xb8, 0x4c3: 0xb8, 0x4c4: 0xb8, 0x4c5: 0xb8, 0x4c6: 0xb8, 0x4c7: 0xb8, + 0x4c8: 0xb8, 0x4c9: 0xb8, 0x4ca: 0xb8, 0x4cb: 0xb8, 0x4cc: 0xb8, 0x4cd: 0xb8, 0x4ce: 0xb8, 0x4cf: 0xb8, + 0x4d0: 0x9d, 0x4d1: 0x9d, 0x4d2: 0x9d, 0x4d3: 0x9d, 0x4d4: 0x9d, 0x4d5: 0x9d, 0x4d6: 0x9d, 0x4d7: 0x9d, + 0x4d8: 0x9d, 0x4d9: 0x145, 0x4da: 0xb8, 0x4db: 0xb8, 0x4dc: 0xb8, 0x4dd: 0xb8, 0x4de: 0xb8, 0x4df: 0xb8, + 0x4e0: 0xb8, 0x4e1: 0xb8, 0x4e2: 0xb8, 0x4e3: 0xb8, 0x4e4: 0xb8, 0x4e5: 0xb8, 0x4e6: 0xb8, 0x4e7: 0xb8, + 0x4e8: 0xb8, 0x4e9: 0xb8, 0x4ea: 0xb8, 0x4eb: 0xb8, 0x4ec: 0xb8, 0x4ed: 0xb8, 0x4ee: 0xb8, 0x4ef: 0xb8, + 0x4f0: 0xb8, 0x4f1: 0xb8, 0x4f2: 0xb8, 0x4f3: 0xb8, 0x4f4: 0xb8, 0x4f5: 0xb8, 0x4f6: 0xb8, 0x4f7: 0xb8, + 0x4f8: 0xb8, 0x4f9: 0xb8, 0x4fa: 0xb8, 0x4fb: 0xb8, 0x4fc: 0xb8, 0x4fd: 0xb8, 0x4fe: 0xb8, 0x4ff: 0xb8, + // Block 0x14, offset 0x500 + 0x500: 0xb8, 0x501: 0xb8, 0x502: 0xb8, 0x503: 0xb8, 0x504: 0xb8, 0x505: 0xb8, 0x506: 0xb8, 0x507: 0xb8, + 0x508: 0xb8, 0x509: 0xb8, 0x50a: 0xb8, 0x50b: 0xb8, 0x50c: 0xb8, 0x50d: 0xb8, 0x50e: 0xb8, 0x50f: 0xb8, + 0x510: 0xb8, 0x511: 0xb8, 0x512: 0xb8, 0x513: 0xb8, 0x514: 0xb8, 0x515: 0xb8, 0x516: 0xb8, 0x517: 0xb8, + 0x518: 0xb8, 0x519: 0xb8, 0x51a: 0xb8, 0x51b: 0xb8, 0x51c: 0xb8, 0x51d: 0xb8, 0x51e: 0xb8, 0x51f: 0xb8, + 0x520: 0x9d, 0x521: 0x9d, 0x522: 0x9d, 0x523: 0x9d, 0x524: 0x9d, 0x525: 0x9d, 0x526: 0x9d, 0x527: 0x9d, + 0x528: 0x13d, 0x529: 0x146, 0x52a: 0xb8, 0x52b: 0x147, 0x52c: 0x148, 0x52d: 0x149, 0x52e: 0x14a, 0x52f: 0xb8, + 0x530: 0xb8, 0x531: 0xb8, 0x532: 0xb8, 0x533: 0xb8, 0x534: 0xb8, 0x535: 0xb8, 0x536: 0xb8, 0x537: 0xb8, + 0x538: 0xb8, 0x539: 0xb8, 0x53a: 0xb8, 0x53b: 0xb8, 0x53c: 0x9d, 0x53d: 0x14b, 0x53e: 0x14c, 0x53f: 0x14d, + // Block 0x15, offset 0x540 + 0x540: 0x9d, 0x541: 0x9d, 0x542: 0x9d, 0x543: 0x9d, 0x544: 0x9d, 0x545: 0x9d, 0x546: 0x9d, 0x547: 0x9d, + 0x548: 0x9d, 0x549: 0x9d, 0x54a: 0x9d, 0x54b: 0x9d, 0x54c: 0x9d, 0x54d: 0x9d, 0x54e: 0x9d, 0x54f: 0x9d, + 0x550: 0x9d, 0x551: 0x9d, 0x552: 0x9d, 0x553: 0x9d, 0x554: 0x9d, 0x555: 0x9d, 0x556: 0x9d, 0x557: 0x9d, + 0x558: 0x9d, 0x559: 0x9d, 0x55a: 0x9d, 0x55b: 0x9d, 0x55c: 0x9d, 0x55d: 0x9d, 0x55e: 0x9d, 0x55f: 0x14e, + 0x560: 0x9d, 0x561: 0x9d, 0x562: 0x9d, 0x563: 0x9d, 0x564: 0x9d, 0x565: 0x9d, 0x566: 0x9d, 0x567: 0x9d, + 0x568: 0x9d, 0x569: 0x9d, 0x56a: 0x9d, 0x56b: 0x14f, 0x56c: 0xb8, 0x56d: 0xb8, 0x56e: 0xb8, 0x56f: 0xb8, + 0x570: 0xb8, 0x571: 0xb8, 0x572: 0xb8, 0x573: 0xb8, 0x574: 0xb8, 0x575: 0xb8, 0x576: 0xb8, 0x577: 0xb8, + 0x578: 0xb8, 0x579: 0xb8, 0x57a: 0xb8, 0x57b: 0xb8, 0x57c: 0xb8, 0x57d: 0xb8, 0x57e: 0xb8, 0x57f: 0xb8, + // Block 0x16, offset 0x580 + 0x580: 0x150, 0x581: 0xb8, 0x582: 0xb8, 0x583: 0xb8, 0x584: 0xb8, 0x585: 0xb8, 0x586: 0xb8, 0x587: 0xb8, + 0x588: 0xb8, 0x589: 0xb8, 0x58a: 0xb8, 0x58b: 0xb8, 0x58c: 0xb8, 0x58d: 0xb8, 0x58e: 0xb8, 0x58f: 0xb8, + 0x590: 0xb8, 0x591: 0xb8, 0x592: 0xb8, 0x593: 0xb8, 0x594: 0xb8, 0x595: 0xb8, 0x596: 0xb8, 0x597: 0xb8, + 0x598: 0xb8, 0x599: 0xb8, 0x59a: 0xb8, 0x59b: 0xb8, 0x59c: 0xb8, 0x59d: 0xb8, 0x59e: 0xb8, 0x59f: 0xb8, + 0x5a0: 0xb8, 0x5a1: 0xb8, 0x5a2: 0xb8, 0x5a3: 0xb8, 0x5a4: 0xb8, 0x5a5: 0xb8, 0x5a6: 0xb8, 0x5a7: 0xb8, + 0x5a8: 0xb8, 0x5a9: 0xb8, 0x5aa: 0xb8, 0x5ab: 0xb8, 0x5ac: 0xb8, 0x5ad: 0xb8, 0x5ae: 0xb8, 0x5af: 0xb8, + 0x5b0: 0x9d, 0x5b1: 0x151, 0x5b2: 0x152, 0x5b3: 0xb8, 0x5b4: 0xb8, 0x5b5: 0xb8, 0x5b6: 0xb8, 0x5b7: 0xb8, + 0x5b8: 0xb8, 0x5b9: 0xb8, 0x5ba: 0xb8, 0x5bb: 0xb8, 0x5bc: 0xb8, 0x5bd: 0xb8, 0x5be: 0xb8, 0x5bf: 0xb8, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x9b, 0x5c1: 0x9b, 0x5c2: 0x9b, 0x5c3: 0x153, 0x5c4: 0x154, 0x5c5: 0x155, 0x5c6: 0x156, 0x5c7: 0x157, + 0x5c8: 0x9b, 0x5c9: 0x158, 0x5ca: 0xb8, 0x5cb: 0xb8, 0x5cc: 0x9b, 0x5cd: 0x159, 0x5ce: 0xb8, 0x5cf: 0xb8, + 0x5d0: 0x5d, 0x5d1: 0x5e, 0x5d2: 0x5f, 0x5d3: 0x60, 0x5d4: 0x61, 0x5d5: 0x62, 0x5d6: 0x63, 0x5d7: 0x64, + 0x5d8: 0x65, 0x5d9: 0x66, 0x5da: 0x67, 0x5db: 0x68, 0x5dc: 0x69, 0x5dd: 0x6a, 0x5de: 0x6b, 0x5df: 0x6c, + 0x5e0: 0x9b, 0x5e1: 0x9b, 0x5e2: 0x9b, 0x5e3: 0x9b, 0x5e4: 0x9b, 0x5e5: 0x9b, 0x5e6: 0x9b, 0x5e7: 0x9b, + 0x5e8: 0x15a, 0x5e9: 0x15b, 0x5ea: 0x15c, 0x5eb: 0xb8, 0x5ec: 0xb8, 0x5ed: 0xb8, 0x5ee: 0xb8, 0x5ef: 0xb8, + 0x5f0: 0xb8, 0x5f1: 0xb8, 0x5f2: 0xb8, 0x5f3: 0xb8, 0x5f4: 0xb8, 0x5f5: 0xb8, 0x5f6: 0xb8, 0x5f7: 0xb8, + 0x5f8: 0xb8, 0x5f9: 0xb8, 0x5fa: 0xb8, 0x5fb: 0xb8, 0x5fc: 0xb8, 0x5fd: 0xb8, 0x5fe: 0xb8, 0x5ff: 0xb8, + // Block 0x18, offset 0x600 + 0x600: 0x15d, 0x601: 0xb8, 0x602: 0xb8, 0x603: 0xb8, 0x604: 0xb8, 0x605: 0xb8, 0x606: 0xb8, 0x607: 0xb8, + 0x608: 0xb8, 0x609: 0xb8, 0x60a: 0xb8, 0x60b: 0xb8, 0x60c: 0xb8, 0x60d: 0xb8, 0x60e: 0xb8, 0x60f: 0xb8, + 0x610: 0xb8, 0x611: 0xb8, 0x612: 0xb8, 0x613: 0xb8, 0x614: 0xb8, 0x615: 0xb8, 0x616: 0xb8, 0x617: 0xb8, + 0x618: 0xb8, 0x619: 0xb8, 0x61a: 0xb8, 0x61b: 0xb8, 0x61c: 0xb8, 0x61d: 0xb8, 0x61e: 0xb8, 0x61f: 0xb8, + 0x620: 0x9d, 0x621: 0x9d, 0x622: 0x9d, 0x623: 0x15e, 0x624: 0x6d, 0x625: 0x15f, 0x626: 0xb8, 0x627: 0xb8, + 0x628: 0xb8, 0x629: 0xb8, 0x62a: 0xb8, 0x62b: 0xb8, 0x62c: 0xb8, 0x62d: 0xb8, 0x62e: 0xb8, 0x62f: 0xb8, + 0x630: 0xb8, 0x631: 0xb8, 0x632: 0xb8, 0x633: 0xb8, 0x634: 0xb8, 0x635: 0xb8, 0x636: 0xb8, 0x637: 0xb8, + 0x638: 0x6e, 0x639: 0x6f, 0x63a: 0x70, 0x63b: 0x160, 0x63c: 0xb8, 0x63d: 0xb8, 0x63e: 0xb8, 0x63f: 0xb8, + // Block 0x19, offset 0x640 + 0x640: 0x161, 0x641: 0x9b, 0x642: 0x162, 0x643: 0x163, 0x644: 0x71, 0x645: 0x72, 0x646: 0x164, 0x647: 0x165, + 0x648: 0x73, 0x649: 0x166, 0x64a: 0xb8, 0x64b: 0xb8, 0x64c: 0x9b, 0x64d: 0x9b, 0x64e: 0x9b, 0x64f: 0x9b, + 0x650: 0x9b, 0x651: 0x9b, 0x652: 0x9b, 0x653: 0x9b, 0x654: 0x9b, 0x655: 0x9b, 0x656: 0x9b, 0x657: 0x9b, + 0x658: 0x9b, 0x659: 0x9b, 0x65a: 0x9b, 0x65b: 0x167, 0x65c: 0x9b, 0x65d: 0x168, 0x65e: 0x9b, 0x65f: 0x169, + 0x660: 0x16a, 0x661: 0x16b, 0x662: 0x16c, 0x663: 0xb8, 0x664: 0x16d, 0x665: 0x16e, 0x666: 0x16f, 0x667: 0x170, + 0x668: 0xb8, 0x669: 0xb8, 0x66a: 0xb8, 0x66b: 0xb8, 0x66c: 0xb8, 0x66d: 0xb8, 0x66e: 0xb8, 0x66f: 0xb8, + 0x670: 0xb8, 0x671: 0xb8, 0x672: 0xb8, 0x673: 0xb8, 0x674: 0xb8, 0x675: 0xb8, 0x676: 0xb8, 0x677: 0xb8, + 0x678: 0xb8, 0x679: 0xb8, 0x67a: 0xb8, 0x67b: 0xb8, 0x67c: 0xb8, 0x67d: 0xb8, 0x67e: 0xb8, 0x67f: 0xb8, + // Block 0x1a, offset 0x680 + 0x680: 0x9d, 0x681: 0x9d, 0x682: 0x9d, 0x683: 0x9d, 0x684: 0x9d, 0x685: 0x9d, 0x686: 0x9d, 0x687: 0x9d, + 0x688: 0x9d, 0x689: 0x9d, 0x68a: 0x9d, 0x68b: 0x9d, 0x68c: 0x9d, 0x68d: 0x9d, 0x68e: 0x9d, 0x68f: 0x9d, + 0x690: 0x9d, 0x691: 0x9d, 0x692: 0x9d, 0x693: 0x9d, 0x694: 0x9d, 0x695: 0x9d, 0x696: 0x9d, 0x697: 0x9d, + 0x698: 0x9d, 0x699: 0x9d, 0x69a: 0x9d, 0x69b: 0x171, 0x69c: 0x9d, 0x69d: 0x9d, 0x69e: 0x9d, 0x69f: 0x9d, + 0x6a0: 0x9d, 0x6a1: 0x9d, 0x6a2: 0x9d, 0x6a3: 0x9d, 0x6a4: 0x9d, 0x6a5: 0x9d, 0x6a6: 0x9d, 0x6a7: 0x9d, + 0x6a8: 0x9d, 0x6a9: 0x9d, 0x6aa: 0x9d, 0x6ab: 0x9d, 0x6ac: 0x9d, 0x6ad: 0x9d, 0x6ae: 0x9d, 0x6af: 0x9d, + 0x6b0: 0x9d, 0x6b1: 0x9d, 0x6b2: 0x9d, 0x6b3: 0x9d, 0x6b4: 0x9d, 0x6b5: 0x9d, 0x6b6: 0x9d, 0x6b7: 0x9d, + 0x6b8: 0x9d, 0x6b9: 0x9d, 0x6ba: 0x9d, 0x6bb: 0x9d, 0x6bc: 0x9d, 0x6bd: 0x9d, 0x6be: 0x9d, 0x6bf: 0x9d, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x9d, 0x6c1: 0x9d, 0x6c2: 0x9d, 0x6c3: 0x9d, 0x6c4: 0x9d, 0x6c5: 0x9d, 0x6c6: 0x9d, 0x6c7: 0x9d, + 0x6c8: 0x9d, 0x6c9: 0x9d, 0x6ca: 0x9d, 0x6cb: 0x9d, 0x6cc: 0x9d, 0x6cd: 0x9d, 0x6ce: 0x9d, 0x6cf: 0x9d, + 0x6d0: 0x9d, 0x6d1: 0x9d, 0x6d2: 0x9d, 0x6d3: 0x9d, 0x6d4: 0x9d, 0x6d5: 0x9d, 0x6d6: 0x9d, 0x6d7: 0x9d, + 0x6d8: 0x9d, 0x6d9: 0x9d, 0x6da: 0x9d, 0x6db: 0x9d, 0x6dc: 0x172, 0x6dd: 0x9d, 0x6de: 0x9d, 0x6df: 0x9d, + 0x6e0: 0x173, 0x6e1: 0x9d, 0x6e2: 0x9d, 0x6e3: 0x9d, 0x6e4: 0x9d, 0x6e5: 0x9d, 0x6e6: 0x9d, 0x6e7: 0x9d, + 0x6e8: 0x9d, 0x6e9: 0x9d, 0x6ea: 0x9d, 0x6eb: 0x9d, 0x6ec: 0x9d, 0x6ed: 0x9d, 0x6ee: 0x9d, 0x6ef: 0x9d, + 0x6f0: 0x9d, 0x6f1: 0x9d, 0x6f2: 0x9d, 0x6f3: 0x9d, 0x6f4: 0x9d, 0x6f5: 0x9d, 0x6f6: 0x9d, 0x6f7: 0x9d, + 0x6f8: 0x9d, 0x6f9: 0x9d, 0x6fa: 0x9d, 0x6fb: 0x9d, 0x6fc: 0x9d, 0x6fd: 0x9d, 0x6fe: 0x9d, 0x6ff: 0x9d, + // Block 0x1c, offset 0x700 + 0x700: 0x9d, 0x701: 0x9d, 0x702: 0x9d, 0x703: 0x9d, 0x704: 0x9d, 0x705: 0x9d, 0x706: 0x9d, 0x707: 0x9d, + 0x708: 0x9d, 0x709: 0x9d, 0x70a: 0x9d, 0x70b: 0x9d, 0x70c: 0x9d, 0x70d: 0x9d, 0x70e: 0x9d, 0x70f: 0x9d, + 0x710: 0x9d, 0x711: 0x9d, 0x712: 0x9d, 0x713: 0x9d, 0x714: 0x9d, 0x715: 0x9d, 0x716: 0x9d, 0x717: 0x9d, + 0x718: 0x9d, 0x719: 0x9d, 0x71a: 0x9d, 0x71b: 0x9d, 0x71c: 0x9d, 0x71d: 0x9d, 0x71e: 0x9d, 0x71f: 0x9d, + 0x720: 0x9d, 0x721: 0x9d, 0x722: 0x9d, 0x723: 0x9d, 0x724: 0x9d, 0x725: 0x9d, 0x726: 0x9d, 0x727: 0x9d, + 0x728: 0x9d, 0x729: 0x9d, 0x72a: 0x9d, 0x72b: 0x9d, 0x72c: 0x9d, 0x72d: 0x9d, 0x72e: 0x9d, 0x72f: 0x9d, + 0x730: 0x9d, 0x731: 0x9d, 0x732: 0x9d, 0x733: 0x9d, 0x734: 0x9d, 0x735: 0x9d, 0x736: 0x9d, 0x737: 0x9d, + 0x738: 0x9d, 0x739: 0x9d, 0x73a: 0x174, 0x73b: 0xb8, 0x73c: 0xb8, 0x73d: 0xb8, 0x73e: 0xb8, 0x73f: 0xb8, + // Block 0x1d, offset 0x740 + 0x740: 0xb8, 0x741: 0xb8, 0x742: 0xb8, 0x743: 0xb8, 0x744: 0xb8, 0x745: 0xb8, 0x746: 0xb8, 0x747: 0xb8, + 0x748: 0xb8, 0x749: 0xb8, 0x74a: 0xb8, 0x74b: 0xb8, 0x74c: 0xb8, 0x74d: 0xb8, 0x74e: 0xb8, 0x74f: 0xb8, + 0x750: 0xb8, 0x751: 0xb8, 0x752: 0xb8, 0x753: 0xb8, 0x754: 0xb8, 0x755: 0xb8, 0x756: 0xb8, 0x757: 0xb8, + 0x758: 0xb8, 0x759: 0xb8, 0x75a: 0xb8, 0x75b: 0xb8, 0x75c: 0xb8, 0x75d: 0xb8, 0x75e: 0xb8, 0x75f: 0xb8, + 0x760: 0x74, 0x761: 0x75, 0x762: 0x76, 0x763: 0x175, 0x764: 0x77, 0x765: 0x78, 0x766: 0x176, 0x767: 0x79, + 0x768: 0x7a, 0x769: 0xb8, 0x76a: 0xb8, 0x76b: 0xb8, 0x76c: 0xb8, 0x76d: 0xb8, 0x76e: 0xb8, 0x76f: 0xb8, + 0x770: 0xb8, 0x771: 0xb8, 0x772: 0xb8, 0x773: 0xb8, 0x774: 0xb8, 0x775: 0xb8, 0x776: 0xb8, 0x777: 0xb8, + 0x778: 0xb8, 0x779: 0xb8, 0x77a: 0xb8, 0x77b: 0xb8, 0x77c: 0xb8, 0x77d: 0xb8, 0x77e: 0xb8, 0x77f: 0xb8, + // Block 0x1e, offset 0x780 + 0x790: 0x0d, 0x791: 0x0e, 0x792: 0x0f, 0x793: 0x10, 0x794: 0x11, 0x795: 0x0b, 0x796: 0x12, 0x797: 0x07, + 0x798: 0x13, 0x799: 0x0b, 0x79a: 0x0b, 0x79b: 0x14, 0x79c: 0x0b, 0x79d: 0x15, 0x79e: 0x16, 0x79f: 0x17, + 0x7a0: 0x07, 0x7a1: 0x07, 0x7a2: 0x07, 0x7a3: 0x07, 0x7a4: 0x07, 0x7a5: 0x07, 0x7a6: 0x07, 0x7a7: 0x07, + 0x7a8: 0x07, 0x7a9: 0x07, 0x7aa: 0x18, 0x7ab: 0x19, 0x7ac: 0x1a, 0x7ad: 0x0b, 0x7ae: 0x0b, 0x7af: 0x1b, + 0x7b0: 0x0b, 0x7b1: 0x0b, 0x7b2: 0x0b, 0x7b3: 0x0b, 0x7b4: 0x0b, 0x7b5: 0x0b, 0x7b6: 0x0b, 0x7b7: 0x0b, + 0x7b8: 0x0b, 0x7b9: 0x0b, 0x7ba: 0x0b, 0x7bb: 0x0b, 0x7bc: 0x0b, 0x7bd: 0x0b, 0x7be: 0x0b, 0x7bf: 0x0b, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x0b, 0x7c1: 0x0b, 0x7c2: 0x0b, 0x7c3: 0x0b, 0x7c4: 0x0b, 0x7c5: 0x0b, 0x7c6: 0x0b, 0x7c7: 0x0b, + 0x7c8: 0x0b, 0x7c9: 0x0b, 0x7ca: 0x0b, 0x7cb: 0x0b, 0x7cc: 0x0b, 0x7cd: 0x0b, 0x7ce: 0x0b, 0x7cf: 0x0b, + 0x7d0: 0x0b, 0x7d1: 0x0b, 0x7d2: 0x0b, 0x7d3: 0x0b, 0x7d4: 0x0b, 0x7d5: 0x0b, 0x7d6: 0x0b, 0x7d7: 0x0b, + 0x7d8: 0x0b, 0x7d9: 0x0b, 0x7da: 0x0b, 0x7db: 0x0b, 0x7dc: 0x0b, 0x7dd: 0x0b, 0x7de: 0x0b, 0x7df: 0x0b, + 0x7e0: 0x0b, 0x7e1: 0x0b, 0x7e2: 0x0b, 0x7e3: 0x0b, 0x7e4: 0x0b, 0x7e5: 0x0b, 0x7e6: 0x0b, 0x7e7: 0x0b, + 0x7e8: 0x0b, 0x7e9: 0x0b, 0x7ea: 0x0b, 0x7eb: 0x0b, 0x7ec: 0x0b, 0x7ed: 0x0b, 0x7ee: 0x0b, 0x7ef: 0x0b, + 0x7f0: 0x0b, 0x7f1: 0x0b, 0x7f2: 0x0b, 0x7f3: 0x0b, 0x7f4: 0x0b, 0x7f5: 0x0b, 0x7f6: 0x0b, 0x7f7: 0x0b, + 0x7f8: 0x0b, 0x7f9: 0x0b, 0x7fa: 0x0b, 0x7fb: 0x0b, 0x7fc: 0x0b, 0x7fd: 0x0b, 0x7fe: 0x0b, 0x7ff: 0x0b, + // Block 0x20, offset 0x800 + 0x800: 0x177, 0x801: 0x178, 0x802: 0xb8, 0x803: 0xb8, 0x804: 0x179, 0x805: 0x179, 0x806: 0x179, 0x807: 0x17a, + 0x808: 0xb8, 0x809: 0xb8, 0x80a: 0xb8, 0x80b: 0xb8, 0x80c: 0xb8, 0x80d: 0xb8, 0x80e: 0xb8, 0x80f: 0xb8, + 0x810: 0xb8, 0x811: 0xb8, 0x812: 0xb8, 0x813: 0xb8, 0x814: 0xb8, 0x815: 0xb8, 0x816: 0xb8, 0x817: 0xb8, + 0x818: 0xb8, 0x819: 0xb8, 0x81a: 0xb8, 0x81b: 0xb8, 0x81c: 0xb8, 0x81d: 0xb8, 0x81e: 0xb8, 0x81f: 0xb8, + 0x820: 0xb8, 0x821: 0xb8, 0x822: 0xb8, 0x823: 0xb8, 0x824: 0xb8, 0x825: 0xb8, 0x826: 0xb8, 0x827: 0xb8, + 0x828: 0xb8, 0x829: 0xb8, 0x82a: 0xb8, 0x82b: 0xb8, 0x82c: 0xb8, 0x82d: 0xb8, 0x82e: 0xb8, 0x82f: 0xb8, + 0x830: 0xb8, 0x831: 0xb8, 0x832: 0xb8, 0x833: 0xb8, 0x834: 0xb8, 0x835: 0xb8, 0x836: 0xb8, 0x837: 0xb8, + 0x838: 0xb8, 0x839: 0xb8, 0x83a: 0xb8, 0x83b: 0xb8, 0x83c: 0xb8, 0x83d: 0xb8, 0x83e: 0xb8, 0x83f: 0xb8, + // Block 0x21, offset 0x840 + 0x840: 0x0b, 0x841: 0x0b, 0x842: 0x0b, 0x843: 0x0b, 0x844: 0x0b, 0x845: 0x0b, 0x846: 0x0b, 0x847: 0x0b, + 0x848: 0x0b, 0x849: 0x0b, 0x84a: 0x0b, 0x84b: 0x0b, 0x84c: 0x0b, 0x84d: 0x0b, 0x84e: 0x0b, 0x84f: 0x0b, + 0x850: 0x0b, 0x851: 0x0b, 0x852: 0x0b, 0x853: 0x0b, 0x854: 0x0b, 0x855: 0x0b, 0x856: 0x0b, 0x857: 0x0b, + 0x858: 0x0b, 0x859: 0x0b, 0x85a: 0x0b, 0x85b: 0x0b, 0x85c: 0x0b, 0x85d: 0x0b, 0x85e: 0x0b, 0x85f: 0x0b, + 0x860: 0x1e, 0x861: 0x0b, 0x862: 0x0b, 0x863: 0x0b, 0x864: 0x0b, 0x865: 0x0b, 0x866: 0x0b, 0x867: 0x0b, + 0x868: 0x0b, 0x869: 0x0b, 0x86a: 0x0b, 0x86b: 0x0b, 0x86c: 0x0b, 0x86d: 0x0b, 0x86e: 0x0b, 0x86f: 0x0b, + 0x870: 0x0b, 0x871: 0x0b, 0x872: 0x0b, 0x873: 0x0b, 0x874: 0x0b, 0x875: 0x0b, 0x876: 0x0b, 0x877: 0x0b, + 0x878: 0x0b, 0x879: 0x0b, 0x87a: 0x0b, 0x87b: 0x0b, 0x87c: 0x0b, 0x87d: 0x0b, 0x87e: 0x0b, 0x87f: 0x0b, + // Block 0x22, offset 0x880 + 0x880: 0x0b, 0x881: 0x0b, 0x882: 0x0b, 0x883: 0x0b, 0x884: 0x0b, 0x885: 0x0b, 0x886: 0x0b, 0x887: 0x0b, + 0x888: 0x0b, 0x889: 0x0b, 0x88a: 0x0b, 0x88b: 0x0b, 0x88c: 0x0b, 0x88d: 0x0b, 0x88e: 0x0b, 0x88f: 0x0b, +} + +// idnaSparseOffset: 256 entries, 512 bytes +var idnaSparseOffset = []uint16{0x0, 0x8, 0x19, 0x25, 0x27, 0x2c, 0x34, 0x3f, 0x4b, 0x5c, 0x60, 0x6f, 0x74, 0x7b, 0x87, 0x95, 0xa3, 0xa8, 0xb1, 0xc1, 0xcf, 0xdc, 0xe8, 0xf9, 0x103, 0x10a, 0x117, 0x128, 0x12f, 0x13a, 0x149, 0x157, 0x161, 0x163, 0x167, 0x169, 0x175, 0x180, 0x188, 0x18e, 0x194, 0x199, 0x19e, 0x1a1, 0x1a5, 0x1ab, 0x1b0, 0x1bc, 0x1c6, 0x1cc, 0x1dd, 0x1e7, 0x1ea, 0x1f2, 0x1f5, 0x202, 0x20a, 0x20e, 0x215, 0x21d, 0x22d, 0x239, 0x23b, 0x245, 0x251, 0x25d, 0x269, 0x271, 0x276, 0x280, 0x291, 0x295, 0x2a0, 0x2a4, 0x2ad, 0x2b5, 0x2bb, 0x2c0, 0x2c3, 0x2c6, 0x2ca, 0x2d0, 0x2d4, 0x2d8, 0x2de, 0x2e5, 0x2eb, 0x2f3, 0x2fa, 0x305, 0x30f, 0x313, 0x316, 0x31c, 0x320, 0x322, 0x325, 0x327, 0x32a, 0x334, 0x337, 0x346, 0x34a, 0x34f, 0x352, 0x356, 0x35b, 0x360, 0x366, 0x36c, 0x37b, 0x381, 0x385, 0x394, 0x399, 0x3a1, 0x3ab, 0x3b6, 0x3be, 0x3cf, 0x3d8, 0x3e8, 0x3f5, 0x3ff, 0x404, 0x411, 0x415, 0x41a, 0x41c, 0x420, 0x422, 0x426, 0x42f, 0x435, 0x439, 0x449, 0x453, 0x458, 0x45b, 0x461, 0x468, 0x46d, 0x471, 0x477, 0x47c, 0x485, 0x48a, 0x490, 0x497, 0x49e, 0x4a5, 0x4a9, 0x4ae, 0x4b1, 0x4b6, 0x4c2, 0x4c8, 0x4cd, 0x4d4, 0x4dc, 0x4e1, 0x4e5, 0x4f5, 0x4fc, 0x500, 0x504, 0x50b, 0x50e, 0x511, 0x515, 0x519, 0x51f, 0x528, 0x534, 0x53b, 0x544, 0x54c, 0x553, 0x561, 0x56e, 0x57b, 0x584, 0x588, 0x596, 0x59e, 0x5a9, 0x5b2, 0x5b8, 0x5c0, 0x5c9, 0x5d3, 0x5d6, 0x5e2, 0x5e5, 0x5ea, 0x5ed, 0x5f7, 0x600, 0x60c, 0x60f, 0x614, 0x617, 0x61a, 0x61d, 0x624, 0x62b, 0x62f, 0x63a, 0x63d, 0x643, 0x648, 0x64c, 0x64f, 0x652, 0x655, 0x65a, 0x664, 0x667, 0x66b, 0x67a, 0x686, 0x68a, 0x68f, 0x694, 0x698, 0x69d, 0x6a6, 0x6b1, 0x6b7, 0x6bf, 0x6c3, 0x6c7, 0x6cd, 0x6d3, 0x6d8, 0x6db, 0x6e9, 0x6f0, 0x6f3, 0x6f6, 0x6fa, 0x700, 0x705, 0x70f, 0x714, 0x717, 0x71a, 0x71d, 0x720, 0x724, 0x727, 0x737, 0x748, 0x74d, 0x74f, 0x751} + +// idnaSparseValues: 1876 entries, 7504 bytes +var idnaSparseValues = [1876]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0000, lo: 0x07}, + {value: 0xe105, lo: 0x80, hi: 0x96}, + {value: 0x0018, lo: 0x97, hi: 0x97}, + {value: 0xe105, lo: 0x98, hi: 0x9e}, + {value: 0x001f, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xb7}, + {value: 0x0008, lo: 0xb8, hi: 0xbf}, + // Block 0x1, offset 0x8 + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0xe01d, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x82}, + {value: 0x0335, lo: 0x83, hi: 0x83}, + {value: 0x034d, lo: 0x84, hi: 0x84}, + {value: 0x0365, lo: 0x85, hi: 0x85}, + {value: 0xe00d, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x87}, + {value: 0xe00d, lo: 0x88, hi: 0x88}, + {value: 0x0008, lo: 0x89, hi: 0x89}, + {value: 0xe00d, lo: 0x8a, hi: 0x8a}, + {value: 0x0008, lo: 0x8b, hi: 0x8b}, + {value: 0xe00d, lo: 0x8c, hi: 0x8c}, + {value: 0x0008, lo: 0x8d, hi: 0x8d}, + {value: 0xe00d, lo: 0x8e, hi: 0x8e}, + {value: 0x0008, lo: 0x8f, hi: 0xbf}, + // Block 0x2, offset 0x19 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x0249, lo: 0xb0, hi: 0xb0}, + {value: 0x037d, lo: 0xb1, hi: 0xb1}, + {value: 0x0259, lo: 0xb2, hi: 0xb2}, + {value: 0x0269, lo: 0xb3, hi: 0xb3}, + {value: 0x034d, lo: 0xb4, hi: 0xb4}, + {value: 0x0395, lo: 0xb5, hi: 0xb5}, + {value: 0xe1bd, lo: 0xb6, hi: 0xb6}, + {value: 0x0279, lo: 0xb7, hi: 0xb7}, + {value: 0x0289, lo: 0xb8, hi: 0xb8}, + {value: 0x0008, lo: 0xb9, hi: 0xbf}, + // Block 0x3, offset 0x25 + {value: 0x0000, lo: 0x01}, + {value: 0x1308, lo: 0x80, hi: 0xbf}, + // Block 0x4, offset 0x27 + {value: 0x0000, lo: 0x04}, + {value: 0x03f5, lo: 0x80, hi: 0x8f}, + {value: 0xe105, lo: 0x90, hi: 0x9f}, + {value: 0x049d, lo: 0xa0, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x5, offset 0x2c + {value: 0x0000, lo: 0x07}, + {value: 0xe185, lo: 0x80, hi: 0x8f}, + {value: 0x0545, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x98}, + {value: 0x0008, lo: 0x99, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xa0}, + {value: 0x0008, lo: 0xa1, hi: 0xbf}, + // Block 0x6, offset 0x34 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0401, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x88}, + {value: 0x0018, lo: 0x89, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x90}, + {value: 0x1308, lo: 0x91, hi: 0xbd}, + {value: 0x0018, lo: 0xbe, hi: 0xbe}, + {value: 0x1308, lo: 0xbf, hi: 0xbf}, + // Block 0x7, offset 0x3f + {value: 0x0000, lo: 0x0b}, + {value: 0x0018, lo: 0x80, hi: 0x80}, + {value: 0x1308, lo: 0x81, hi: 0x82}, + {value: 0x0018, lo: 0x83, hi: 0x83}, + {value: 0x1308, lo: 0x84, hi: 0x85}, + {value: 0x0018, lo: 0x86, hi: 0x86}, + {value: 0x1308, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0x8, offset 0x4b + {value: 0x0000, lo: 0x10}, + {value: 0x0018, lo: 0x80, hi: 0x80}, + {value: 0x0208, lo: 0x81, hi: 0x87}, + {value: 0x0408, lo: 0x88, hi: 0x88}, + {value: 0x0208, lo: 0x89, hi: 0x8a}, + {value: 0x1308, lo: 0x8b, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xad}, + {value: 0x0208, lo: 0xae, hi: 0xaf}, + {value: 0x1308, lo: 0xb0, hi: 0xb0}, + {value: 0x0408, lo: 0xb1, hi: 0xb3}, + {value: 0x0008, lo: 0xb4, hi: 0xb4}, + {value: 0x0429, lo: 0xb5, hi: 0xb5}, + {value: 0x0451, lo: 0xb6, hi: 0xb6}, + {value: 0x0479, lo: 0xb7, hi: 0xb7}, + {value: 0x04a1, lo: 0xb8, hi: 0xb8}, + {value: 0x0208, lo: 0xb9, hi: 0xbf}, + // Block 0x9, offset 0x5c + {value: 0x0000, lo: 0x03}, + {value: 0x0208, lo: 0x80, hi: 0x87}, + {value: 0x0408, lo: 0x88, hi: 0x99}, + {value: 0x0208, lo: 0x9a, hi: 0xbf}, + // Block 0xa, offset 0x60 + {value: 0x0000, lo: 0x0e}, + {value: 0x1308, lo: 0x80, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8c}, + {value: 0x0408, lo: 0x8d, hi: 0x8d}, + {value: 0x0208, lo: 0x8e, hi: 0x98}, + {value: 0x0408, lo: 0x99, hi: 0x9b}, + {value: 0x0208, lo: 0x9c, hi: 0xaa}, + {value: 0x0408, lo: 0xab, hi: 0xac}, + {value: 0x0208, lo: 0xad, hi: 0xb0}, + {value: 0x0408, lo: 0xb1, hi: 0xb1}, + {value: 0x0208, lo: 0xb2, hi: 0xb2}, + {value: 0x0408, lo: 0xb3, hi: 0xb4}, + {value: 0x0208, lo: 0xb5, hi: 0xb7}, + {value: 0x0408, lo: 0xb8, hi: 0xb9}, + {value: 0x0208, lo: 0xba, hi: 0xbf}, + // Block 0xb, offset 0x6f + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x1308, lo: 0xa6, hi: 0xb0}, + {value: 0x0008, lo: 0xb1, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0xc, offset 0x74 + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0208, lo: 0x8a, hi: 0xaa}, + {value: 0x1308, lo: 0xab, hi: 0xb3}, + {value: 0x0008, lo: 0xb4, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0xd, offset 0x7b + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x95}, + {value: 0x1308, lo: 0x96, hi: 0x99}, + {value: 0x0008, lo: 0x9a, hi: 0x9a}, + {value: 0x1308, lo: 0x9b, hi: 0xa3}, + {value: 0x0008, lo: 0xa4, hi: 0xa4}, + {value: 0x1308, lo: 0xa5, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xa8}, + {value: 0x1308, lo: 0xa9, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xe, offset 0x87 + {value: 0x0000, lo: 0x0d}, + {value: 0x0408, lo: 0x80, hi: 0x80}, + {value: 0x0208, lo: 0x81, hi: 0x85}, + {value: 0x0408, lo: 0x86, hi: 0x87}, + {value: 0x0208, lo: 0x88, hi: 0x88}, + {value: 0x0408, lo: 0x89, hi: 0x89}, + {value: 0x0208, lo: 0x8a, hi: 0x93}, + {value: 0x0408, lo: 0x94, hi: 0x94}, + {value: 0x0208, lo: 0x95, hi: 0x95}, + {value: 0x0008, lo: 0x96, hi: 0x98}, + {value: 0x1308, lo: 0x99, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0xbf}, + // Block 0xf, offset 0x95 + {value: 0x0000, lo: 0x0d}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0208, lo: 0xa0, hi: 0xa9}, + {value: 0x0408, lo: 0xaa, hi: 0xac}, + {value: 0x0008, lo: 0xad, hi: 0xad}, + {value: 0x0408, lo: 0xae, hi: 0xae}, + {value: 0x0208, lo: 0xaf, hi: 0xb0}, + {value: 0x0408, lo: 0xb1, hi: 0xb2}, + {value: 0x0208, lo: 0xb3, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xb5}, + {value: 0x0208, lo: 0xb6, hi: 0xb8}, + {value: 0x0408, lo: 0xb9, hi: 0xb9}, + {value: 0x0208, lo: 0xba, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x10, offset 0xa3 + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x93}, + {value: 0x1308, lo: 0x94, hi: 0xa1}, + {value: 0x0040, lo: 0xa2, hi: 0xa2}, + {value: 0x1308, lo: 0xa3, hi: 0xbf}, + // Block 0x11, offset 0xa8 + {value: 0x0000, lo: 0x08}, + {value: 0x1308, lo: 0x80, hi: 0x82}, + {value: 0x1008, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0xb9}, + {value: 0x1308, lo: 0xba, hi: 0xba}, + {value: 0x1008, lo: 0xbb, hi: 0xbb}, + {value: 0x1308, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x1008, lo: 0xbe, hi: 0xbf}, + // Block 0x12, offset 0xb1 + {value: 0x0000, lo: 0x0f}, + {value: 0x1308, lo: 0x80, hi: 0x80}, + {value: 0x1008, lo: 0x81, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x85}, + {value: 0x1008, lo: 0x86, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x1008, lo: 0x8a, hi: 0x8c}, + {value: 0x1b08, lo: 0x8d, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x96}, + {value: 0x1008, lo: 0x97, hi: 0x97}, + {value: 0x0040, lo: 0x98, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0x13, offset 0xc1 + {value: 0x0000, lo: 0x0d}, + {value: 0x1308, lo: 0x80, hi: 0x80}, + {value: 0x1008, lo: 0x81, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x0008, lo: 0x92, hi: 0xa8}, + {value: 0x0040, lo: 0xa9, hi: 0xa9}, + {value: 0x0008, lo: 0xaa, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x1308, lo: 0xbe, hi: 0xbf}, + // Block 0x14, offset 0xcf + {value: 0x0000, lo: 0x0c}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x1308, lo: 0x81, hi: 0x81}, + {value: 0x1008, lo: 0x82, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x0008, lo: 0x92, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x1008, lo: 0xbe, hi: 0xbf}, + // Block 0x15, offset 0xdc + {value: 0x0000, lo: 0x0b}, + {value: 0x0040, lo: 0x80, hi: 0x81}, + {value: 0x1008, lo: 0x82, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x99}, + {value: 0x0008, lo: 0x9a, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xb2}, + {value: 0x0008, lo: 0xb3, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x16, offset 0xe8 + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x89}, + {value: 0x1b08, lo: 0x8a, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8e}, + {value: 0x1008, lo: 0x8f, hi: 0x91}, + {value: 0x1308, lo: 0x92, hi: 0x94}, + {value: 0x0040, lo: 0x95, hi: 0x95}, + {value: 0x1308, lo: 0x96, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x1008, lo: 0x98, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xb1}, + {value: 0x1008, lo: 0xb2, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0x17, offset 0xf9 + {value: 0x0000, lo: 0x09}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0xb0}, + {value: 0x1308, lo: 0xb1, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb2}, + {value: 0x08f1, lo: 0xb3, hi: 0xb3}, + {value: 0x1308, lo: 0xb4, hi: 0xb9}, + {value: 0x1b08, lo: 0xba, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbe}, + {value: 0x0018, lo: 0xbf, hi: 0xbf}, + // Block 0x18, offset 0x103 + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x1308, lo: 0x87, hi: 0x8e}, + {value: 0x0018, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0xbf}, + // Block 0x19, offset 0x10a + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x84}, + {value: 0x0040, lo: 0x85, hi: 0x85}, + {value: 0x0008, lo: 0x86, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x1308, lo: 0x88, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9b}, + {value: 0x0961, lo: 0x9c, hi: 0x9c}, + {value: 0x0999, lo: 0x9d, hi: 0x9d}, + {value: 0x0008, lo: 0x9e, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0x1a, offset 0x117 + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x8a}, + {value: 0x0008, lo: 0x8b, hi: 0x8b}, + {value: 0xe03d, lo: 0x8c, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x97}, + {value: 0x1308, lo: 0x98, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xb4}, + {value: 0x1308, lo: 0xb5, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xb6}, + {value: 0x1308, lo: 0xb7, hi: 0xb7}, + {value: 0x0018, lo: 0xb8, hi: 0xb8}, + {value: 0x1308, lo: 0xb9, hi: 0xb9}, + {value: 0x0018, lo: 0xba, hi: 0xbd}, + {value: 0x1008, lo: 0xbe, hi: 0xbf}, + // Block 0x1b, offset 0x128 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x85}, + {value: 0x1308, lo: 0x86, hi: 0x86}, + {value: 0x0018, lo: 0x87, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8d}, + {value: 0x0018, lo: 0x8e, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0xbf}, + // Block 0x1c, offset 0x12f + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x1008, lo: 0xab, hi: 0xac}, + {value: 0x1308, lo: 0xad, hi: 0xb0}, + {value: 0x1008, lo: 0xb1, hi: 0xb1}, + {value: 0x1308, lo: 0xb2, hi: 0xb7}, + {value: 0x1008, lo: 0xb8, hi: 0xb8}, + {value: 0x1b08, lo: 0xb9, hi: 0xba}, + {value: 0x1008, lo: 0xbb, hi: 0xbc}, + {value: 0x1308, lo: 0xbd, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0x1d, offset 0x13a + {value: 0x0000, lo: 0x0e}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0018, lo: 0x8a, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x95}, + {value: 0x1008, lo: 0x96, hi: 0x97}, + {value: 0x1308, lo: 0x98, hi: 0x99}, + {value: 0x0008, lo: 0x9a, hi: 0x9d}, + {value: 0x1308, lo: 0x9e, hi: 0xa0}, + {value: 0x0008, lo: 0xa1, hi: 0xa1}, + {value: 0x1008, lo: 0xa2, hi: 0xa4}, + {value: 0x0008, lo: 0xa5, hi: 0xa6}, + {value: 0x1008, lo: 0xa7, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xb0}, + {value: 0x1308, lo: 0xb1, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xbf}, + // Block 0x1e, offset 0x149 + {value: 0x0000, lo: 0x0d}, + {value: 0x0008, lo: 0x80, hi: 0x81}, + {value: 0x1308, lo: 0x82, hi: 0x82}, + {value: 0x1008, lo: 0x83, hi: 0x84}, + {value: 0x1308, lo: 0x85, hi: 0x86}, + {value: 0x1008, lo: 0x87, hi: 0x8c}, + {value: 0x1308, lo: 0x8d, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x8e}, + {value: 0x1008, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x1008, lo: 0x9a, hi: 0x9c}, + {value: 0x1308, lo: 0x9d, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0x1f, offset 0x157 + {value: 0x0000, lo: 0x09}, + {value: 0x0040, lo: 0x80, hi: 0x86}, + {value: 0x055d, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8c}, + {value: 0x055d, lo: 0x8d, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbb}, + {value: 0xe105, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbf}, + // Block 0x20, offset 0x161 + {value: 0x0000, lo: 0x01}, + {value: 0x0018, lo: 0x80, hi: 0xbf}, + // Block 0x21, offset 0x163 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0xa0}, + {value: 0x0018, lo: 0xa1, hi: 0xbf}, + // Block 0x22, offset 0x167 + {value: 0x0000, lo: 0x01}, + {value: 0x0008, lo: 0x80, hi: 0xbf}, + // Block 0x23, offset 0x169 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0x98}, + {value: 0x0040, lo: 0x99, hi: 0x99}, + {value: 0x0008, lo: 0x9a, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x24, offset 0x175 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb7}, + {value: 0x0008, lo: 0xb8, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x25, offset 0x180 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0040, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0xbf}, + // Block 0x26, offset 0x188 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0x0008, lo: 0x92, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0xbf}, + // Block 0x27, offset 0x18e + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0x9c}, + {value: 0x1308, lo: 0x9d, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0x28, offset 0x194 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x29, offset 0x199 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb7}, + {value: 0xe045, lo: 0xb8, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x2a, offset 0x19e + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0xbf}, + // Block 0x2b, offset 0x1a1 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xac}, + {value: 0x0018, lo: 0xad, hi: 0xae}, + {value: 0x0008, lo: 0xaf, hi: 0xbf}, + // Block 0x2c, offset 0x1a5 + {value: 0x0000, lo: 0x05}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9c}, + {value: 0x0040, lo: 0x9d, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x2d, offset 0x1ab + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x0018, lo: 0xab, hi: 0xb0}, + {value: 0x0008, lo: 0xb1, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0x2e, offset 0x1b0 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8d}, + {value: 0x0008, lo: 0x8e, hi: 0x91}, + {value: 0x1308, lo: 0x92, hi: 0x93}, + {value: 0x1b08, lo: 0x94, hi: 0x94}, + {value: 0x0040, lo: 0x95, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb1}, + {value: 0x1308, lo: 0xb2, hi: 0xb3}, + {value: 0x1b08, lo: 0xb4, hi: 0xb4}, + {value: 0x0018, lo: 0xb5, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x2f, offset 0x1bc + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x91}, + {value: 0x1308, lo: 0x92, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xb1}, + {value: 0x1308, lo: 0xb2, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbf}, + // Block 0x30, offset 0x1c6 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0xb3}, + {value: 0x1340, lo: 0xb4, hi: 0xb5}, + {value: 0x1008, lo: 0xb6, hi: 0xb6}, + {value: 0x1308, lo: 0xb7, hi: 0xbd}, + {value: 0x1008, lo: 0xbe, hi: 0xbf}, + // Block 0x31, offset 0x1cc + {value: 0x0000, lo: 0x10}, + {value: 0x1008, lo: 0x80, hi: 0x85}, + {value: 0x1308, lo: 0x86, hi: 0x86}, + {value: 0x1008, lo: 0x87, hi: 0x88}, + {value: 0x1308, lo: 0x89, hi: 0x91}, + {value: 0x1b08, lo: 0x92, hi: 0x92}, + {value: 0x1308, lo: 0x93, hi: 0x93}, + {value: 0x0018, lo: 0x94, hi: 0x96}, + {value: 0x0008, lo: 0x97, hi: 0x97}, + {value: 0x0018, lo: 0x98, hi: 0x9b}, + {value: 0x0008, lo: 0x9c, hi: 0x9c}, + {value: 0x1308, lo: 0x9d, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x32, offset 0x1dd + {value: 0x0000, lo: 0x09}, + {value: 0x0018, lo: 0x80, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x86}, + {value: 0x0218, lo: 0x87, hi: 0x87}, + {value: 0x0018, lo: 0x88, hi: 0x8a}, + {value: 0x13c0, lo: 0x8b, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0208, lo: 0xa0, hi: 0xbf}, + // Block 0x33, offset 0x1e7 + {value: 0x0000, lo: 0x02}, + {value: 0x0208, lo: 0x80, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbf}, + // Block 0x34, offset 0x1ea + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x84}, + {value: 0x1308, lo: 0x85, hi: 0x86}, + {value: 0x0208, lo: 0x87, hi: 0xa8}, + {value: 0x1308, lo: 0xa9, hi: 0xa9}, + {value: 0x0208, lo: 0xaa, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x35, offset 0x1f2 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0x36, offset 0x1f5 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x1308, lo: 0xa0, hi: 0xa2}, + {value: 0x1008, lo: 0xa3, hi: 0xa6}, + {value: 0x1308, lo: 0xa7, hi: 0xa8}, + {value: 0x1008, lo: 0xa9, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x1008, lo: 0xb0, hi: 0xb1}, + {value: 0x1308, lo: 0xb2, hi: 0xb2}, + {value: 0x1008, lo: 0xb3, hi: 0xb8}, + {value: 0x1308, lo: 0xb9, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x37, offset 0x202 + {value: 0x0000, lo: 0x07}, + {value: 0x0018, lo: 0x80, hi: 0x80}, + {value: 0x0040, lo: 0x81, hi: 0x83}, + {value: 0x0018, lo: 0x84, hi: 0x85}, + {value: 0x0008, lo: 0x86, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0x38, offset 0x20a + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x39, offset 0x20e + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0028, lo: 0x9a, hi: 0x9a}, + {value: 0x0040, lo: 0x9b, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0xbf}, + // Block 0x3a, offset 0x215 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x96}, + {value: 0x1308, lo: 0x97, hi: 0x98}, + {value: 0x1008, lo: 0x99, hi: 0x9a}, + {value: 0x1308, lo: 0x9b, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x3b, offset 0x21d + {value: 0x0000, lo: 0x0f}, + {value: 0x0008, lo: 0x80, hi: 0x94}, + {value: 0x1008, lo: 0x95, hi: 0x95}, + {value: 0x1308, lo: 0x96, hi: 0x96}, + {value: 0x1008, lo: 0x97, hi: 0x97}, + {value: 0x1308, lo: 0x98, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x1b08, lo: 0xa0, hi: 0xa0}, + {value: 0x1008, lo: 0xa1, hi: 0xa1}, + {value: 0x1308, lo: 0xa2, hi: 0xa2}, + {value: 0x1008, lo: 0xa3, hi: 0xa4}, + {value: 0x1308, lo: 0xa5, hi: 0xac}, + {value: 0x1008, lo: 0xad, hi: 0xb2}, + {value: 0x1308, lo: 0xb3, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbe}, + {value: 0x1308, lo: 0xbf, hi: 0xbf}, + // Block 0x3c, offset 0x22d + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa6}, + {value: 0x0008, lo: 0xa7, hi: 0xa7}, + {value: 0x0018, lo: 0xa8, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x1308, lo: 0xb0, hi: 0xbd}, + {value: 0x1318, lo: 0xbe, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x3d, offset 0x239 + {value: 0x0000, lo: 0x01}, + {value: 0x0040, lo: 0x80, hi: 0xbf}, + // Block 0x3e, offset 0x23b + {value: 0x0000, lo: 0x09}, + {value: 0x1308, lo: 0x80, hi: 0x83}, + {value: 0x1008, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0xb3}, + {value: 0x1308, lo: 0xb4, hi: 0xb4}, + {value: 0x1008, lo: 0xb5, hi: 0xb5}, + {value: 0x1308, lo: 0xb6, hi: 0xba}, + {value: 0x1008, lo: 0xbb, hi: 0xbb}, + {value: 0x1308, lo: 0xbc, hi: 0xbc}, + {value: 0x1008, lo: 0xbd, hi: 0xbf}, + // Block 0x3f, offset 0x245 + {value: 0x0000, lo: 0x0b}, + {value: 0x1008, lo: 0x80, hi: 0x81}, + {value: 0x1308, lo: 0x82, hi: 0x82}, + {value: 0x1008, lo: 0x83, hi: 0x83}, + {value: 0x1808, lo: 0x84, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0xaa}, + {value: 0x1308, lo: 0xab, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0x40, offset 0x251 + {value: 0x0000, lo: 0x0b}, + {value: 0x1308, lo: 0x80, hi: 0x81}, + {value: 0x1008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xa0}, + {value: 0x1008, lo: 0xa1, hi: 0xa1}, + {value: 0x1308, lo: 0xa2, hi: 0xa5}, + {value: 0x1008, lo: 0xa6, hi: 0xa7}, + {value: 0x1308, lo: 0xa8, hi: 0xa9}, + {value: 0x1808, lo: 0xaa, hi: 0xaa}, + {value: 0x1b08, lo: 0xab, hi: 0xab}, + {value: 0x1308, lo: 0xac, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xbf}, + // Block 0x41, offset 0x25d + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x1308, lo: 0xa6, hi: 0xa6}, + {value: 0x1008, lo: 0xa7, hi: 0xa7}, + {value: 0x1308, lo: 0xa8, hi: 0xa9}, + {value: 0x1008, lo: 0xaa, hi: 0xac}, + {value: 0x1308, lo: 0xad, hi: 0xad}, + {value: 0x1008, lo: 0xae, hi: 0xae}, + {value: 0x1308, lo: 0xaf, hi: 0xb1}, + {value: 0x1808, lo: 0xb2, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbb}, + {value: 0x0018, lo: 0xbc, hi: 0xbf}, + // Block 0x42, offset 0x269 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xa3}, + {value: 0x1008, lo: 0xa4, hi: 0xab}, + {value: 0x1308, lo: 0xac, hi: 0xb3}, + {value: 0x1008, lo: 0xb4, hi: 0xb5}, + {value: 0x1308, lo: 0xb6, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbf}, + // Block 0x43, offset 0x271 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0x8c}, + {value: 0x0008, lo: 0x8d, hi: 0xbd}, + {value: 0x0018, lo: 0xbe, hi: 0xbf}, + // Block 0x44, offset 0x276 + {value: 0x0000, lo: 0x09}, + {value: 0x0e29, lo: 0x80, hi: 0x80}, + {value: 0x0e41, lo: 0x81, hi: 0x81}, + {value: 0x0e59, lo: 0x82, hi: 0x82}, + {value: 0x0e71, lo: 0x83, hi: 0x83}, + {value: 0x0e89, lo: 0x84, hi: 0x85}, + {value: 0x0ea1, lo: 0x86, hi: 0x86}, + {value: 0x0eb9, lo: 0x87, hi: 0x87}, + {value: 0x057d, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0xbf}, + // Block 0x45, offset 0x280 + {value: 0x0000, lo: 0x10}, + {value: 0x0018, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x1308, lo: 0x90, hi: 0x92}, + {value: 0x0018, lo: 0x93, hi: 0x93}, + {value: 0x1308, lo: 0x94, hi: 0xa0}, + {value: 0x1008, lo: 0xa1, hi: 0xa1}, + {value: 0x1308, lo: 0xa2, hi: 0xa8}, + {value: 0x0008, lo: 0xa9, hi: 0xac}, + {value: 0x1308, lo: 0xad, hi: 0xad}, + {value: 0x0008, lo: 0xae, hi: 0xb1}, + {value: 0x1008, lo: 0xb2, hi: 0xb3}, + {value: 0x1308, lo: 0xb4, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xb7}, + {value: 0x1308, lo: 0xb8, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x46, offset 0x291 + {value: 0x0000, lo: 0x03}, + {value: 0x1308, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xba}, + {value: 0x1308, lo: 0xbb, hi: 0xbf}, + // Block 0x47, offset 0x295 + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x87}, + {value: 0xe045, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x97}, + {value: 0xe045, lo: 0x98, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa7}, + {value: 0xe045, lo: 0xa8, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb7}, + {value: 0xe045, lo: 0xb8, hi: 0xbf}, + // Block 0x48, offset 0x2a0 + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x1318, lo: 0x90, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xbf}, + // Block 0x49, offset 0x2a4 + {value: 0x0000, lo: 0x08}, + {value: 0x0018, lo: 0x80, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x88}, + {value: 0x24c1, lo: 0x89, hi: 0x89}, + {value: 0x0018, lo: 0x8a, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbf}, + // Block 0x4a, offset 0x2ad + {value: 0x0000, lo: 0x07}, + {value: 0x0018, lo: 0x80, hi: 0xab}, + {value: 0x24f1, lo: 0xac, hi: 0xac}, + {value: 0x2529, lo: 0xad, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xae}, + {value: 0x2579, lo: 0xaf, hi: 0xaf}, + {value: 0x25b1, lo: 0xb0, hi: 0xb0}, + {value: 0x0018, lo: 0xb1, hi: 0xbf}, + // Block 0x4b, offset 0x2b5 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x9f}, + {value: 0x0080, lo: 0xa0, hi: 0xa0}, + {value: 0x0018, lo: 0xa1, hi: 0xad}, + {value: 0x0080, lo: 0xae, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0x4c, offset 0x2bb + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0xa8}, + {value: 0x09c5, lo: 0xa9, hi: 0xa9}, + {value: 0x09e5, lo: 0xaa, hi: 0xaa}, + {value: 0x0018, lo: 0xab, hi: 0xbf}, + // Block 0x4d, offset 0x2c0 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x4e, offset 0x2c3 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xbf}, + // Block 0x4f, offset 0x2c6 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x8b}, + {value: 0x28c1, lo: 0x8c, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0xbf}, + // Block 0x50, offset 0x2ca + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0xb3}, + {value: 0x0e66, lo: 0xb4, hi: 0xb4}, + {value: 0x292a, lo: 0xb5, hi: 0xb5}, + {value: 0x0e86, lo: 0xb6, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xbf}, + // Block 0x51, offset 0x2d0 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x9b}, + {value: 0x2941, lo: 0x9c, hi: 0x9c}, + {value: 0x0018, lo: 0x9d, hi: 0xbf}, + // Block 0x52, offset 0x2d4 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xbf}, + // Block 0x53, offset 0x2d8 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x97}, + {value: 0x0018, lo: 0x98, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbc}, + {value: 0x0018, lo: 0xbd, hi: 0xbf}, + // Block 0x54, offset 0x2de + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0018, lo: 0x8a, hi: 0x91}, + {value: 0x0040, lo: 0x92, hi: 0xab}, + {value: 0x0018, lo: 0xac, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, + // Block 0x55, offset 0x2e5 + {value: 0x0000, lo: 0x05}, + {value: 0xe185, lo: 0x80, hi: 0x8f}, + {value: 0x03f5, lo: 0x90, hi: 0x9f}, + {value: 0x0ea5, lo: 0xa0, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x56, offset 0x2eb + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x0040, lo: 0xa6, hi: 0xa6}, + {value: 0x0008, lo: 0xa7, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xac}, + {value: 0x0008, lo: 0xad, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x57, offset 0x2f3 + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xae}, + {value: 0xe075, lo: 0xaf, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xbe}, + {value: 0x1b08, lo: 0xbf, hi: 0xbf}, + // Block 0x58, offset 0x2fa + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xb7}, + {value: 0x0008, lo: 0xb8, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x59, offset 0x305 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x1308, lo: 0xa0, hi: 0xbf}, + // Block 0x5a, offset 0x30f + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xae}, + {value: 0x0008, lo: 0xaf, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0x5b, offset 0x313 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x84}, + {value: 0x0040, lo: 0x85, hi: 0xbf}, + // Block 0x5c, offset 0x316 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9e}, + {value: 0x0edd, lo: 0x9f, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xbf}, + // Block 0x5d, offset 0x31c + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xb2}, + {value: 0x0efd, lo: 0xb3, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbf}, + // Block 0x5e, offset 0x320 + {value: 0x0020, lo: 0x01}, + {value: 0x0f1d, lo: 0x80, hi: 0xbf}, + // Block 0x5f, offset 0x322 + {value: 0x0020, lo: 0x02}, + {value: 0x171d, lo: 0x80, hi: 0x8f}, + {value: 0x18fd, lo: 0x90, hi: 0xbf}, + // Block 0x60, offset 0x325 + {value: 0x0020, lo: 0x01}, + {value: 0x1efd, lo: 0x80, hi: 0xbf}, + // Block 0x61, offset 0x327 + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0xbf}, + // Block 0x62, offset 0x32a + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x98}, + {value: 0x1308, lo: 0x99, hi: 0x9a}, + {value: 0x29e2, lo: 0x9b, hi: 0x9b}, + {value: 0x2a0a, lo: 0x9c, hi: 0x9c}, + {value: 0x0008, lo: 0x9d, hi: 0x9e}, + {value: 0x2a31, lo: 0x9f, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa0}, + {value: 0x0008, lo: 0xa1, hi: 0xbf}, + // Block 0x63, offset 0x334 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xbe}, + {value: 0x2a69, lo: 0xbf, hi: 0xbf}, + // Block 0x64, offset 0x337 + {value: 0x0000, lo: 0x0e}, + {value: 0x0040, lo: 0x80, hi: 0x84}, + {value: 0x0008, lo: 0x85, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xb0}, + {value: 0x2a1d, lo: 0xb1, hi: 0xb1}, + {value: 0x2a3d, lo: 0xb2, hi: 0xb2}, + {value: 0x2a5d, lo: 0xb3, hi: 0xb3}, + {value: 0x2a7d, lo: 0xb4, hi: 0xb4}, + {value: 0x2a5d, lo: 0xb5, hi: 0xb5}, + {value: 0x2a9d, lo: 0xb6, hi: 0xb6}, + {value: 0x2abd, lo: 0xb7, hi: 0xb7}, + {value: 0x2add, lo: 0xb8, hi: 0xb9}, + {value: 0x2afd, lo: 0xba, hi: 0xbb}, + {value: 0x2b1d, lo: 0xbc, hi: 0xbd}, + {value: 0x2afd, lo: 0xbe, hi: 0xbf}, + // Block 0x65, offset 0x346 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x66, offset 0x34a + {value: 0x0030, lo: 0x04}, + {value: 0x2aa2, lo: 0x80, hi: 0x9d}, + {value: 0x305a, lo: 0x9e, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x30a2, lo: 0xa0, hi: 0xbf}, + // Block 0x67, offset 0x34f + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0xbf}, + // Block 0x68, offset 0x352 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x8c}, + {value: 0x0040, lo: 0x8d, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbf}, + // Block 0x69, offset 0x356 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xbd}, + {value: 0x0018, lo: 0xbe, hi: 0xbf}, + // Block 0x6a, offset 0x35b + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xbf}, + // Block 0x6b, offset 0x360 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x0018, lo: 0xa6, hi: 0xaf}, + {value: 0x1308, lo: 0xb0, hi: 0xb1}, + {value: 0x0018, lo: 0xb2, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbf}, + // Block 0x6c, offset 0x366 + {value: 0x0000, lo: 0x05}, + {value: 0x0040, lo: 0x80, hi: 0xb6}, + {value: 0x0008, lo: 0xb7, hi: 0xb7}, + {value: 0x2009, lo: 0xb8, hi: 0xb8}, + {value: 0x6e89, lo: 0xb9, hi: 0xb9}, + {value: 0x0008, lo: 0xba, hi: 0xbf}, + // Block 0x6d, offset 0x36c + {value: 0x0000, lo: 0x0e}, + {value: 0x0008, lo: 0x80, hi: 0x81}, + {value: 0x1308, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0x85}, + {value: 0x1b08, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x8a}, + {value: 0x1308, lo: 0x8b, hi: 0x8b}, + {value: 0x0008, lo: 0x8c, hi: 0xa2}, + {value: 0x1008, lo: 0xa3, hi: 0xa4}, + {value: 0x1308, lo: 0xa5, hi: 0xa6}, + {value: 0x1008, lo: 0xa7, hi: 0xa7}, + {value: 0x0018, lo: 0xa8, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x6e, offset 0x37b + {value: 0x0000, lo: 0x05}, + {value: 0x0208, lo: 0x80, hi: 0xb1}, + {value: 0x0108, lo: 0xb2, hi: 0xb2}, + {value: 0x0008, lo: 0xb3, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbf}, + // Block 0x6f, offset 0x381 + {value: 0x0000, lo: 0x03}, + {value: 0x1008, lo: 0x80, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0xb3}, + {value: 0x1008, lo: 0xb4, hi: 0xbf}, + // Block 0x70, offset 0x385 + {value: 0x0000, lo: 0x0e}, + {value: 0x1008, lo: 0x80, hi: 0x83}, + {value: 0x1b08, lo: 0x84, hi: 0x84}, + {value: 0x1308, lo: 0x85, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x8d}, + {value: 0x0018, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x1308, lo: 0xa0, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb7}, + {value: 0x0018, lo: 0xb8, hi: 0xba}, + {value: 0x0008, lo: 0xbb, hi: 0xbb}, + {value: 0x0018, lo: 0xbc, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x71, offset 0x394 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xa5}, + {value: 0x1308, lo: 0xa6, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x72, offset 0x399 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x1308, lo: 0x87, hi: 0x91}, + {value: 0x1008, lo: 0x92, hi: 0x92}, + {value: 0x1808, lo: 0x93, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0x73, offset 0x3a1 + {value: 0x0000, lo: 0x09}, + {value: 0x1308, lo: 0x80, hi: 0x82}, + {value: 0x1008, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0xb2}, + {value: 0x1308, lo: 0xb3, hi: 0xb3}, + {value: 0x1008, lo: 0xb4, hi: 0xb5}, + {value: 0x1308, lo: 0xb6, hi: 0xb9}, + {value: 0x1008, lo: 0xba, hi: 0xbb}, + {value: 0x1308, lo: 0xbc, hi: 0xbc}, + {value: 0x1008, lo: 0xbd, hi: 0xbf}, + // Block 0x74, offset 0x3ab + {value: 0x0000, lo: 0x0a}, + {value: 0x1808, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8e}, + {value: 0x0008, lo: 0x8f, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa4}, + {value: 0x1308, lo: 0xa5, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0x75, offset 0x3b6 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xa8}, + {value: 0x1308, lo: 0xa9, hi: 0xae}, + {value: 0x1008, lo: 0xaf, hi: 0xb0}, + {value: 0x1308, lo: 0xb1, hi: 0xb2}, + {value: 0x1008, lo: 0xb3, hi: 0xb4}, + {value: 0x1308, lo: 0xb5, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x76, offset 0x3be + {value: 0x0000, lo: 0x10}, + {value: 0x0008, lo: 0x80, hi: 0x82}, + {value: 0x1308, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x8b}, + {value: 0x1308, lo: 0x8c, hi: 0x8c}, + {value: 0x1008, lo: 0x8d, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9b}, + {value: 0x0018, lo: 0x9c, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xb9}, + {value: 0x0008, lo: 0xba, hi: 0xba}, + {value: 0x1008, lo: 0xbb, hi: 0xbb}, + {value: 0x1308, lo: 0xbc, hi: 0xbc}, + {value: 0x1008, lo: 0xbd, hi: 0xbd}, + {value: 0x0008, lo: 0xbe, hi: 0xbf}, + // Block 0x77, offset 0x3cf + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x1308, lo: 0xb0, hi: 0xb0}, + {value: 0x0008, lo: 0xb1, hi: 0xb1}, + {value: 0x1308, lo: 0xb2, hi: 0xb4}, + {value: 0x0008, lo: 0xb5, hi: 0xb6}, + {value: 0x1308, lo: 0xb7, hi: 0xb8}, + {value: 0x0008, lo: 0xb9, hi: 0xbd}, + {value: 0x1308, lo: 0xbe, hi: 0xbf}, + // Block 0x78, offset 0x3d8 + {value: 0x0000, lo: 0x0f}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x1308, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x9a}, + {value: 0x0008, lo: 0x9b, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xaa}, + {value: 0x1008, lo: 0xab, hi: 0xab}, + {value: 0x1308, lo: 0xac, hi: 0xad}, + {value: 0x1008, lo: 0xae, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xb4}, + {value: 0x1008, lo: 0xb5, hi: 0xb5}, + {value: 0x1b08, lo: 0xb6, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x79, offset 0x3e8 + {value: 0x0000, lo: 0x0c}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x88}, + {value: 0x0008, lo: 0x89, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x90}, + {value: 0x0008, lo: 0x91, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x7a, offset 0x3f5 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9b}, + {value: 0x4465, lo: 0x9c, hi: 0x9c}, + {value: 0x447d, lo: 0x9d, hi: 0x9d}, + {value: 0x2971, lo: 0x9e, hi: 0x9e}, + {value: 0xe06d, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa5}, + {value: 0x0040, lo: 0xa6, hi: 0xaf}, + {value: 0x4495, lo: 0xb0, hi: 0xbf}, + // Block 0x7b, offset 0x3ff + {value: 0x0000, lo: 0x04}, + {value: 0x44b5, lo: 0x80, hi: 0x8f}, + {value: 0x44d5, lo: 0x90, hi: 0x9f}, + {value: 0x44f5, lo: 0xa0, hi: 0xaf}, + {value: 0x44d5, lo: 0xb0, hi: 0xbf}, + // Block 0x7c, offset 0x404 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0xa2}, + {value: 0x1008, lo: 0xa3, hi: 0xa4}, + {value: 0x1308, lo: 0xa5, hi: 0xa5}, + {value: 0x1008, lo: 0xa6, hi: 0xa7}, + {value: 0x1308, lo: 0xa8, hi: 0xa8}, + {value: 0x1008, lo: 0xa9, hi: 0xaa}, + {value: 0x0018, lo: 0xab, hi: 0xab}, + {value: 0x1008, lo: 0xac, hi: 0xac}, + {value: 0x1b08, lo: 0xad, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0x7d, offset 0x411 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0x7e, offset 0x415 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8a}, + {value: 0x0018, lo: 0x8b, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x7f, offset 0x41a + {value: 0x0020, lo: 0x01}, + {value: 0x4515, lo: 0x80, hi: 0xbf}, + // Block 0x80, offset 0x41c + {value: 0x0020, lo: 0x03}, + {value: 0x4d15, lo: 0x80, hi: 0x94}, + {value: 0x4ad5, lo: 0x95, hi: 0x95}, + {value: 0x4fb5, lo: 0x96, hi: 0xbf}, + // Block 0x81, offset 0x420 + {value: 0x0020, lo: 0x01}, + {value: 0x54f5, lo: 0x80, hi: 0xbf}, + // Block 0x82, offset 0x422 + {value: 0x0020, lo: 0x03}, + {value: 0x5cf5, lo: 0x80, hi: 0x84}, + {value: 0x5655, lo: 0x85, hi: 0x85}, + {value: 0x5d95, lo: 0x86, hi: 0xbf}, + // Block 0x83, offset 0x426 + {value: 0x0020, lo: 0x08}, + {value: 0x6b55, lo: 0x80, hi: 0x8f}, + {value: 0x6d15, lo: 0x90, hi: 0x90}, + {value: 0x6d55, lo: 0x91, hi: 0xab}, + {value: 0x6ea1, lo: 0xac, hi: 0xac}, + {value: 0x70b5, lo: 0xad, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x70d5, lo: 0xb0, hi: 0xbf}, + // Block 0x84, offset 0x42f + {value: 0x0020, lo: 0x05}, + {value: 0x72d5, lo: 0x80, hi: 0xad}, + {value: 0x6535, lo: 0xae, hi: 0xae}, + {value: 0x7895, lo: 0xaf, hi: 0xb5}, + {value: 0x6f55, lo: 0xb6, hi: 0xb6}, + {value: 0x7975, lo: 0xb7, hi: 0xbf}, + // Block 0x85, offset 0x435 + {value: 0x0028, lo: 0x03}, + {value: 0x7c21, lo: 0x80, hi: 0x82}, + {value: 0x7be1, lo: 0x83, hi: 0x83}, + {value: 0x7c99, lo: 0x84, hi: 0xbf}, + // Block 0x86, offset 0x439 + {value: 0x0038, lo: 0x0f}, + {value: 0x9db1, lo: 0x80, hi: 0x83}, + {value: 0x9e59, lo: 0x84, hi: 0x85}, + {value: 0x9e91, lo: 0x86, hi: 0x87}, + {value: 0x9ec9, lo: 0x88, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x91}, + {value: 0xa089, lo: 0x92, hi: 0x97}, + {value: 0xa1a1, lo: 0x98, hi: 0x9c}, + {value: 0xa281, lo: 0x9d, hi: 0xb3}, + {value: 0x9d41, lo: 0xb4, hi: 0xb4}, + {value: 0x9db1, lo: 0xb5, hi: 0xb5}, + {value: 0xa789, lo: 0xb6, hi: 0xbb}, + {value: 0xa869, lo: 0xbc, hi: 0xbc}, + {value: 0xa7f9, lo: 0xbd, hi: 0xbd}, + {value: 0xa8d9, lo: 0xbe, hi: 0xbf}, + // Block 0x87, offset 0x449 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8c}, + {value: 0x0008, lo: 0x8d, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbb}, + {value: 0x0008, lo: 0xbc, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0x88, offset 0x453 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0xbf}, + // Block 0x89, offset 0x458 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0x8a, offset 0x45b + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x82}, + {value: 0x0040, lo: 0x83, hi: 0x86}, + {value: 0x0018, lo: 0x87, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xbf}, + // Block 0x8b, offset 0x461 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x8e}, + {value: 0x0040, lo: 0x8f, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa0}, + {value: 0x0040, lo: 0xa1, hi: 0xbf}, + // Block 0x8c, offset 0x468 + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbc}, + {value: 0x1308, lo: 0xbd, hi: 0xbd}, + {value: 0x0040, lo: 0xbe, hi: 0xbf}, + // Block 0x8d, offset 0x46d + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x9c}, + {value: 0x0040, lo: 0x9d, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x8e, offset 0x471 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x90}, + {value: 0x0040, lo: 0x91, hi: 0x9f}, + {value: 0x1308, lo: 0xa0, hi: 0xa0}, + {value: 0x0018, lo: 0xa1, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x8f, offset 0x477 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x90, offset 0x47c + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x81}, + {value: 0x0008, lo: 0x82, hi: 0x89}, + {value: 0x0018, lo: 0x8a, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xb5}, + {value: 0x1308, lo: 0xb6, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbf}, + // Block 0x91, offset 0x485 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0x92, offset 0x48a + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0xbf}, + // Block 0x93, offset 0x490 + {value: 0x0000, lo: 0x06}, + {value: 0xe145, lo: 0x80, hi: 0x87}, + {value: 0xe1c5, lo: 0x88, hi: 0x8f}, + {value: 0xe145, lo: 0x90, hi: 0x97}, + {value: 0x8ad5, lo: 0x98, hi: 0x9f}, + {value: 0x8aed, lo: 0xa0, hi: 0xa7}, + {value: 0x0008, lo: 0xa8, hi: 0xbf}, + // Block 0x94, offset 0x497 + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xaf}, + {value: 0x8aed, lo: 0xb0, hi: 0xb7}, + {value: 0x8ad5, lo: 0xb8, hi: 0xbf}, + // Block 0x95, offset 0x49e + {value: 0x0000, lo: 0x06}, + {value: 0xe145, lo: 0x80, hi: 0x87}, + {value: 0xe1c5, lo: 0x88, hi: 0x8f}, + {value: 0xe145, lo: 0x90, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0xbb}, + {value: 0x0040, lo: 0xbc, hi: 0xbf}, + // Block 0x96, offset 0x4a5 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0x97, offset 0x4a9 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xae}, + {value: 0x0018, lo: 0xaf, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, + // Block 0x98, offset 0x4ae + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0x99, offset 0x4b1 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xbf}, + // Block 0x9a, offset 0x4b6 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb6}, + {value: 0x0008, lo: 0xb7, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbb}, + {value: 0x0008, lo: 0xbc, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0x9b, offset 0x4c2 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x96}, + {value: 0x0018, lo: 0x97, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xbf}, + // Block 0x9c, offset 0x4c8 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0xa6}, + {value: 0x0018, lo: 0xa7, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, + // Block 0x9d, offset 0x4cd + {value: 0x0000, lo: 0x06}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xb3}, + {value: 0x0008, lo: 0xb4, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbf}, + // Block 0x9e, offset 0x4d4 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0x95}, + {value: 0x0018, lo: 0x96, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbe}, + {value: 0x0018, lo: 0xbf, hi: 0xbf}, + // Block 0x9f, offset 0x4dc + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbb}, + {value: 0x0018, lo: 0xbc, hi: 0xbd}, + {value: 0x0008, lo: 0xbe, hi: 0xbf}, + // Block 0xa0, offset 0x4e1 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x91}, + {value: 0x0018, lo: 0x92, hi: 0xbf}, + // Block 0xa1, offset 0x4e5 + {value: 0x0000, lo: 0x0f}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x1308, lo: 0x81, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x84}, + {value: 0x1308, lo: 0x85, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x8b}, + {value: 0x1308, lo: 0x8c, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x94}, + {value: 0x0008, lo: 0x95, hi: 0x97}, + {value: 0x0040, lo: 0x98, hi: 0x98}, + {value: 0x0008, lo: 0x99, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xb7}, + {value: 0x1308, lo: 0xb8, hi: 0xba}, + {value: 0x0040, lo: 0xbb, hi: 0xbe}, + {value: 0x1b08, lo: 0xbf, hi: 0xbf}, + // Block 0xa2, offset 0x4f5 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x98}, + {value: 0x0040, lo: 0x99, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbc}, + {value: 0x0018, lo: 0xbd, hi: 0xbf}, + // Block 0xa3, offset 0x4fc + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x9c}, + {value: 0x0018, lo: 0x9d, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0xa4, offset 0x500 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb8}, + {value: 0x0018, lo: 0xb9, hi: 0xbf}, + // Block 0xa5, offset 0x504 + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x95}, + {value: 0x0040, lo: 0x96, hi: 0x97}, + {value: 0x0018, lo: 0x98, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xb7}, + {value: 0x0018, lo: 0xb8, hi: 0xbf}, + // Block 0xa6, offset 0x50b + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0xbf}, + // Block 0xa7, offset 0x50e + {value: 0x0000, lo: 0x02}, + {value: 0x03dd, lo: 0x80, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xbf}, + // Block 0xa8, offset 0x511 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xb9}, + {value: 0x0018, lo: 0xba, hi: 0xbf}, + // Block 0xa9, offset 0x515 + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xaa, offset 0x519 + {value: 0x0000, lo: 0x05}, + {value: 0x1008, lo: 0x80, hi: 0x80}, + {value: 0x1308, lo: 0x81, hi: 0x81}, + {value: 0x1008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xb7}, + {value: 0x1308, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x51f + {value: 0x0000, lo: 0x08}, + {value: 0x1308, lo: 0x80, hi: 0x85}, + {value: 0x1b08, lo: 0x86, hi: 0x86}, + {value: 0x0018, lo: 0x87, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x91}, + {value: 0x0018, lo: 0x92, hi: 0xa5}, + {value: 0x0008, lo: 0xa6, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbe}, + {value: 0x1b08, lo: 0xbf, hi: 0xbf}, + // Block 0xac, offset 0x528 + {value: 0x0000, lo: 0x0b}, + {value: 0x1308, lo: 0x80, hi: 0x81}, + {value: 0x1008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xaf}, + {value: 0x1008, lo: 0xb0, hi: 0xb2}, + {value: 0x1308, lo: 0xb3, hi: 0xb6}, + {value: 0x1008, lo: 0xb7, hi: 0xb8}, + {value: 0x1b08, lo: 0xb9, hi: 0xb9}, + {value: 0x1308, lo: 0xba, hi: 0xba}, + {value: 0x0018, lo: 0xbb, hi: 0xbc}, + {value: 0x0340, lo: 0xbd, hi: 0xbd}, + {value: 0x0018, lo: 0xbe, hi: 0xbf}, + // Block 0xad, offset 0x534 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x81}, + {value: 0x0040, lo: 0x82, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xa8}, + {value: 0x0040, lo: 0xa9, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0xae, offset 0x53b + {value: 0x0000, lo: 0x08}, + {value: 0x1308, lo: 0x80, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xa6}, + {value: 0x1308, lo: 0xa7, hi: 0xab}, + {value: 0x1008, lo: 0xac, hi: 0xac}, + {value: 0x1308, lo: 0xad, hi: 0xb2}, + {value: 0x1b08, lo: 0xb3, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xb5}, + {value: 0x0008, lo: 0xb6, hi: 0xbf}, + // Block 0xaf, offset 0x544 + {value: 0x0000, lo: 0x07}, + {value: 0x0018, lo: 0x80, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xb2}, + {value: 0x1308, lo: 0xb3, hi: 0xb3}, + {value: 0x0018, lo: 0xb4, hi: 0xb5}, + {value: 0x0008, lo: 0xb6, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0xb0, offset 0x54c + {value: 0x0000, lo: 0x06}, + {value: 0x1308, lo: 0x80, hi: 0x81}, + {value: 0x1008, lo: 0x82, hi: 0x82}, + {value: 0x0008, lo: 0x83, hi: 0xb2}, + {value: 0x1008, lo: 0xb3, hi: 0xb5}, + {value: 0x1308, lo: 0xb6, hi: 0xbe}, + {value: 0x1008, lo: 0xbf, hi: 0xbf}, + // Block 0xb1, offset 0x553 + {value: 0x0000, lo: 0x0d}, + {value: 0x1808, lo: 0x80, hi: 0x80}, + {value: 0x0008, lo: 0x81, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x89}, + {value: 0x1308, lo: 0x8a, hi: 0x8c}, + {value: 0x0018, lo: 0x8d, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9b}, + {value: 0x0008, lo: 0x9c, hi: 0x9c}, + {value: 0x0018, lo: 0x9d, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xa0}, + {value: 0x0018, lo: 0xa1, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0xb2, offset 0x561 + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x91}, + {value: 0x0040, lo: 0x92, hi: 0x92}, + {value: 0x0008, lo: 0x93, hi: 0xab}, + {value: 0x1008, lo: 0xac, hi: 0xae}, + {value: 0x1308, lo: 0xaf, hi: 0xb1}, + {value: 0x1008, lo: 0xb2, hi: 0xb3}, + {value: 0x1308, lo: 0xb4, hi: 0xb4}, + {value: 0x1808, lo: 0xb5, hi: 0xb5}, + {value: 0x1308, lo: 0xb6, hi: 0xb7}, + {value: 0x0018, lo: 0xb8, hi: 0xbd}, + {value: 0x1308, lo: 0xbe, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xb3, offset 0x56e + {value: 0x0000, lo: 0x0c}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x0008, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0x8d}, + {value: 0x0040, lo: 0x8e, hi: 0x8e}, + {value: 0x0008, lo: 0x8f, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9e}, + {value: 0x0008, lo: 0x9f, hi: 0xa8}, + {value: 0x0018, lo: 0xa9, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbf}, + // Block 0xb4, offset 0x57b + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x1308, lo: 0x9f, hi: 0x9f}, + {value: 0x1008, lo: 0xa0, hi: 0xa2}, + {value: 0x1308, lo: 0xa3, hi: 0xa9}, + {value: 0x1b08, lo: 0xaa, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0040, lo: 0xba, hi: 0xbf}, + // Block 0xb5, offset 0x584 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xb4}, + {value: 0x1008, lo: 0xb5, hi: 0xb7}, + {value: 0x1308, lo: 0xb8, hi: 0xbf}, + // Block 0xb6, offset 0x588 + {value: 0x0000, lo: 0x0d}, + {value: 0x1008, lo: 0x80, hi: 0x81}, + {value: 0x1b08, lo: 0x82, hi: 0x82}, + {value: 0x1308, lo: 0x83, hi: 0x84}, + {value: 0x1008, lo: 0x85, hi: 0x85}, + {value: 0x1308, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x8a}, + {value: 0x0018, lo: 0x8b, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0x9b}, + {value: 0x0040, lo: 0x9c, hi: 0x9c}, + {value: 0x0018, lo: 0x9d, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0xbf}, + // Block 0xb7, offset 0x596 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x1008, lo: 0xb0, hi: 0xb2}, + {value: 0x1308, lo: 0xb3, hi: 0xb8}, + {value: 0x1008, lo: 0xb9, hi: 0xb9}, + {value: 0x1308, lo: 0xba, hi: 0xba}, + {value: 0x1008, lo: 0xbb, hi: 0xbe}, + {value: 0x1308, lo: 0xbf, hi: 0xbf}, + // Block 0xb8, offset 0x59e + {value: 0x0000, lo: 0x0a}, + {value: 0x1308, lo: 0x80, hi: 0x80}, + {value: 0x1008, lo: 0x81, hi: 0x81}, + {value: 0x1b08, lo: 0x82, hi: 0x82}, + {value: 0x1308, lo: 0x83, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x85}, + {value: 0x0018, lo: 0x86, hi: 0x86}, + {value: 0x0008, lo: 0x87, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0xbf}, + // Block 0xb9, offset 0x5a9 + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0xae}, + {value: 0x1008, lo: 0xaf, hi: 0xb1}, + {value: 0x1308, lo: 0xb2, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xb7}, + {value: 0x1008, lo: 0xb8, hi: 0xbb}, + {value: 0x1308, lo: 0xbc, hi: 0xbd}, + {value: 0x1008, lo: 0xbe, hi: 0xbe}, + {value: 0x1b08, lo: 0xbf, hi: 0xbf}, + // Block 0xba, offset 0x5b2 + {value: 0x0000, lo: 0x05}, + {value: 0x1308, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x97}, + {value: 0x0008, lo: 0x98, hi: 0x9b}, + {value: 0x1308, lo: 0x9c, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0xbf}, + // Block 0xbb, offset 0x5b8 + {value: 0x0000, lo: 0x07}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x1008, lo: 0xb0, hi: 0xb2}, + {value: 0x1308, lo: 0xb3, hi: 0xba}, + {value: 0x1008, lo: 0xbb, hi: 0xbc}, + {value: 0x1308, lo: 0xbd, hi: 0xbd}, + {value: 0x1008, lo: 0xbe, hi: 0xbe}, + {value: 0x1b08, lo: 0xbf, hi: 0xbf}, + // Block 0xbc, offset 0x5c0 + {value: 0x0000, lo: 0x08}, + {value: 0x1308, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x83}, + {value: 0x0008, lo: 0x84, hi: 0x84}, + {value: 0x0040, lo: 0x85, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xbf}, + // Block 0xbd, offset 0x5c9 + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x1308, lo: 0xab, hi: 0xab}, + {value: 0x1008, lo: 0xac, hi: 0xac}, + {value: 0x1308, lo: 0xad, hi: 0xad}, + {value: 0x1008, lo: 0xae, hi: 0xaf}, + {value: 0x1308, lo: 0xb0, hi: 0xb5}, + {value: 0x1808, lo: 0xb6, hi: 0xb6}, + {value: 0x1308, lo: 0xb7, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbf}, + // Block 0xbe, offset 0x5d3 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x89}, + {value: 0x0040, lo: 0x8a, hi: 0xbf}, + // Block 0xbf, offset 0x5d6 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9c}, + {value: 0x1308, lo: 0x9d, hi: 0x9f}, + {value: 0x1008, lo: 0xa0, hi: 0xa1}, + {value: 0x1308, lo: 0xa2, hi: 0xa5}, + {value: 0x1008, lo: 0xa6, hi: 0xa6}, + {value: 0x1308, lo: 0xa7, hi: 0xaa}, + {value: 0x1b08, lo: 0xab, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xb9}, + {value: 0x0018, lo: 0xba, hi: 0xbf}, + // Block 0xc0, offset 0x5e2 + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x049d, lo: 0xa0, hi: 0xbf}, + // Block 0xc1, offset 0x5e5 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xbe}, + {value: 0x0008, lo: 0xbf, hi: 0xbf}, + // Block 0xc2, offset 0x5ea + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb8}, + {value: 0x0040, lo: 0xb9, hi: 0xbf}, + // Block 0xc3, offset 0x5ed + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x89}, + {value: 0x0008, lo: 0x8a, hi: 0xae}, + {value: 0x1008, lo: 0xaf, hi: 0xaf}, + {value: 0x1308, lo: 0xb0, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xb7}, + {value: 0x1308, lo: 0xb8, hi: 0xbd}, + {value: 0x1008, lo: 0xbe, hi: 0xbe}, + {value: 0x1b08, lo: 0xbf, hi: 0xbf}, + // Block 0xc4, offset 0x5f7 + {value: 0x0000, lo: 0x08}, + {value: 0x0008, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0018, lo: 0x9a, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb1}, + {value: 0x0008, lo: 0xb2, hi: 0xbf}, + // Block 0xc5, offset 0x600 + {value: 0x0000, lo: 0x0b}, + {value: 0x0008, lo: 0x80, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x91}, + {value: 0x1308, lo: 0x92, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xa8}, + {value: 0x1008, lo: 0xa9, hi: 0xa9}, + {value: 0x1308, lo: 0xaa, hi: 0xb0}, + {value: 0x1008, lo: 0xb1, hi: 0xb1}, + {value: 0x1308, lo: 0xb2, hi: 0xb3}, + {value: 0x1008, lo: 0xb4, hi: 0xb4}, + {value: 0x1308, lo: 0xb5, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0xc6, offset 0x60c + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0xbf}, + // Block 0xc7, offset 0x60f + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0xc8, offset 0x614 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x83}, + {value: 0x0040, lo: 0x84, hi: 0xbf}, + // Block 0xc9, offset 0x617 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xbf}, + // Block 0xca, offset 0x61a + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0xbf}, + // Block 0xcb, offset 0x61d + {value: 0x0000, lo: 0x06}, + {value: 0x0008, lo: 0x80, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa9}, + {value: 0x0040, lo: 0xaa, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, + // Block 0xcc, offset 0x624 + {value: 0x0000, lo: 0x06}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xaf}, + {value: 0x1308, lo: 0xb0, hi: 0xb4}, + {value: 0x0018, lo: 0xb5, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0xcd, offset 0x62b + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0xaf}, + {value: 0x1308, lo: 0xb0, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xbf}, + // Block 0xce, offset 0x62f + {value: 0x0000, lo: 0x0a}, + {value: 0x0008, lo: 0x80, hi: 0x83}, + {value: 0x0018, lo: 0x84, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9a}, + {value: 0x0018, lo: 0x9b, hi: 0xa1}, + {value: 0x0040, lo: 0xa2, hi: 0xa2}, + {value: 0x0008, lo: 0xa3, hi: 0xb7}, + {value: 0x0040, lo: 0xb8, hi: 0xbc}, + {value: 0x0008, lo: 0xbd, hi: 0xbf}, + // Block 0xcf, offset 0x63a + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0xbf}, + // Block 0xd0, offset 0x63d + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x84}, + {value: 0x0040, lo: 0x85, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x90}, + {value: 0x1008, lo: 0x91, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xd1, offset 0x643 + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x8e}, + {value: 0x1308, lo: 0x8f, hi: 0x92}, + {value: 0x0008, lo: 0x93, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0xd2, offset 0x648 + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xa0}, + {value: 0x0040, lo: 0xa1, hi: 0xbf}, + // Block 0xd3, offset 0x64c + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xbf}, + // Block 0xd4, offset 0x64f + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb2}, + {value: 0x0040, lo: 0xb3, hi: 0xbf}, + // Block 0xd5, offset 0x652 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x81}, + {value: 0x0040, lo: 0x82, hi: 0xbf}, + // Block 0xd6, offset 0x655 + {value: 0x0000, lo: 0x04}, + {value: 0x0008, lo: 0x80, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xaf}, + {value: 0x0008, lo: 0xb0, hi: 0xbc}, + {value: 0x0040, lo: 0xbd, hi: 0xbf}, + // Block 0xd7, offset 0x65a + {value: 0x0000, lo: 0x09}, + {value: 0x0008, lo: 0x80, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9b}, + {value: 0x0018, lo: 0x9c, hi: 0x9c}, + {value: 0x1308, lo: 0x9d, hi: 0x9e}, + {value: 0x0018, lo: 0x9f, hi: 0x9f}, + {value: 0x03c0, lo: 0xa0, hi: 0xa3}, + {value: 0x0040, lo: 0xa4, hi: 0xbf}, + // Block 0xd8, offset 0x664 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0xd9, offset 0x667 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xa6}, + {value: 0x0040, lo: 0xa7, hi: 0xa8}, + {value: 0x0018, lo: 0xa9, hi: 0xbf}, + // Block 0xda, offset 0x66b + {value: 0x0000, lo: 0x0e}, + {value: 0x0018, lo: 0x80, hi: 0x9d}, + {value: 0xb5b9, lo: 0x9e, hi: 0x9e}, + {value: 0xb601, lo: 0x9f, hi: 0x9f}, + {value: 0xb649, lo: 0xa0, hi: 0xa0}, + {value: 0xb6b1, lo: 0xa1, hi: 0xa1}, + {value: 0xb719, lo: 0xa2, hi: 0xa2}, + {value: 0xb781, lo: 0xa3, hi: 0xa3}, + {value: 0xb7e9, lo: 0xa4, hi: 0xa4}, + {value: 0x1018, lo: 0xa5, hi: 0xa6}, + {value: 0x1318, lo: 0xa7, hi: 0xa9}, + {value: 0x0018, lo: 0xaa, hi: 0xac}, + {value: 0x1018, lo: 0xad, hi: 0xb2}, + {value: 0x0340, lo: 0xb3, hi: 0xba}, + {value: 0x1318, lo: 0xbb, hi: 0xbf}, + // Block 0xdb, offset 0x67a + {value: 0x0000, lo: 0x0b}, + {value: 0x1318, lo: 0x80, hi: 0x82}, + {value: 0x0018, lo: 0x83, hi: 0x84}, + {value: 0x1318, lo: 0x85, hi: 0x8b}, + {value: 0x0018, lo: 0x8c, hi: 0xa9}, + {value: 0x1318, lo: 0xaa, hi: 0xad}, + {value: 0x0018, lo: 0xae, hi: 0xba}, + {value: 0xb851, lo: 0xbb, hi: 0xbb}, + {value: 0xb899, lo: 0xbc, hi: 0xbc}, + {value: 0xb8e1, lo: 0xbd, hi: 0xbd}, + {value: 0xb949, lo: 0xbe, hi: 0xbe}, + {value: 0xb9b1, lo: 0xbf, hi: 0xbf}, + // Block 0xdc, offset 0x686 + {value: 0x0000, lo: 0x03}, + {value: 0xba19, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0xa8}, + {value: 0x0040, lo: 0xa9, hi: 0xbf}, + // Block 0xdd, offset 0x68a + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x81}, + {value: 0x1318, lo: 0x82, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x85}, + {value: 0x0040, lo: 0x86, hi: 0xbf}, + // Block 0xde, offset 0x68f + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0xdf, offset 0x694 + {value: 0x0000, lo: 0x03}, + {value: 0x1308, lo: 0x80, hi: 0xb6}, + {value: 0x0018, lo: 0xb7, hi: 0xba}, + {value: 0x1308, lo: 0xbb, hi: 0xbf}, + // Block 0xe0, offset 0x698 + {value: 0x0000, lo: 0x04}, + {value: 0x1308, lo: 0x80, hi: 0xac}, + {value: 0x0018, lo: 0xad, hi: 0xb4}, + {value: 0x1308, lo: 0xb5, hi: 0xb5}, + {value: 0x0018, lo: 0xb6, hi: 0xbf}, + // Block 0xe1, offset 0x69d + {value: 0x0000, lo: 0x08}, + {value: 0x0018, lo: 0x80, hi: 0x83}, + {value: 0x1308, lo: 0x84, hi: 0x84}, + {value: 0x0018, lo: 0x85, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x9a}, + {value: 0x1308, lo: 0x9b, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xa0}, + {value: 0x1308, lo: 0xa1, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, + // Block 0xe2, offset 0x6a6 + {value: 0x0000, lo: 0x0a}, + {value: 0x1308, lo: 0x80, hi: 0x86}, + {value: 0x0040, lo: 0x87, hi: 0x87}, + {value: 0x1308, lo: 0x88, hi: 0x98}, + {value: 0x0040, lo: 0x99, hi: 0x9a}, + {value: 0x1308, lo: 0x9b, hi: 0xa1}, + {value: 0x0040, lo: 0xa2, hi: 0xa2}, + {value: 0x1308, lo: 0xa3, hi: 0xa4}, + {value: 0x0040, lo: 0xa5, hi: 0xa5}, + {value: 0x1308, lo: 0xa6, hi: 0xaa}, + {value: 0x0040, lo: 0xab, hi: 0xbf}, + // Block 0xe3, offset 0x6b1 + {value: 0x0000, lo: 0x05}, + {value: 0x0008, lo: 0x80, hi: 0x84}, + {value: 0x0040, lo: 0x85, hi: 0x86}, + {value: 0x0018, lo: 0x87, hi: 0x8f}, + {value: 0x1308, lo: 0x90, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0xbf}, + // Block 0xe4, offset 0x6b7 + {value: 0x0000, lo: 0x07}, + {value: 0x0208, lo: 0x80, hi: 0x83}, + {value: 0x1308, lo: 0x84, hi: 0x8a}, + {value: 0x0040, lo: 0x8b, hi: 0x8f}, + {value: 0x0008, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9d}, + {value: 0x0018, lo: 0x9e, hi: 0x9f}, + {value: 0x0040, lo: 0xa0, hi: 0xbf}, + // Block 0xe5, offset 0x6bf + {value: 0x0000, lo: 0x03}, + {value: 0x0040, lo: 0x80, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb1}, + {value: 0x0040, lo: 0xb2, hi: 0xbf}, + // Block 0xe6, offset 0x6c3 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0xab}, + {value: 0x0040, lo: 0xac, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xbf}, + // Block 0xe7, offset 0x6c7 + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x93}, + {value: 0x0040, lo: 0x94, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xae}, + {value: 0x0040, lo: 0xaf, hi: 0xb0}, + {value: 0x0018, lo: 0xb1, hi: 0xbf}, + // Block 0xe8, offset 0x6cd + {value: 0x0000, lo: 0x05}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0018, lo: 0x81, hi: 0x8f}, + {value: 0x0040, lo: 0x90, hi: 0x90}, + {value: 0x0018, lo: 0x91, hi: 0xb5}, + {value: 0x0040, lo: 0xb6, hi: 0xbf}, + // Block 0xe9, offset 0x6d3 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x8f}, + {value: 0xc1c1, lo: 0x90, hi: 0x90}, + {value: 0x0018, lo: 0x91, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xbf}, + // Block 0xea, offset 0x6d8 + {value: 0x0000, lo: 0x02}, + {value: 0x0040, lo: 0x80, hi: 0xa5}, + {value: 0x0018, lo: 0xa6, hi: 0xbf}, + // Block 0xeb, offset 0x6db + {value: 0x0000, lo: 0x0d}, + {value: 0xc7e9, lo: 0x80, hi: 0x80}, + {value: 0xc839, lo: 0x81, hi: 0x81}, + {value: 0xc889, lo: 0x82, hi: 0x82}, + {value: 0xc8d9, lo: 0x83, hi: 0x83}, + {value: 0xc929, lo: 0x84, hi: 0x84}, + {value: 0xc979, lo: 0x85, hi: 0x85}, + {value: 0xc9c9, lo: 0x86, hi: 0x86}, + {value: 0xca19, lo: 0x87, hi: 0x87}, + {value: 0xca69, lo: 0x88, hi: 0x88}, + {value: 0x0040, lo: 0x89, hi: 0x8f}, + {value: 0xcab9, lo: 0x90, hi: 0x90}, + {value: 0xcad9, lo: 0x91, hi: 0x91}, + {value: 0x0040, lo: 0x92, hi: 0xbf}, + // Block 0xec, offset 0x6e9 + {value: 0x0000, lo: 0x06}, + {value: 0x0018, lo: 0x80, hi: 0x92}, + {value: 0x0040, lo: 0x93, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xac}, + {value: 0x0040, lo: 0xad, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb6}, + {value: 0x0040, lo: 0xb7, hi: 0xbf}, + // Block 0xed, offset 0x6f0 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0xb3}, + {value: 0x0040, lo: 0xb4, hi: 0xbf}, + // Block 0xee, offset 0x6f3 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x94}, + {value: 0x0040, lo: 0x95, hi: 0xbf}, + // Block 0xef, offset 0x6f6 + {value: 0x0000, lo: 0x03}, + {value: 0x0018, lo: 0x80, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xbf}, + // Block 0xf0, offset 0x6fa + {value: 0x0000, lo: 0x05}, + {value: 0x0018, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x99}, + {value: 0x0040, lo: 0x9a, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xbf}, + // Block 0xf1, offset 0x700 + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x87}, + {value: 0x0040, lo: 0x88, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0xad}, + {value: 0x0040, lo: 0xae, hi: 0xbf}, + // Block 0xf2, offset 0x705 + {value: 0x0000, lo: 0x09}, + {value: 0x0040, lo: 0x80, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0x9f}, + {value: 0x0018, lo: 0xa0, hi: 0xa7}, + {value: 0x0040, lo: 0xa8, hi: 0xaf}, + {value: 0x0018, lo: 0xb0, hi: 0xb0}, + {value: 0x0040, lo: 0xb1, hi: 0xb2}, + {value: 0x0018, lo: 0xb3, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xf3, offset 0x70f + {value: 0x0000, lo: 0x04}, + {value: 0x0018, lo: 0x80, hi: 0x8b}, + {value: 0x0040, lo: 0x8c, hi: 0x8f}, + {value: 0x0018, lo: 0x90, hi: 0x9e}, + {value: 0x0040, lo: 0x9f, hi: 0xbf}, + // Block 0xf4, offset 0x714 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x91}, + {value: 0x0040, lo: 0x92, hi: 0xbf}, + // Block 0xf5, offset 0x717 + {value: 0x0000, lo: 0x02}, + {value: 0x0018, lo: 0x80, hi: 0x80}, + {value: 0x0040, lo: 0x81, hi: 0xbf}, + // Block 0xf6, offset 0x71a + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0x96}, + {value: 0x0040, lo: 0x97, hi: 0xbf}, + // Block 0xf7, offset 0x71d + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xb4}, + {value: 0x0040, lo: 0xb5, hi: 0xbf}, + // Block 0xf8, offset 0x720 + {value: 0x0000, lo: 0x03}, + {value: 0x0008, lo: 0x80, hi: 0x9d}, + {value: 0x0040, lo: 0x9e, hi: 0x9f}, + {value: 0x0008, lo: 0xa0, hi: 0xbf}, + // Block 0xf9, offset 0x724 + {value: 0x0000, lo: 0x02}, + {value: 0x0008, lo: 0x80, hi: 0xa1}, + {value: 0x0040, lo: 0xa2, hi: 0xbf}, + // Block 0xfa, offset 0x727 + {value: 0x0020, lo: 0x0f}, + {value: 0xdeb9, lo: 0x80, hi: 0x89}, + {value: 0x8dfd, lo: 0x8a, hi: 0x8a}, + {value: 0xdff9, lo: 0x8b, hi: 0x9c}, + {value: 0x8e1d, lo: 0x9d, hi: 0x9d}, + {value: 0xe239, lo: 0x9e, hi: 0xa2}, + {value: 0x8e3d, lo: 0xa3, hi: 0xa3}, + {value: 0xe2d9, lo: 0xa4, hi: 0xab}, + {value: 0x7ed5, lo: 0xac, hi: 0xac}, + {value: 0xe3d9, lo: 0xad, hi: 0xaf}, + {value: 0x8e5d, lo: 0xb0, hi: 0xb0}, + {value: 0xe439, lo: 0xb1, hi: 0xb6}, + {value: 0x8e7d, lo: 0xb7, hi: 0xb9}, + {value: 0xe4f9, lo: 0xba, hi: 0xba}, + {value: 0x8edd, lo: 0xbb, hi: 0xbb}, + {value: 0xe519, lo: 0xbc, hi: 0xbf}, + // Block 0xfb, offset 0x737 + {value: 0x0020, lo: 0x10}, + {value: 0x937d, lo: 0x80, hi: 0x80}, + {value: 0xf099, lo: 0x81, hi: 0x86}, + {value: 0x939d, lo: 0x87, hi: 0x8a}, + {value: 0xd9f9, lo: 0x8b, hi: 0x8b}, + {value: 0xf159, lo: 0x8c, hi: 0x96}, + {value: 0x941d, lo: 0x97, hi: 0x97}, + {value: 0xf2b9, lo: 0x98, hi: 0xa3}, + {value: 0x943d, lo: 0xa4, hi: 0xa6}, + {value: 0xf439, lo: 0xa7, hi: 0xaa}, + {value: 0x949d, lo: 0xab, hi: 0xab}, + {value: 0xf4b9, lo: 0xac, hi: 0xac}, + {value: 0x94bd, lo: 0xad, hi: 0xad}, + {value: 0xf4d9, lo: 0xae, hi: 0xaf}, + {value: 0x94dd, lo: 0xb0, hi: 0xb1}, + {value: 0xf519, lo: 0xb2, hi: 0xbe}, + {value: 0x0040, lo: 0xbf, hi: 0xbf}, + // Block 0xfc, offset 0x748 + {value: 0x0000, lo: 0x04}, + {value: 0x0040, lo: 0x80, hi: 0x80}, + {value: 0x0340, lo: 0x81, hi: 0x81}, + {value: 0x0040, lo: 0x82, hi: 0x9f}, + {value: 0x0340, lo: 0xa0, hi: 0xbf}, + // Block 0xfd, offset 0x74d + {value: 0x0000, lo: 0x01}, + {value: 0x0340, lo: 0x80, hi: 0xbf}, + // Block 0xfe, offset 0x74f + {value: 0x0000, lo: 0x01}, + {value: 0x13c0, lo: 0x80, hi: 0xbf}, + // Block 0xff, offset 0x751 + {value: 0x0000, lo: 0x02}, + {value: 0x13c0, lo: 0x80, hi: 0xaf}, + {value: 0x0040, lo: 0xb0, hi: 0xbf}, +} + +// Total table size 41559 bytes (40KiB); checksum: F4A1FA4E diff --git a/vendor/golang.org/x/net/idna/trie.go b/vendor/golang.org/x/net/idna/trie.go new file mode 100644 index 0000000..c4ef847 --- /dev/null +++ b/vendor/golang.org/x/net/idna/trie.go @@ -0,0 +1,72 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package idna + +// appendMapping appends the mapping for the respective rune. isMapped must be +// true. A mapping is a categorization of a rune as defined in UTS #46. +func (c info) appendMapping(b []byte, s string) []byte { + index := int(c >> indexShift) + if c&xorBit == 0 { + s := mappings[index:] + return append(b, s[1:s[0]+1]...) + } + b = append(b, s...) + if c&inlineXOR == inlineXOR { + // TODO: support and handle two-byte inline masks + b[len(b)-1] ^= byte(index) + } else { + for p := len(b) - int(xorData[index]); p < len(b); p++ { + index++ + b[p] ^= xorData[index] + } + } + return b +} + +// Sparse block handling code. + +type valueRange struct { + value uint16 // header: value:stride + lo, hi byte // header: lo:n +} + +type sparseBlocks struct { + values []valueRange + offset []uint16 +} + +var idnaSparse = sparseBlocks{ + values: idnaSparseValues[:], + offset: idnaSparseOffset[:], +} + +// Don't use newIdnaTrie to avoid unconditional linking in of the table. +var trie = &idnaTrie{} + +// lookup determines the type of block n and looks up the value for b. +// For n < t.cutoff, the block is a simple lookup table. Otherwise, the block +// is a list of ranges with an accompanying value. Given a matching range r, +// the value for b is by r.value + (b - r.lo) * stride. +func (t *sparseBlocks) lookup(n uint32, b byte) uint16 { + offset := t.offset[n] + header := t.values[offset] + lo := offset + 1 + hi := lo + uint16(header.lo) + for lo < hi { + m := lo + (hi-lo)/2 + r := t.values[m] + if r.lo <= b && b <= r.hi { + return r.value + uint16(b-r.lo)*header.value + } + if b < r.lo { + hi = m + } else { + lo = m + 1 + } + } + return 0 +} diff --git a/vendor/golang.org/x/net/idna/trieval.go b/vendor/golang.org/x/net/idna/trieval.go new file mode 100644 index 0000000..63cb03b --- /dev/null +++ b/vendor/golang.org/x/net/idna/trieval.go @@ -0,0 +1,114 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package idna + +// This file contains definitions for interpreting the trie value of the idna +// trie generated by "go run gen*.go". It is shared by both the generator +// program and the resultant package. Sharing is achieved by the generator +// copying gen_trieval.go to trieval.go and changing what's above this comment. + +// info holds information from the IDNA mapping table for a single rune. It is +// the value returned by a trie lookup. In most cases, all information fits in +// a 16-bit value. For mappings, this value may contain an index into a slice +// with the mapped string. Such mappings can consist of the actual mapped value +// or an XOR pattern to be applied to the bytes of the UTF8 encoding of the +// input rune. This technique is used by the cases packages and reduces the +// table size significantly. +// +// The per-rune values have the following format: +// +// if mapped { +// if inlinedXOR { +// 15..13 inline XOR marker +// 12..11 unused +// 10..3 inline XOR mask +// } else { +// 15..3 index into xor or mapping table +// } +// } else { +// 15..13 unused +// 12 modifier (including virama) +// 11 virama modifier +// 10..8 joining type +// 7..3 category type +// } +// 2 use xor pattern +// 1..0 mapped category +// +// See the definitions below for a more detailed description of the various +// bits. +type info uint16 + +const ( + catSmallMask = 0x3 + catBigMask = 0xF8 + indexShift = 3 + xorBit = 0x4 // interpret the index as an xor pattern + inlineXOR = 0xE000 // These bits are set if the XOR pattern is inlined. + + joinShift = 8 + joinMask = 0x07 + + viramaModifier = 0x0800 + modifier = 0x1000 +) + +// A category corresponds to a category defined in the IDNA mapping table. +type category uint16 + +const ( + unknown category = 0 // not defined currently in unicode. + mapped category = 1 + disallowedSTD3Mapped category = 2 + deviation category = 3 +) + +const ( + valid category = 0x08 + validNV8 category = 0x18 + validXV8 category = 0x28 + disallowed category = 0x40 + disallowedSTD3Valid category = 0x80 + ignored category = 0xC0 +) + +// join types and additional rune information +const ( + joiningL = (iota + 1) + joiningD + joiningT + joiningR + + //the following types are derived during processing + joinZWJ + joinZWNJ + joinVirama + numJoinTypes +) + +func (c info) isMapped() bool { + return c&0x3 != 0 +} + +func (c info) category() category { + small := c & catSmallMask + if small != 0 { + return category(small) + } + return category(c & catBigMask) +} + +func (c info) joinType() info { + if c.isMapped() { + return 0 + } + return (c >> joinShift) & joinMask +} + +func (c info) isModifier() bool { + return c&(modifier|catSmallMask) == modifier +} + +func (c info) isViramaModifier() bool { + return c&(viramaModifier|catSmallMask) == viramaModifier +} diff --git a/vendor/golang.org/x/text/cases/cases.go b/vendor/golang.org/x/text/cases/cases.go index 13b3a57..cf70630 100644 --- a/vendor/golang.org/x/text/cases/cases.go +++ b/vendor/golang.org/x/text/cases/cases.go @@ -35,7 +35,7 @@ import ( // A Caser may be stateful and should therefore not be shared between // goroutines. type Caser struct { - t transform.Transformer + t transform.SpanningTransformer } // Bytes returns a new byte slice with the result of converting b to the case @@ -56,12 +56,17 @@ func (c Caser) String(s string) string { // Transform. func (c Caser) Reset() { c.t.Reset() } -// Transform implements the Transformer interface and transforms the given input -// to the case form implemented by c. +// Transform implements the transform.Transformer interface and transforms the +// given input to the case form implemented by c. func (c Caser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { return c.t.Transform(dst, src, atEOF) } +// Span implements the transform.SpanningTransformer interface. +func (c Caser) Span(src []byte, atEOF bool) (n int, err error) { + return c.t.Span(src, atEOF) +} + // Upper returns a Caser for language-specific uppercasing. func Upper(t language.Tag, opts ...Option) Caser { return Caser{makeUpper(t, getOpts(opts...))} @@ -83,14 +88,20 @@ func Title(t language.Tag, opts ...Option) Caser { // // Case folding does not normalize the input and may not preserve a normal form. // Use the collate or search package for more convenient and linguistically -// sound comparisons. Use unicode/precis for string comparisons where security -// aspects are a concern. +// sound comparisons. Use golang.org/x/text/secure/precis for string comparisons +// where security aspects are a concern. func Fold(opts ...Option) Caser { return Caser{makeFold(getOpts(opts...))} } // An Option is used to modify the behavior of a Caser. -type Option func(o *options) +type Option func(o options) options + +// TODO: consider these options to take a boolean as well, like FinalSigma. +// The advantage of using this approach is that other providers of a lower-case +// algorithm could set different defaults by prefixing a user-provided slice +// of options with their own. This is handy, for instance, for the precis +// package which would override the default to not handle the Greek final sigma. var ( // NoLower disables the lowercasing of non-leading letters for a title @@ -110,20 +121,42 @@ type options struct { // TODO: segmenter, max ignorable, alternative versions, etc. - noFinalSigma bool // Only used for testing. + ignoreFinalSigma bool } func getOpts(o ...Option) (res options) { for _, f := range o { - f(&res) + res = f(res) } return } -func noLower(o *options) { +func noLower(o options) options { o.noLower = true + return o } -func compact(o *options) { +func compact(o options) options { o.simple = true + return o +} + +// HandleFinalSigma specifies whether the special handling of Greek final sigma +// should be enabled. Unicode prescribes handling the Greek final sigma for all +// locales, but standards like IDNA and PRECIS override this default. +func HandleFinalSigma(enable bool) Option { + if enable { + return handleFinalSigma + } + return ignoreFinalSigma +} + +func ignoreFinalSigma(o options) options { + o.ignoreFinalSigma = true + return o +} + +func handleFinalSigma(o options) options { + o.ignoreFinalSigma = false + return o } diff --git a/vendor/golang.org/x/text/cases/context.go b/vendor/golang.org/x/text/cases/context.go index 0d2e497..e9aa9e1 100644 --- a/vendor/golang.org/x/text/cases/context.go +++ b/vendor/golang.org/x/text/cases/context.go @@ -4,9 +4,7 @@ package cases -import ( - "golang.org/x/text/transform" -) +import "golang.org/x/text/transform" // A context is used for iterating over source bytes, fetching case info and // writing to a destination buffer. @@ -56,6 +54,14 @@ func (c *context) ret() (nDst, nSrc int, err error) { return c.nDst, c.nSrc, transform.ErrShortSrc } +// retSpan returns the return values for the Span method. It checks whether +// there were insufficient bytes in src to complete and introduces an error +// accordingly, if necessary. +func (c *context) retSpan() (n int, err error) { + _, nSrc, err := c.ret() + return nSrc, err +} + // checkpoint sets the return value buffer points for Transform to the current // positions. func (c *context) checkpoint() { @@ -200,6 +206,23 @@ func lower(c *context) bool { return c.copy() } +func isLower(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cLower { + return true + } + if c.info&exceptionBit == 0 { + c.err = transform.ErrEndOfSpan + return false + } + e := exceptions[c.info>>exceptionShift:] + if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + // upper writes the uppercase version of the current rune to dst. func upper(c *context) bool { ct := c.caseType() @@ -226,6 +249,29 @@ func upper(c *context) bool { return c.copy() } +// isUpper writes the isUppercase version of the current rune to dst. +func isUpper(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cUpper { + return true + } + if c.info&exceptionBit == 0 { + c.err = transform.ErrEndOfSpan + return false + } + e := exceptions[c.info>>exceptionShift:] + // Get length of first special case mapping. + n := (e[1] >> lengthBits) & lengthMask + if ct == cTitle { + n = e[1] & lengthMask + } + if n != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + // title writes the title case version of the current rune to dst. func title(c *context) bool { ct := c.caseType() @@ -257,6 +303,33 @@ func title(c *context) bool { return c.copy() } +// isTitle reports whether the current rune is in title case. +func isTitle(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cTitle { + return true + } + if c.info&exceptionBit == 0 { + if ct == cLower { + c.err = transform.ErrEndOfSpan + return false + } + return true + } + // Get the exception data. + e := exceptions[c.info>>exceptionShift:] + if nTitle := e[1] & lengthMask; nTitle != noChange { + c.err = transform.ErrEndOfSpan + return false + } + nFirst := (e[1] >> lengthBits) & lengthMask + if ct == cLower && nFirst != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + // foldFull writes the foldFull version of the current rune to dst. func foldFull(c *context) bool { if c.info&hasMappingMask == 0 { @@ -279,3 +352,25 @@ func foldFull(c *context) bool { } return c.writeString(e[2 : 2+n]) } + +// isFoldFull reports whether the current run is mapped to foldFull +func isFoldFull(c *context) bool { + if c.info&hasMappingMask == 0 { + return true + } + ct := c.caseType() + if c.info&exceptionBit == 0 { + if ct != cLower || c.info&inverseFoldBit != 0 { + c.err = transform.ErrEndOfSpan + return false + } + return true + } + e := exceptions[c.info>>exceptionShift:] + n := e[0] & lengthMask + if n == 0 && ct == cLower { + return true + } + c.err = transform.ErrEndOfSpan + return false +} diff --git a/vendor/golang.org/x/text/cases/fold.go b/vendor/golang.org/x/text/cases/fold.go index e95bfa8..85cc434 100644 --- a/vendor/golang.org/x/text/cases/fold.go +++ b/vendor/golang.org/x/text/cases/fold.go @@ -18,7 +18,15 @@ func (t *caseFolder) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err return c.ret() } -func makeFold(o options) transform.Transformer { +func (t *caseFolder) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isFoldFull(&c) { + c.checkpoint() + } + return c.retSpan() +} + +func makeFold(o options) transform.SpanningTransformer { // TODO: Special case folding, through option Language, Special/Turkic, or // both. // TODO: Implement Compact options. diff --git a/vendor/golang.org/x/text/cases/gen.go b/vendor/golang.org/x/text/cases/gen.go index f46170f..24b7230 100644 --- a/vendor/golang.org/x/text/cases/gen.go +++ b/vendor/golang.org/x/text/cases/gen.go @@ -76,7 +76,7 @@ type breakCategory int const ( breakBreak breakCategory = iota breakLetter - breakIgnored + breakMid ) // mapping returns the case mapping for the given case type. @@ -162,9 +162,14 @@ func parseUCD() []runeInfo { // We collapse the word breaking properties onto the categories we need. switch p.String(1) { // TODO: officially we need to canonicalize. - case "Format", "MidLetter", "MidNumLet", "Single_Quote": - ri.BreakCat = breakIgnored - case "ALetter", "Hebrew_Letter", "Numeric", "Extend", "ExtendNumLet": + case "MidLetter", "MidNumLet", "Single_Quote": + ri.BreakCat = breakMid + if !ri.CaseIgnorable { + // finalSigma relies on the fact that all breakMid runes are + // also a Case_Ignorable. Revisit this code when this changes. + log.Fatalf("Rune %U, which has a break category mid, is not a case ignorable", ri) + } + case "ALetter", "Hebrew_Letter", "Numeric", "Extend", "ExtendNumLet", "Format", "ZWJ": ri.BreakCat = breakLetter } }) @@ -240,8 +245,11 @@ func makeEntry(ri *runeInfo) { case above: // Above ccc = cccAbove } - if ri.BreakCat == breakBreak { + switch ri.BreakCat { + case breakBreak: ccc = cccBreak + case breakMid: + ri.entry |= isMidBit } ri.entry |= ccc @@ -588,7 +596,7 @@ func verifyProperties(chars []runeInfo) { // decomposition is greater than U+00FF, the rune is always // great and not a modifier. if f := runes[0]; unicode.IsMark(f) || f > 0xFF && !unicode.Is(unicode.Greek, f) { - log.Fatalf("%U: expeced first rune of Greek decomposition to be letter, found %U", r, f) + log.Fatalf("%U: expected first rune of Greek decomposition to be letter, found %U", r, f) } // A.6.2: Any follow-up rune in a Greek decomposition is a // modifier of which the first should be gobbled in @@ -597,7 +605,7 @@ func verifyProperties(chars []runeInfo) { switch m { case 0x0313, 0x0314, 0x0301, 0x0300, 0x0306, 0x0342, 0x0308, 0x0304, 0x345: default: - log.Fatalf("%U: modifier %U is outside of expeced Greek modifier set", r, m) + log.Fatalf("%U: modifier %U is outside of expected Greek modifier set", r, m) } } } @@ -690,7 +698,7 @@ func genTablesTest() { parse("auxiliary/WordBreakProperty.txt", func(p *ucd.Parser) { switch p.String(1) { case "Extend", "Format", "MidLetter", "MidNumLet", "Single_Quote", - "ALetter", "Hebrew_Letter", "Numeric", "ExtendNumLet": + "ALetter", "Hebrew_Letter", "Numeric", "ExtendNumLet", "ZWJ": notBreak[p.Rune(0)] = true } }) diff --git a/vendor/golang.org/x/text/cases/gen_trieval.go b/vendor/golang.org/x/text/cases/gen_trieval.go index cf1a99d..376d22c 100644 --- a/vendor/golang.org/x/text/cases/gen_trieval.go +++ b/vendor/golang.org/x/text/cases/gen_trieval.go @@ -26,6 +26,7 @@ package main // Only 13..8 are used for XOR patterns. // 7 inverseFold (fold to upper, not to lower) // 6 index: interpret the XOR pattern as an index +// or isMid if case mode is cIgnorableUncased. // 5..4 CCC: zero (normal or break), above or other // } // 3 exception: interpret this value as an exception index @@ -48,6 +49,7 @@ const ( ignorableValue = 0x0004 inverseFoldBit = 1 << 7 + isMidBit = 1 << 6 exceptionBit = 1 << 3 exceptionShift = 5 @@ -57,7 +59,7 @@ const ( xorShift = 8 // There is no mapping if all xor bits and the exception bit are zero. - hasMappingMask = 0xffc0 | exceptionBit + hasMappingMask = 0xff80 | exceptionBit ) // The case mode bits encodes the case type of a rune. This includes uncased, @@ -95,10 +97,6 @@ func (c info) isCaseIgnorable() bool { return c&ignorableMask == ignorableValue } -func (c info) isCaseIgnorableAndNonBreakStarter() bool { - return c&(fullCasedMask|cccMask) == (ignorableValue | cccZero) -} - func (c info) isNotCasedAndNotCaseIgnorable() bool { return c&fullCasedMask == 0 } @@ -107,6 +105,10 @@ func (c info) isCaseIgnorableAndNotCased() bool { return c&fullCasedMask == cIgnorableUncased } +func (c info) isMid() bool { + return c&(fullCasedMask|isMidBit) == isMidBit|cIgnorableUncased +} + // The case mapping implementation will need to know about various Canonical // Combining Class (CCC) values. We encode two of these in the trie value: // cccZero (0) and cccAbove (230). If the value is cccOther, it means that diff --git a/vendor/golang.org/x/text/cases/icu.go b/vendor/golang.org/x/text/cases/icu.go new file mode 100644 index 0000000..46530d1 --- /dev/null +++ b/vendor/golang.org/x/text/cases/icu.go @@ -0,0 +1,61 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build icu + +package cases + +// Ideally these functions would be defined in a test file, but go test doesn't +// allow CGO in tests. The build tag should ensure either way that these +// functions will not end up in the package. + +// TODO: Ensure that the correct ICU version is set. + +/* +#cgo LDFLAGS: -licui18n.57 -licuuc.57 +#include +#include +#include +#include +#include +*/ +import "C" + +import "unsafe" + +func doICU(tag, caser, input string) string { + err := C.UErrorCode(0) + loc := C.CString(tag) + cm := C.ucasemap_open(loc, C.uint32_t(0), &err) + + buf := make([]byte, len(input)*4) + dst := (*C.char)(unsafe.Pointer(&buf[0])) + src := C.CString(input) + + cn := C.int32_t(0) + + switch caser { + case "fold": + cn = C.ucasemap_utf8FoldCase(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "lower": + cn = C.ucasemap_utf8ToLower(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "upper": + cn = C.ucasemap_utf8ToUpper(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "title": + cn = C.ucasemap_utf8ToTitle(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + } + return string(buf[:cn]) +} diff --git a/vendor/golang.org/x/text/cases/info.go b/vendor/golang.org/x/text/cases/info.go index 669d7ae..3b51f03 100644 --- a/vendor/golang.org/x/text/cases/info.go +++ b/vendor/golang.org/x/text/cases/info.go @@ -28,9 +28,6 @@ func (c info) cccType() info { // only makes sense, though, if the performance and/or space penalty of using // the generic breaker is big. Extra data will only be needed for non-cased // runes, which means there are sufficient bits left in the caseType. -// Also note that the standard breaking algorithm doesn't always make sense -// for title casing. For example, a4a -> A4a, but a"4a -> A"4A (where " stands -// for modifier \u0308). // ICU prohibits breaking in such cases as well. // For the purpose of title casing we use an approximation of the Unicode Word @@ -41,17 +38,19 @@ func (c info) cccType() info { // categories, with associated rules: // // 1) Letter: -// ALetter, Hebrew_Letter, Numeric, ExtendNumLet, Extend. +// ALetter, Hebrew_Letter, Numeric, ExtendNumLet, Extend, Format_FE, ZWJ. // Rule: Never break between consecutive runes of this category. // // 2) Mid: -// Format, MidLetter, MidNumLet, Single_Quote. -// (Cf. case-ignorable: MidLetter, MidNumLet or cat is Mn, Me, Cf, Lm or Sk). +// MidLetter, MidNumLet, Single_Quote. +// (Cf. case-ignorable: MidLetter, MidNumLet, Single_Quote or cat is Mn, +// Me, Cf, Lm or Sk). // Rule: Don't break between Letter and Mid, but break between two Mids. // // 3) Break: -// Any other category, including NewLine, CR, LF and Double_Quote. These -// categories should always result in a break between two cased letters. +// Any other category: NewLine, MidNum, CR, LF, Double_Quote, Katakana, and +// Other. +// These categories should always result in a break between two cased letters. // Rule: Always break. // // Note 1: the Katakana and MidNum categories can, in esoteric cases, result in diff --git a/vendor/golang.org/x/text/cases/map.go b/vendor/golang.org/x/text/cases/map.go index f2a8e96..4baebaa 100644 --- a/vendor/golang.org/x/text/cases/map.go +++ b/vendor/golang.org/x/text/cases/map.go @@ -13,6 +13,7 @@ import ( "unicode" "unicode/utf8" + "golang.org/x/text/internal" "golang.org/x/text/language" "golang.org/x/text/transform" "golang.org/x/text/unicode/norm" @@ -24,6 +25,11 @@ import ( // dst so far won't need changing as we see more source bytes. type mapFunc func(*context) bool +// A spanFunc takes a context set to the current rune and returns whether this +// rune would be altered when written to the output. It may advance the context +// to the next rune. It returns whether a checkpoint is possible. +type spanFunc func(*context) bool + // maxIgnorable defines the maximum number of ignorables to consider for // lookahead operations. const maxIgnorable = 30 @@ -36,12 +42,12 @@ func init() { for _, s := range strings.Split(supported, " ") { tags = append(tags, language.MustParse(s)) } - matcher = language.NewMatcher(tags) + matcher = internal.NewInheritanceMatcher(tags) Supported = language.NewCoverage(tags) } var ( - matcher language.Matcher + matcher *internal.InheritanceMatcher Supported language.Coverage @@ -50,56 +56,69 @@ var ( // Some uppercase mappers are stateless, so we can precompute the // Transformers and save a bit on runtime allocations. - upperFunc = []mapFunc{ - nil, // und - nil, // af - aztrUpper(upper), // az - elUpper, // el - ltUpper(upper), // lt - nil, // nl - aztrUpper(upper), // tr + upperFunc = []struct { + upper mapFunc + span spanFunc + }{ + {nil, nil}, // und + {nil, nil}, // af + {aztrUpper(upper), isUpper}, // az + {elUpper, noSpan}, // el + {ltUpper(upper), noSpan}, // lt + {nil, nil}, // nl + {aztrUpper(upper), isUpper}, // tr } - undUpper transform.Transformer = &undUpperCaser{} + undUpper transform.SpanningTransformer = &undUpperCaser{} + undLower transform.SpanningTransformer = &undLowerCaser{} + undLowerIgnoreSigma transform.SpanningTransformer = &undLowerIgnoreSigmaCaser{} lowerFunc = []mapFunc{ - lower, // und - lower, // af + nil, // und + nil, // af aztrLower, // az - lower, // el + nil, // el ltLower, // lt - lower, // nl + nil, // nl aztrLower, // tr } titleInfos = []struct { - title, lower mapFunc - rewrite func(*context) + title mapFunc + lower mapFunc + titleSpan spanFunc + rewrite func(*context) }{ - {title, lower, nil}, // und - {title, lower, afnlRewrite}, // af - {aztrUpper(title), aztrLower, nil}, // az - {title, lower, nil}, // el - {ltUpper(title), ltLower, nil}, // lt - {nlTitle, lower, afnlRewrite}, // nl - {aztrUpper(title), aztrLower, nil}, // tr + {title, lower, isTitle, nil}, // und + {title, lower, isTitle, afnlRewrite}, // af + {aztrUpper(title), aztrLower, isTitle, nil}, // az + {title, lower, isTitle, nil}, // el + {ltUpper(title), ltLower, noSpan, nil}, // lt + {nlTitle, lower, nlTitleSpan, afnlRewrite}, // nl + {aztrUpper(title), aztrLower, isTitle, nil}, // tr } ) -func makeUpper(t language.Tag, o options) transform.Transformer { +func makeUpper(t language.Tag, o options) transform.SpanningTransformer { _, i, _ := matcher.Match(t) - f := upperFunc[i] + f := upperFunc[i].upper if f == nil { return undUpper } - return &simpleCaser{f: f} + return &simpleCaser{f: f, span: upperFunc[i].span} } -func makeLower(t language.Tag, o options) transform.Transformer { +func makeLower(t language.Tag, o options) transform.SpanningTransformer { _, i, _ := matcher.Match(t) f := lowerFunc[i] - if o.noFinalSigma { - return &simpleCaser{f: f} + if f == nil { + if o.ignoreFinalSigma { + return undLowerIgnoreSigma + } + return undLower + } + if o.ignoreFinalSigma { + return &simpleCaser{f: f, span: isLower} } return &lowerCaser{ first: f, @@ -107,22 +126,28 @@ func makeLower(t language.Tag, o options) transform.Transformer { } } -func makeTitle(t language.Tag, o options) transform.Transformer { +func makeTitle(t language.Tag, o options) transform.SpanningTransformer { _, i, _ := matcher.Match(t) x := &titleInfos[i] lower := x.lower if o.noLower { lower = (*context).copy - } else if !o.noFinalSigma { + } else if !o.ignoreFinalSigma { lower = finalSigma(lower) } return &titleCaser{ - title: x.title, - lower: lower, - rewrite: x.rewrite, + title: x.title, + lower: lower, + titleSpan: x.titleSpan, + rewrite: x.rewrite, } } +func noSpan(c *context) bool { + c.err = transform.ErrEndOfSpan + return false +} + // TODO: consider a similar special case for the fast majority lower case. This // is a bit more involved so will require some more precise benchmarking to // justify it. @@ -132,7 +157,7 @@ type undUpperCaser struct{ transform.NopResetter } // undUpperCaser implements the Transformer interface for doing an upper case // mapping for the root locale (und). It eliminates the need for an allocation // as it prevents escaping by not using function pointers. -func (t *undUpperCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { +func (t undUpperCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { c := context{dst: dst, src: src, atEOF: atEOF} for c.next() { upper(&c) @@ -141,26 +166,117 @@ func (t *undUpperCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, return c.ret() } +func (t undUpperCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isUpper(&c) { + c.checkpoint() + } + return c.retSpan() +} + +// undLowerIgnoreSigmaCaser implements the Transformer interface for doing +// a lower case mapping for the root locale (und) ignoring final sigma +// handling. This casing algorithm is used in some performance-critical packages +// like secure/precis and x/net/http/idna, which warrants its special-casing. +type undLowerIgnoreSigmaCaser struct{ transform.NopResetter } + +func (t undLowerIgnoreSigmaCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() && lower(&c) { + c.checkpoint() + } + return c.ret() + +} + +// Span implements a generic lower-casing. This is possible as isLower works +// for all lowercasing variants. All lowercase variants only vary in how they +// transform a non-lowercase letter. They will never change an already lowercase +// letter. In addition, there is no state. +func (t undLowerIgnoreSigmaCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isLower(&c) { + c.checkpoint() + } + return c.retSpan() +} + type simpleCaser struct { context - f mapFunc + f mapFunc + span spanFunc } // simpleCaser implements the Transformer interface for doing a case operation // on a rune-by-rune basis. func (t *simpleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - t.context = context{dst: dst, src: src, atEOF: atEOF} - c := &t.context - for c.next() && t.f(c) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() && t.f(&c) { + c.checkpoint() + } + return c.ret() +} + +func (t *simpleCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && t.span(&c) { + c.checkpoint() + } + return c.retSpan() +} + +// undLowerCaser implements the Transformer interface for doing a lower case +// mapping for the root locale (und) ignoring final sigma handling. This casing +// algorithm is used in some performance-critical packages like secure/precis +// and x/net/http/idna, which warrants its special-casing. +type undLowerCaser struct{ transform.NopResetter } + +func (t undLowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + + for isInterWord := true; c.next(); { + if isInterWord { + if c.info.isCased() { + if !lower(&c) { + break + } + isInterWord = false + } else if !c.copy() { + break + } + } else { + if c.info.isNotCasedAndNotCaseIgnorable() { + if !c.copy() { + break + } + isInterWord = true + } else if !c.hasPrefix("Σ") { + if !lower(&c) { + break + } + } else if !finalSigmaBody(&c) { + break + } + } c.checkpoint() } return c.ret() } +func (t undLowerCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isLower(&c) { + c.checkpoint() + } + return c.retSpan() +} + // lowerCaser implements the Transformer interface. The default Unicode lower // casing requires different treatment for the first and subsequent characters // of a word, most notably to handle the Greek final Sigma. type lowerCaser struct { + undLowerIgnoreSigmaCaser + context first, midWord mapFunc @@ -202,7 +318,9 @@ type titleCaser struct { context // rune mappings used by the actual casing algorithms. - title, lower mapFunc + title mapFunc + lower mapFunc + titleSpan spanFunc rewrite func(*context) } @@ -228,10 +346,10 @@ func (t *titleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err t.rewrite(c) } - wasMid := p.isCaseIgnorableAndNonBreakStarter() + wasMid := p.isMid() // Break out of this loop on failure to ensure we do not modify the // state incorrectly. - if p.isCased() && !p.isCaseIgnorableAndNotCased() { + if p.isCased() { if !c.isMidWord { if !t.title(c) { break @@ -242,26 +360,69 @@ func (t *titleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err } } else if !c.copy() { break + } else if p.isBreak() { + c.isMidWord = false + } + + // As we save the state of the transformer, it is safe to call + // checkpoint after any successful write. + if !(c.isMidWord && wasMid) { + c.checkpoint() } - // TODO: make this an "else if" if we can prove that no rune that does - // not match the first condition of the if statement can be a break. - if p.isBreak() { + if !c.next() { + break + } + if wasMid && c.info.isMid() { c.isMidWord = false } + } + return c.ret() +} + +func (t *titleCaser) Span(src []byte, atEOF bool) (n int, err error) { + t.context = context{src: src, atEOF: atEOF, isMidWord: t.isMidWord} + c := &t.context + + if !c.next() { + return c.retSpan() + } + + for { + p := c.info + if t.rewrite != nil { + t.rewrite(c) + } + wasMid := p.isMid() + // Break out of this loop on failure to ensure we do not modify the + // state incorrectly. + if p.isCased() { + if !c.isMidWord { + if !t.titleSpan(c) { + break + } + c.isMidWord = true + } else if !isLower(c) { + break + } + } else if p.isBreak() { + c.isMidWord = false + } // As we save the state of the transformer, it is safe to call // checkpoint after any successful write. - c.checkpoint() + if !(c.isMidWord && wasMid) { + c.checkpoint() + } if !c.next() { break } - if wasMid && c.info.isCaseIgnorableAndNonBreakStarter() { + if wasMid && c.info.isMid() { c.isMidWord = false } } - return c.ret() + return c.retSpan() } // finalSigma adds Greek final Sigma handing to another casing function. It @@ -269,44 +430,69 @@ func (t *titleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err // case-ignorables and a cased letters. func finalSigma(f mapFunc) mapFunc { return func(c *context) bool { - // ::NFD(); - // # 03A3; 03C2; 03A3; 03A3; Final_Sigma; # GREEK CAPITAL LETTER SIGMA - // Σ } [:case-ignorable:]* [:cased:] → σ; - // [:cased:] [:case-ignorable:]* { Σ → ς; - // ::Any-Lower; - // ::NFC(); - if !c.hasPrefix("Σ") { return f(c) } + return finalSigmaBody(c) + } +} - p := c.pDst - c.writeString("ς") - // We need to do one more iteration after maxIgnorable, as a cased - // letter is not an ignorable and may modify the result. - for i := 0; i < maxIgnorable+1; i++ { - if !c.next() { - return false - } - if !c.info.isCaseIgnorable() { - if c.info.isCased() { - // p+1 is guaranteed to be in bounds: if writing ς was - // successful, p+1 will contain the second byte of ς. If not, - // this function will have returned after c.next returned false. - c.dst[p+1]++ // ς → σ - } - c.unreadRune() - return true +func finalSigmaBody(c *context) bool { + // Current rune must be ∑. + + // ::NFD(); + // # 03A3; 03C2; 03A3; 03A3; Final_Sigma; # GREEK CAPITAL LETTER SIGMA + // Σ } [:case-ignorable:]* [:cased:] → σ; + // [:cased:] [:case-ignorable:]* { Σ → ς; + // ::Any-Lower; + // ::NFC(); + + p := c.pDst + c.writeString("ς") + + // TODO: we should do this here, but right now this will never have an + // effect as this is called when the prefix is Sigma, whereas Dutch and + // Afrikaans only test for an apostrophe. + // + // if t.rewrite != nil { + // t.rewrite(c) + // } + + // We need to do one more iteration after maxIgnorable, as a cased + // letter is not an ignorable and may modify the result. + wasMid := false + for i := 0; i < maxIgnorable+1; i++ { + if !c.next() { + return false + } + if !c.info.isCaseIgnorable() { + // All Midword runes are also case ignorable, so we are + // guaranteed to have a letter or word break here. As we are + // unreading the run, there is no need to unset c.isMidWord; + // the title caser will handle this. + if c.info.isCased() { + // p+1 is guaranteed to be in bounds: if writing ς was + // successful, p+1 will contain the second byte of ς. If not, + // this function will have returned after c.next returned false. + c.dst[p+1]++ // ς → σ } - // A case ignorable may also introduce a word break, so we may need - // to continue searching even after detecting a break. - c.isMidWord = c.isMidWord && !c.info.isBreak() - c.copy() + c.unreadRune() + return true } - return true + // A case ignorable may also introduce a word break, so we may need + // to continue searching even after detecting a break. + isMid := c.info.isMid() + if (wasMid && isMid) || c.info.isBreak() { + c.isMidWord = false + } + wasMid = isMid + c.copy() } + return true } +// finalSigmaSpan would be the same as isLower. + // elUpper implements Greek upper casing, which entails removing a predefined // set of non-blocked modifiers. Note that these accents should not be removed // for title casing! @@ -376,6 +562,8 @@ func elUpper(c *context) bool { return i == maxIgnorable } +// TODO: implement elUpperSpan (low-priority: complex and infrequent). + func ltLower(c *context) bool { // From CLDR: // # Introduce an explicit dot above when lowercasing capital I's and J's @@ -390,10 +578,10 @@ func ltLower(c *context) bool { // ::NFD(); // I } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0307; // J } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → j \u0307; - // Į } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → į \u0307; - // Ì → i \u0307 \u0300; - // Í → i \u0307 \u0301; - // Ĩ → i \u0307 \u0303; + // I \u0328 (Į) } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0328 \u0307; + // I \u0300 (Ì) → i \u0307 \u0300; + // I \u0301 (Í) → i \u0307 \u0301; + // I \u0303 (Ĩ) → i \u0307 \u0303; // ::Any-Lower(); // ::NFC(); @@ -445,9 +633,16 @@ func ltLower(c *context) bool { return i == maxIgnorable } +// ltLowerSpan would be the same as isLower. + func ltUpper(f mapFunc) mapFunc { return func(c *context) bool { + // Unicode: + // 0307; 0307; ; ; lt After_Soft_Dotted; # COMBINING DOT ABOVE + // // From CLDR: + // # Remove \u0307 following soft-dotteds (i, j, and the like), with possible + // # intervening non-230 marks. // ::NFD(); // [:Soft_Dotted:] [^[:ccc=Not_Reordered:][:ccc=Above:]]* { \u0307 → ; // ::Any-Upper(); @@ -511,6 +706,8 @@ func ltUpper(f mapFunc) mapFunc { } } +// TODO: implement ltUpperSpan (low priority: complex and infrequent). + func aztrUpper(f mapFunc) mapFunc { return func(c *context) bool { // i→İ; @@ -571,6 +768,8 @@ Loop: return c.writeString("ı") && c.writeBytes(c.src[start:c.pSrc+c.sz]) && done } +// aztrLowerSpan would be the same as isLower. + func nlTitle(c *context) bool { // From CLDR: // # Special titlecasing for Dutch initial "ij". @@ -591,6 +790,24 @@ func nlTitle(c *context) bool { return true } +func nlTitleSpan(c *context) bool { + // From CLDR: + // # Special titlecasing for Dutch initial "ij". + // ::Any-Title(); + // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) + // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; + if c.src[c.pSrc] != 'I' { + return isTitle(c) + } + if !c.next() || c.src[c.pSrc] == 'j' { + return false + } + if c.src[c.pSrc] != 'J' { + c.unreadRune() + } + return true +} + // Not part of CLDR, but see http://unicode.org/cldr/trac/ticket/7078. func afnlRewrite(c *context) { if c.hasPrefix("'") || c.hasPrefix("’") { diff --git a/vendor/golang.org/x/text/cases/tables.go b/vendor/golang.org/x/text/cases/tables.go index 4257e57..e6e95a6 100644 --- a/vendor/golang.org/x/text/cases/tables.go +++ b/vendor/golang.org/x/text/cases/tables.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package cases @@ -216,7 +216,7 @@ func (t *caseTrie) lookupStringUnsafe(s string) uint16 { return 0 } -// caseTrie. Total size: 11750 bytes (11.47 KiB). Checksum: 9ec26581a3006e0d. +// caseTrie. Total size: 11742 bytes (11.47 KiB). Checksum: 147a11466b427436. type caseTrie struct{} func newCaseTrie(i int) *caseTrie { @@ -238,10 +238,10 @@ func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { // The third block is the zero block. var caseValues = [1280]uint16{ // Block 0x0, offset 0x0 - 0x27: 0x0014, - 0x2e: 0x0014, + 0x27: 0x0054, + 0x2e: 0x0054, 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, - 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0014, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, // Block 0x1, offset 0x40 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, @@ -316,7 +316,7 @@ var caseValues = [1280]uint16{ 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, // Block 0x8, offset 0x200 0x204: 0x0004, 0x205: 0x0004, - 0x206: 0x2a13, 0x207: 0x0014, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x1e2a, 0x211: 0x2013, 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, @@ -571,10 +571,10 @@ var caseIndex = [1600]uint16{ } // sparseOffsets: 272 entries, 544 bytes -var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x3a, 0x3d, 0x41, 0x44, 0x48, 0x52, 0x54, 0x59, 0x69, 0x70, 0x75, 0x83, 0x84, 0x92, 0xa1, 0xab, 0xae, 0xb4, 0xbc, 0xbe, 0xc0, 0xce, 0xd4, 0xe2, 0xed, 0xf8, 0x103, 0x10f, 0x119, 0x124, 0x12f, 0x13b, 0x147, 0x14f, 0x157, 0x161, 0x16c, 0x178, 0x17e, 0x189, 0x18e, 0x196, 0x199, 0x19e, 0x1a2, 0x1a6, 0x1ad, 0x1b6, 0x1be, 0x1bf, 0x1c8, 0x1cf, 0x1d7, 0x1dd, 0x1e3, 0x1e8, 0x1ec, 0x1ef, 0x1f1, 0x1f4, 0x1f9, 0x1fa, 0x1fc, 0x1fe, 0x200, 0x207, 0x20c, 0x210, 0x219, 0x21c, 0x21f, 0x225, 0x226, 0x231, 0x232, 0x233, 0x238, 0x245, 0x24d, 0x255, 0x25e, 0x267, 0x270, 0x275, 0x278, 0x281, 0x28e, 0x290, 0x297, 0x299, 0x2a4, 0x2a5, 0x2b0, 0x2b8, 0x2c2, 0x2c8, 0x2c9, 0x2d7, 0x2dc, 0x2df, 0x2e4, 0x2e8, 0x2ee, 0x2f3, 0x2f6, 0x2fb, 0x300, 0x301, 0x307, 0x309, 0x30a, 0x30c, 0x30e, 0x311, 0x312, 0x314, 0x317, 0x31d, 0x321, 0x323, 0x329, 0x330, 0x334, 0x33d, 0x33e, 0x346, 0x34a, 0x34f, 0x357, 0x35d, 0x363, 0x36d, 0x372, 0x37b, 0x381, 0x388, 0x38c, 0x394, 0x396, 0x398, 0x39b, 0x39d, 0x39f, 0x3a0, 0x3a1, 0x3a3, 0x3a5, 0x3ab, 0x3b0, 0x3b2, 0x3b8, 0x3bb, 0x3bd, 0x3c3, 0x3c8, 0x3ca, 0x3cb, 0x3cc, 0x3cd, 0x3cf, 0x3d1, 0x3d3, 0x3d6, 0x3d8, 0x3db, 0x3e3, 0x3e6, 0x3ea, 0x3f2, 0x3f4, 0x3f5, 0x3f6, 0x3f8, 0x3fe, 0x400, 0x401, 0x403, 0x405, 0x407, 0x414, 0x415, 0x416, 0x41a, 0x41c, 0x41d, 0x41e, 0x41f, 0x420, 0x424, 0x428, 0x42e, 0x430, 0x437, 0x43a, 0x43e, 0x444, 0x44d, 0x453, 0x459, 0x463, 0x46d, 0x46f, 0x476, 0x47c, 0x482, 0x488, 0x48b, 0x491, 0x494, 0x49c, 0x49d, 0x4a4, 0x4a5, 0x4a8, 0x4a9, 0x4af, 0x4b2, 0x4ba, 0x4bb, 0x4bc, 0x4bd, 0x4be, 0x4c0, 0x4c2, 0x4c4, 0x4c8, 0x4c9, 0x4cb, 0x4cc, 0x4cd, 0x4cf, 0x4d4, 0x4d9, 0x4dd, 0x4de, 0x4e1, 0x4e5, 0x4f0, 0x4f4, 0x4fc, 0x501, 0x505, 0x508, 0x50c, 0x50f, 0x512, 0x517, 0x51b, 0x51f, 0x523, 0x527, 0x529, 0x52b, 0x52e, 0x533, 0x535, 0x53a, 0x543, 0x548, 0x549, 0x54c, 0x54d, 0x54e, 0x550, 0x551, 0x552} +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x3a, 0x3d, 0x41, 0x44, 0x48, 0x52, 0x54, 0x59, 0x69, 0x70, 0x75, 0x83, 0x84, 0x92, 0xa1, 0xab, 0xae, 0xb4, 0xbc, 0xbe, 0xc0, 0xce, 0xd4, 0xe2, 0xed, 0xf8, 0x103, 0x10f, 0x119, 0x124, 0x12f, 0x13b, 0x147, 0x14f, 0x157, 0x161, 0x16c, 0x178, 0x17e, 0x189, 0x18e, 0x196, 0x199, 0x19e, 0x1a2, 0x1a6, 0x1ad, 0x1b6, 0x1be, 0x1bf, 0x1c8, 0x1cf, 0x1d7, 0x1dd, 0x1e3, 0x1e8, 0x1ec, 0x1ef, 0x1f1, 0x1f4, 0x1f9, 0x1fa, 0x1fc, 0x1fe, 0x200, 0x207, 0x20c, 0x210, 0x219, 0x21c, 0x21f, 0x225, 0x226, 0x231, 0x232, 0x233, 0x238, 0x245, 0x24d, 0x255, 0x25e, 0x267, 0x270, 0x275, 0x278, 0x281, 0x28e, 0x290, 0x297, 0x299, 0x2a4, 0x2a5, 0x2b0, 0x2b8, 0x2c0, 0x2c6, 0x2c7, 0x2d5, 0x2da, 0x2dd, 0x2e2, 0x2e6, 0x2ec, 0x2f1, 0x2f4, 0x2f9, 0x2fe, 0x2ff, 0x305, 0x307, 0x308, 0x30a, 0x30c, 0x30f, 0x310, 0x312, 0x315, 0x31b, 0x31f, 0x321, 0x327, 0x32e, 0x332, 0x33b, 0x33c, 0x344, 0x348, 0x34d, 0x355, 0x35b, 0x361, 0x36b, 0x370, 0x379, 0x37f, 0x386, 0x38a, 0x392, 0x394, 0x396, 0x399, 0x39b, 0x39d, 0x39e, 0x39f, 0x3a1, 0x3a3, 0x3a9, 0x3ae, 0x3b0, 0x3b6, 0x3b9, 0x3bb, 0x3c1, 0x3c6, 0x3c8, 0x3c9, 0x3ca, 0x3cb, 0x3cd, 0x3cf, 0x3d1, 0x3d4, 0x3d6, 0x3d9, 0x3e1, 0x3e4, 0x3e8, 0x3f0, 0x3f2, 0x3f3, 0x3f4, 0x3f6, 0x3fc, 0x3fe, 0x3ff, 0x401, 0x403, 0x405, 0x412, 0x413, 0x414, 0x418, 0x41a, 0x41b, 0x41c, 0x41d, 0x41e, 0x422, 0x426, 0x42c, 0x42e, 0x435, 0x438, 0x43c, 0x442, 0x44b, 0x451, 0x457, 0x461, 0x46b, 0x46d, 0x474, 0x47a, 0x480, 0x486, 0x489, 0x48f, 0x492, 0x49a, 0x49b, 0x4a2, 0x4a3, 0x4a6, 0x4a7, 0x4ad, 0x4b0, 0x4b8, 0x4b9, 0x4ba, 0x4bb, 0x4bc, 0x4be, 0x4c0, 0x4c2, 0x4c6, 0x4c7, 0x4c9, 0x4ca, 0x4cb, 0x4cd, 0x4d2, 0x4d7, 0x4db, 0x4dc, 0x4df, 0x4e3, 0x4ee, 0x4f2, 0x4fa, 0x4ff, 0x503, 0x506, 0x50a, 0x50d, 0x510, 0x515, 0x519, 0x51d, 0x521, 0x525, 0x527, 0x529, 0x52c, 0x531, 0x533, 0x538, 0x541, 0x546, 0x547, 0x54a, 0x54b, 0x54c, 0x54e, 0x54f, 0x550} -// sparseValues: 1362 entries, 5448 bytes -var sparseValues = [1362]valueRange{ +// sparseValues: 1360 entries, 5440 bytes +var sparseValues = [1360]valueRange{ // Block 0x0, offset 0x0 {value: 0x0004, lo: 0xa8, hi: 0xa8}, {value: 0x0012, lo: 0xaa, hi: 0xaa}, @@ -582,7 +582,7 @@ var sparseValues = [1362]valueRange{ {value: 0x0004, lo: 0xaf, hi: 0xaf}, {value: 0x0004, lo: 0xb4, hi: 0xb4}, {value: 0x002a, lo: 0xb5, hi: 0xb5}, - {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, {value: 0x0004, lo: 0xb8, hi: 0xb8}, {value: 0x0012, lo: 0xba, hi: 0xba}, // Block 0x1, offset 0x9 @@ -631,7 +631,7 @@ var sparseValues = [1362]valueRange{ {value: 0x0004, lo: 0x82, hi: 0x85}, {value: 0x0014, lo: 0x86, hi: 0x91}, {value: 0x0004, lo: 0x92, hi: 0x96}, - {value: 0x0014, lo: 0x97, hi: 0x97}, + {value: 0x0054, lo: 0x97, hi: 0x97}, {value: 0x0004, lo: 0x98, hi: 0x9f}, {value: 0x0015, lo: 0xa0, hi: 0xa4}, {value: 0x0004, lo: 0xa5, hi: 0xab}, @@ -701,7 +701,7 @@ var sparseValues = [1362]valueRange{ {value: 0x0034, lo: 0x87, hi: 0x87}, {value: 0x0010, lo: 0x90, hi: 0xaa}, {value: 0x0010, lo: 0xb0, hi: 0xb3}, - {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, // Block 0xf, offset 0x70 {value: 0x0014, lo: 0x80, hi: 0x85}, {value: 0x0024, lo: 0x90, hi: 0x97}, @@ -1372,25 +1372,23 @@ var sparseValues = [1362]valueRange{ {value: 0x0813, lo: 0xb8, hi: 0xbf}, // Block 0x63, offset 0x2b8 {value: 0x0004, lo: 0x8b, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0004, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x8e, hi: 0x8f}, - {value: 0x0014, lo: 0x98, hi: 0x99}, - {value: 0x0014, lo: 0xa4, hi: 0xa4}, - {value: 0x0014, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, {value: 0x0014, lo: 0xaa, hi: 0xae}, {value: 0x0010, lo: 0xaf, hi: 0xaf}, {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x64, offset 0x2c2 + // Block 0x64, offset 0x2c0 {value: 0x0010, lo: 0x80, hi: 0x80}, {value: 0x0010, lo: 0x94, hi: 0x94}, {value: 0x0014, lo: 0xa0, hi: 0xa4}, {value: 0x0014, lo: 0xa6, hi: 0xaf}, {value: 0x0015, lo: 0xb1, hi: 0xb1}, {value: 0x0015, lo: 0xbf, hi: 0xbf}, - // Block 0x65, offset 0x2c8 + // Block 0x65, offset 0x2c6 {value: 0x0015, lo: 0x90, hi: 0x9c}, - // Block 0x66, offset 0x2c9 + // Block 0x66, offset 0x2c7 {value: 0x0024, lo: 0x90, hi: 0x91}, {value: 0x0034, lo: 0x92, hi: 0x93}, {value: 0x0024, lo: 0x94, hi: 0x97}, @@ -1405,112 +1403,112 @@ var sparseValues = [1362]valueRange{ {value: 0x0024, lo: 0xa9, hi: 0xa9}, {value: 0x0034, lo: 0xaa, hi: 0xaf}, {value: 0x0024, lo: 0xb0, hi: 0xb0}, - // Block 0x67, offset 0x2d7 + // Block 0x67, offset 0x2d5 {value: 0x0016, lo: 0x85, hi: 0x86}, {value: 0x0012, lo: 0x87, hi: 0x89}, {value: 0x9d52, lo: 0x8e, hi: 0x8e}, {value: 0x1013, lo: 0xa0, hi: 0xaf}, {value: 0x1012, lo: 0xb0, hi: 0xbf}, - // Block 0x68, offset 0x2dc + // Block 0x68, offset 0x2da {value: 0x0010, lo: 0x80, hi: 0x82}, {value: 0x0716, lo: 0x83, hi: 0x84}, {value: 0x0010, lo: 0x85, hi: 0x88}, - // Block 0x69, offset 0x2df + // Block 0x69, offset 0x2dd {value: 0xa053, lo: 0xb6, hi: 0xb7}, {value: 0xa353, lo: 0xb8, hi: 0xb9}, {value: 0xa653, lo: 0xba, hi: 0xbb}, {value: 0xa353, lo: 0xbc, hi: 0xbd}, {value: 0xa053, lo: 0xbe, hi: 0xbf}, - // Block 0x6a, offset 0x2e4 + // Block 0x6a, offset 0x2e2 {value: 0x3013, lo: 0x80, hi: 0x8f}, {value: 0x6553, lo: 0x90, hi: 0x9f}, {value: 0xa953, lo: 0xa0, hi: 0xae}, {value: 0x3012, lo: 0xb0, hi: 0xbf}, - // Block 0x6b, offset 0x2e8 + // Block 0x6b, offset 0x2e6 {value: 0x0117, lo: 0x80, hi: 0xa3}, {value: 0x0012, lo: 0xa4, hi: 0xa4}, {value: 0x0716, lo: 0xab, hi: 0xac}, {value: 0x0316, lo: 0xad, hi: 0xae}, {value: 0x0024, lo: 0xaf, hi: 0xb1}, {value: 0x0117, lo: 0xb2, hi: 0xb3}, - // Block 0x6c, offset 0x2ee + // Block 0x6c, offset 0x2ec {value: 0x6c52, lo: 0x80, hi: 0x9f}, {value: 0x7052, lo: 0xa0, hi: 0xa5}, {value: 0x7052, lo: 0xa7, hi: 0xa7}, {value: 0x7052, lo: 0xad, hi: 0xad}, {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x6d, offset 0x2f3 + // Block 0x6d, offset 0x2f1 {value: 0x0010, lo: 0x80, hi: 0xa7}, {value: 0x0014, lo: 0xaf, hi: 0xaf}, {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x6e, offset 0x2f6 + // Block 0x6e, offset 0x2f4 {value: 0x0010, lo: 0x80, hi: 0x96}, {value: 0x0010, lo: 0xa0, hi: 0xa6}, {value: 0x0010, lo: 0xa8, hi: 0xae}, {value: 0x0010, lo: 0xb0, hi: 0xb6}, {value: 0x0010, lo: 0xb8, hi: 0xbe}, - // Block 0x6f, offset 0x2fb + // Block 0x6f, offset 0x2f9 {value: 0x0010, lo: 0x80, hi: 0x86}, {value: 0x0010, lo: 0x88, hi: 0x8e}, {value: 0x0010, lo: 0x90, hi: 0x96}, {value: 0x0010, lo: 0x98, hi: 0x9e}, {value: 0x0024, lo: 0xa0, hi: 0xbf}, - // Block 0x70, offset 0x300 + // Block 0x70, offset 0x2fe {value: 0x0014, lo: 0xaf, hi: 0xaf}, - // Block 0x71, offset 0x301 + // Block 0x71, offset 0x2ff {value: 0x0014, lo: 0x85, hi: 0x85}, {value: 0x0034, lo: 0xaa, hi: 0xad}, {value: 0x0030, lo: 0xae, hi: 0xaf}, {value: 0x0004, lo: 0xb1, hi: 0xb5}, {value: 0x0014, lo: 0xbb, hi: 0xbb}, {value: 0x0010, lo: 0xbc, hi: 0xbc}, - // Block 0x72, offset 0x307 + // Block 0x72, offset 0x305 {value: 0x0034, lo: 0x99, hi: 0x9a}, {value: 0x0004, lo: 0x9b, hi: 0x9e}, - // Block 0x73, offset 0x309 + // Block 0x73, offset 0x307 {value: 0x0004, lo: 0xbc, hi: 0xbe}, - // Block 0x74, offset 0x30a + // Block 0x74, offset 0x308 {value: 0x0010, lo: 0x85, hi: 0xad}, {value: 0x0010, lo: 0xb1, hi: 0xbf}, - // Block 0x75, offset 0x30c + // Block 0x75, offset 0x30a {value: 0x0010, lo: 0x80, hi: 0x8e}, {value: 0x0010, lo: 0xa0, hi: 0xba}, - // Block 0x76, offset 0x30e + // Block 0x76, offset 0x30c {value: 0x0010, lo: 0x80, hi: 0x94}, {value: 0x0014, lo: 0x95, hi: 0x95}, {value: 0x0010, lo: 0x96, hi: 0xbf}, - // Block 0x77, offset 0x311 + // Block 0x77, offset 0x30f {value: 0x0010, lo: 0x80, hi: 0x8c}, - // Block 0x78, offset 0x312 + // Block 0x78, offset 0x310 {value: 0x0010, lo: 0x90, hi: 0xb7}, {value: 0x0014, lo: 0xb8, hi: 0xbd}, - // Block 0x79, offset 0x314 + // Block 0x79, offset 0x312 {value: 0x0010, lo: 0x80, hi: 0x8b}, {value: 0x0014, lo: 0x8c, hi: 0x8c}, {value: 0x0010, lo: 0x90, hi: 0xab}, - // Block 0x7a, offset 0x317 + // Block 0x7a, offset 0x315 {value: 0x0117, lo: 0x80, hi: 0xad}, {value: 0x0010, lo: 0xae, hi: 0xae}, {value: 0x0024, lo: 0xaf, hi: 0xaf}, {value: 0x0014, lo: 0xb0, hi: 0xb2}, {value: 0x0024, lo: 0xb4, hi: 0xbd}, {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x7b, offset 0x31d + // Block 0x7b, offset 0x31b {value: 0x0117, lo: 0x80, hi: 0x9b}, {value: 0x0015, lo: 0x9c, hi: 0x9d}, {value: 0x0024, lo: 0x9e, hi: 0x9f}, {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x7c, offset 0x321 + // Block 0x7c, offset 0x31f {value: 0x0010, lo: 0x80, hi: 0xaf}, {value: 0x0024, lo: 0xb0, hi: 0xb1}, - // Block 0x7d, offset 0x323 + // Block 0x7d, offset 0x321 {value: 0x0004, lo: 0x80, hi: 0x96}, {value: 0x0014, lo: 0x97, hi: 0x9f}, {value: 0x0004, lo: 0xa0, hi: 0xa1}, {value: 0x0117, lo: 0xa2, hi: 0xaf}, {value: 0x0012, lo: 0xb0, hi: 0xb1}, {value: 0x0117, lo: 0xb2, hi: 0xbf}, - // Block 0x7e, offset 0x329 + // Block 0x7e, offset 0x327 {value: 0x0117, lo: 0x80, hi: 0xaf}, {value: 0x0015, lo: 0xb0, hi: 0xb0}, {value: 0x0012, lo: 0xb1, hi: 0xb8}, @@ -1518,12 +1516,12 @@ var sparseValues = [1362]valueRange{ {value: 0x0716, lo: 0xbb, hi: 0xbc}, {value: 0x8453, lo: 0xbd, hi: 0xbd}, {value: 0x0117, lo: 0xbe, hi: 0xbf}, - // Block 0x7f, offset 0x330 + // Block 0x7f, offset 0x32e {value: 0x0010, lo: 0xb7, hi: 0xb7}, {value: 0x0015, lo: 0xb8, hi: 0xb9}, {value: 0x0012, lo: 0xba, hi: 0xba}, {value: 0x0010, lo: 0xbb, hi: 0xbf}, - // Block 0x80, offset 0x334 + // Block 0x80, offset 0x332 {value: 0x0010, lo: 0x80, hi: 0x81}, {value: 0x0014, lo: 0x82, hi: 0x82}, {value: 0x0010, lo: 0x83, hi: 0x85}, @@ -1533,9 +1531,9 @@ var sparseValues = [1362]valueRange{ {value: 0x0010, lo: 0x8c, hi: 0xa4}, {value: 0x0014, lo: 0xa5, hi: 0xa6}, {value: 0x0010, lo: 0xa7, hi: 0xa7}, - // Block 0x81, offset 0x33d + // Block 0x81, offset 0x33b {value: 0x0010, lo: 0x80, hi: 0xb3}, - // Block 0x82, offset 0x33e + // Block 0x82, offset 0x33c {value: 0x0010, lo: 0x80, hi: 0x83}, {value: 0x0034, lo: 0x84, hi: 0x84}, {value: 0x0014, lo: 0x85, hi: 0x85}, @@ -1544,18 +1542,18 @@ var sparseValues = [1362]valueRange{ {value: 0x0010, lo: 0xb2, hi: 0xb7}, {value: 0x0010, lo: 0xbb, hi: 0xbb}, {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x83, offset 0x346 + // Block 0x83, offset 0x344 {value: 0x0010, lo: 0x80, hi: 0xa5}, {value: 0x0014, lo: 0xa6, hi: 0xaa}, {value: 0x0034, lo: 0xab, hi: 0xad}, {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x84, offset 0x34a + // Block 0x84, offset 0x348 {value: 0x0010, lo: 0x80, hi: 0x86}, {value: 0x0014, lo: 0x87, hi: 0x91}, {value: 0x0010, lo: 0x92, hi: 0x92}, {value: 0x0030, lo: 0x93, hi: 0x93}, {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0x85, offset 0x34f + // Block 0x85, offset 0x34d {value: 0x0014, lo: 0x80, hi: 0x82}, {value: 0x0010, lo: 0x83, hi: 0xb2}, {value: 0x0034, lo: 0xb3, hi: 0xb3}, @@ -1564,21 +1562,21 @@ var sparseValues = [1362]valueRange{ {value: 0x0010, lo: 0xba, hi: 0xbb}, {value: 0x0014, lo: 0xbc, hi: 0xbc}, {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x86, offset 0x357 + // Block 0x86, offset 0x355 {value: 0x0030, lo: 0x80, hi: 0x80}, {value: 0x0014, lo: 0x8f, hi: 0x8f}, {value: 0x0010, lo: 0x90, hi: 0x99}, {value: 0x0014, lo: 0xa5, hi: 0xa5}, {value: 0x0004, lo: 0xa6, hi: 0xa6}, {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x87, offset 0x35d + // Block 0x87, offset 0x35b {value: 0x0010, lo: 0x80, hi: 0xa8}, {value: 0x0014, lo: 0xa9, hi: 0xae}, {value: 0x0010, lo: 0xaf, hi: 0xb0}, {value: 0x0014, lo: 0xb1, hi: 0xb2}, {value: 0x0010, lo: 0xb3, hi: 0xb4}, {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0x88, offset 0x363 + // Block 0x88, offset 0x361 {value: 0x0010, lo: 0x80, hi: 0x82}, {value: 0x0014, lo: 0x83, hi: 0x83}, {value: 0x0010, lo: 0x84, hi: 0x8b}, @@ -1589,13 +1587,13 @@ var sparseValues = [1362]valueRange{ {value: 0x0010, lo: 0xbb, hi: 0xbb}, {value: 0x0014, lo: 0xbc, hi: 0xbc}, {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x89, offset 0x36d + // Block 0x89, offset 0x36b {value: 0x0024, lo: 0xb0, hi: 0xb0}, {value: 0x0024, lo: 0xb2, hi: 0xb3}, {value: 0x0034, lo: 0xb4, hi: 0xb4}, {value: 0x0024, lo: 0xb7, hi: 0xb8}, {value: 0x0024, lo: 0xbe, hi: 0xbf}, - // Block 0x8a, offset 0x372 + // Block 0x8a, offset 0x370 {value: 0x0024, lo: 0x81, hi: 0x81}, {value: 0x0004, lo: 0x9d, hi: 0x9d}, {value: 0x0010, lo: 0xa0, hi: 0xab}, @@ -1605,14 +1603,14 @@ var sparseValues = [1362]valueRange{ {value: 0x0014, lo: 0xb3, hi: 0xb4}, {value: 0x0010, lo: 0xb5, hi: 0xb5}, {value: 0x0034, lo: 0xb6, hi: 0xb6}, - // Block 0x8b, offset 0x37b + // Block 0x8b, offset 0x379 {value: 0x0010, lo: 0x81, hi: 0x86}, {value: 0x0010, lo: 0x89, hi: 0x8e}, {value: 0x0010, lo: 0x91, hi: 0x96}, {value: 0x0010, lo: 0xa0, hi: 0xa6}, {value: 0x0010, lo: 0xa8, hi: 0xae}, {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0x8c, offset 0x381 + // Block 0x8c, offset 0x37f {value: 0x0012, lo: 0x80, hi: 0x92}, {value: 0xac52, lo: 0x93, hi: 0x93}, {value: 0x0012, lo: 0x94, hi: 0x9a}, @@ -1620,12 +1618,12 @@ var sparseValues = [1362]valueRange{ {value: 0x0015, lo: 0x9c, hi: 0x9f}, {value: 0x0012, lo: 0xa0, hi: 0xa5}, {value: 0x74d2, lo: 0xb0, hi: 0xbf}, - // Block 0x8d, offset 0x388 + // Block 0x8d, offset 0x386 {value: 0x78d2, lo: 0x80, hi: 0x8f}, {value: 0x7cd2, lo: 0x90, hi: 0x9f}, {value: 0x80d2, lo: 0xa0, hi: 0xaf}, {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, - // Block 0x8e, offset 0x38c + // Block 0x8e, offset 0x38a {value: 0x0010, lo: 0x80, hi: 0xa4}, {value: 0x0014, lo: 0xa5, hi: 0xa5}, {value: 0x0010, lo: 0xa6, hi: 0xa7}, @@ -1634,105 +1632,105 @@ var sparseValues = [1362]valueRange{ {value: 0x0010, lo: 0xac, hi: 0xac}, {value: 0x0034, lo: 0xad, hi: 0xad}, {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x8f, offset 0x394 + // Block 0x8f, offset 0x392 {value: 0x0010, lo: 0x80, hi: 0xa3}, {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x90, offset 0x396 + // Block 0x90, offset 0x394 {value: 0x0010, lo: 0x80, hi: 0x86}, {value: 0x0010, lo: 0x8b, hi: 0xbb}, - // Block 0x91, offset 0x398 + // Block 0x91, offset 0x396 {value: 0x0010, lo: 0x80, hi: 0x81}, {value: 0x0010, lo: 0x83, hi: 0x84}, {value: 0x0010, lo: 0x86, hi: 0xbf}, - // Block 0x92, offset 0x39b + // Block 0x92, offset 0x399 {value: 0x0010, lo: 0x80, hi: 0xb1}, {value: 0x0004, lo: 0xb2, hi: 0xbf}, - // Block 0x93, offset 0x39d + // Block 0x93, offset 0x39b {value: 0x0004, lo: 0x80, hi: 0x81}, {value: 0x0010, lo: 0x93, hi: 0xbf}, - // Block 0x94, offset 0x39f + // Block 0x94, offset 0x39d {value: 0x0010, lo: 0x80, hi: 0xbd}, - // Block 0x95, offset 0x3a0 + // Block 0x95, offset 0x39e {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0x96, offset 0x3a1 + // Block 0x96, offset 0x39f {value: 0x0010, lo: 0x80, hi: 0x8f}, {value: 0x0010, lo: 0x92, hi: 0xbf}, - // Block 0x97, offset 0x3a3 + // Block 0x97, offset 0x3a1 {value: 0x0010, lo: 0x80, hi: 0x87}, {value: 0x0010, lo: 0xb0, hi: 0xbb}, - // Block 0x98, offset 0x3a5 + // Block 0x98, offset 0x3a3 {value: 0x0014, lo: 0x80, hi: 0x8f}, - {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0054, lo: 0x93, hi: 0x93}, {value: 0x0024, lo: 0xa0, hi: 0xa6}, {value: 0x0034, lo: 0xa7, hi: 0xad}, {value: 0x0024, lo: 0xae, hi: 0xaf}, {value: 0x0010, lo: 0xb3, hi: 0xb4}, - // Block 0x99, offset 0x3ab + // Block 0x99, offset 0x3a9 {value: 0x0010, lo: 0x8d, hi: 0x8f}, - {value: 0x0014, lo: 0x92, hi: 0x92}, - {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, {value: 0x0010, lo: 0xb0, hi: 0xb4}, {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0x9a, offset 0x3b0 + // Block 0x9a, offset 0x3ae {value: 0x0010, lo: 0x80, hi: 0xbc}, {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x9b, offset 0x3b2 - {value: 0x0014, lo: 0x87, hi: 0x87}, - {value: 0x0014, lo: 0x8e, hi: 0x8e}, - {value: 0x0014, lo: 0x9a, hi: 0x9a}, + // Block 0x9b, offset 0x3b0 + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, {value: 0x5f53, lo: 0xa1, hi: 0xba}, {value: 0x0004, lo: 0xbe, hi: 0xbe}, {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x9c, offset 0x3b8 + // Block 0x9c, offset 0x3b6 {value: 0x0004, lo: 0x80, hi: 0x80}, {value: 0x5f52, lo: 0x81, hi: 0x9a}, {value: 0x0004, lo: 0xb0, hi: 0xb0}, - // Block 0x9d, offset 0x3bb + // Block 0x9d, offset 0x3b9 {value: 0x0014, lo: 0x9e, hi: 0x9f}, {value: 0x0010, lo: 0xa0, hi: 0xbe}, - // Block 0x9e, offset 0x3bd + // Block 0x9e, offset 0x3bb {value: 0x0010, lo: 0x82, hi: 0x87}, {value: 0x0010, lo: 0x8a, hi: 0x8f}, {value: 0x0010, lo: 0x92, hi: 0x97}, {value: 0x0010, lo: 0x9a, hi: 0x9c}, {value: 0x0004, lo: 0xa3, hi: 0xa3}, {value: 0x0014, lo: 0xb9, hi: 0xbb}, - // Block 0x9f, offset 0x3c3 + // Block 0x9f, offset 0x3c1 {value: 0x0010, lo: 0x80, hi: 0x8b}, {value: 0x0010, lo: 0x8d, hi: 0xa6}, {value: 0x0010, lo: 0xa8, hi: 0xba}, {value: 0x0010, lo: 0xbc, hi: 0xbd}, {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xa0, offset 0x3c8 + // Block 0xa0, offset 0x3c6 {value: 0x0010, lo: 0x80, hi: 0x8d}, {value: 0x0010, lo: 0x90, hi: 0x9d}, - // Block 0xa1, offset 0x3ca + // Block 0xa1, offset 0x3c8 {value: 0x0010, lo: 0x80, hi: 0xba}, - // Block 0xa2, offset 0x3cb + // Block 0xa2, offset 0x3c9 {value: 0x0010, lo: 0x80, hi: 0xb4}, - // Block 0xa3, offset 0x3cc + // Block 0xa3, offset 0x3ca {value: 0x0034, lo: 0xbd, hi: 0xbd}, - // Block 0xa4, offset 0x3cd + // Block 0xa4, offset 0x3cb {value: 0x0010, lo: 0x80, hi: 0x9c}, {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa5, offset 0x3cf + // Block 0xa5, offset 0x3cd {value: 0x0010, lo: 0x80, hi: 0x90}, {value: 0x0034, lo: 0xa0, hi: 0xa0}, - // Block 0xa6, offset 0x3d1 + // Block 0xa6, offset 0x3cf {value: 0x0010, lo: 0x80, hi: 0x9f}, {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xa7, offset 0x3d3 + // Block 0xa7, offset 0x3d1 {value: 0x0010, lo: 0x80, hi: 0x8a}, {value: 0x0010, lo: 0x90, hi: 0xb5}, {value: 0x0024, lo: 0xb6, hi: 0xba}, - // Block 0xa8, offset 0x3d6 + // Block 0xa8, offset 0x3d4 {value: 0x0010, lo: 0x80, hi: 0x9d}, {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa9, offset 0x3d8 + // Block 0xa9, offset 0x3d6 {value: 0x0010, lo: 0x80, hi: 0x83}, {value: 0x0010, lo: 0x88, hi: 0x8f}, {value: 0x0010, lo: 0x91, hi: 0x95}, - // Block 0xaa, offset 0x3db + // Block 0xaa, offset 0x3d9 {value: 0x2813, lo: 0x80, hi: 0x87}, {value: 0x3813, lo: 0x88, hi: 0x8f}, {value: 0x2813, lo: 0x90, hi: 0x97}, @@ -1741,16 +1739,16 @@ var sparseValues = [1362]valueRange{ {value: 0x2812, lo: 0xa8, hi: 0xaf}, {value: 0x3812, lo: 0xb0, hi: 0xb7}, {value: 0x2812, lo: 0xb8, hi: 0xbf}, - // Block 0xab, offset 0x3e3 + // Block 0xab, offset 0x3e1 {value: 0xaf52, lo: 0x80, hi: 0x87}, {value: 0xb252, lo: 0x88, hi: 0x8f}, {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0xac, offset 0x3e6 + // Block 0xac, offset 0x3e4 {value: 0x0010, lo: 0x80, hi: 0x9d}, {value: 0x0010, lo: 0xa0, hi: 0xa9}, {value: 0xb253, lo: 0xb0, hi: 0xb7}, {value: 0xaf53, lo: 0xb8, hi: 0xbf}, - // Block 0xad, offset 0x3ea + // Block 0xad, offset 0x3e8 {value: 0x2813, lo: 0x80, hi: 0x87}, {value: 0x3813, lo: 0x88, hi: 0x8f}, {value: 0x2813, lo: 0x90, hi: 0x93}, @@ -1759,38 +1757,38 @@ var sparseValues = [1362]valueRange{ {value: 0x2812, lo: 0xa8, hi: 0xaf}, {value: 0x3812, lo: 0xb0, hi: 0xb7}, {value: 0x2812, lo: 0xb8, hi: 0xbb}, - // Block 0xae, offset 0x3f2 + // Block 0xae, offset 0x3f0 {value: 0x0010, lo: 0x80, hi: 0xa7}, {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xaf, offset 0x3f4 + // Block 0xaf, offset 0x3f2 {value: 0x0010, lo: 0x80, hi: 0xa3}, - // Block 0xb0, offset 0x3f5 + // Block 0xb0, offset 0x3f3 {value: 0x0010, lo: 0x80, hi: 0xb6}, - // Block 0xb1, offset 0x3f6 + // Block 0xb1, offset 0x3f4 {value: 0x0010, lo: 0x80, hi: 0x95}, {value: 0x0010, lo: 0xa0, hi: 0xa7}, - // Block 0xb2, offset 0x3f8 + // Block 0xb2, offset 0x3f6 {value: 0x0010, lo: 0x80, hi: 0x85}, {value: 0x0010, lo: 0x88, hi: 0x88}, {value: 0x0010, lo: 0x8a, hi: 0xb5}, {value: 0x0010, lo: 0xb7, hi: 0xb8}, {value: 0x0010, lo: 0xbc, hi: 0xbc}, {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xb3, offset 0x3fe + // Block 0xb3, offset 0x3fc {value: 0x0010, lo: 0x80, hi: 0x95}, {value: 0x0010, lo: 0xa0, hi: 0xb6}, - // Block 0xb4, offset 0x400 + // Block 0xb4, offset 0x3fe {value: 0x0010, lo: 0x80, hi: 0x9e}, - // Block 0xb5, offset 0x401 + // Block 0xb5, offset 0x3ff {value: 0x0010, lo: 0xa0, hi: 0xb2}, {value: 0x0010, lo: 0xb4, hi: 0xb5}, - // Block 0xb6, offset 0x403 + // Block 0xb6, offset 0x401 {value: 0x0010, lo: 0x80, hi: 0x95}, {value: 0x0010, lo: 0xa0, hi: 0xb9}, - // Block 0xb7, offset 0x405 + // Block 0xb7, offset 0x403 {value: 0x0010, lo: 0x80, hi: 0xb7}, {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0xb8, offset 0x407 + // Block 0xb8, offset 0x405 {value: 0x0010, lo: 0x80, hi: 0x80}, {value: 0x0014, lo: 0x81, hi: 0x83}, {value: 0x0014, lo: 0x85, hi: 0x86}, @@ -1804,47 +1802,47 @@ var sparseValues = [1362]valueRange{ {value: 0x0024, lo: 0xb8, hi: 0xb8}, {value: 0x0034, lo: 0xb9, hi: 0xba}, {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xb9, offset 0x414 + // Block 0xb9, offset 0x412 {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0xba, offset 0x415 + // Block 0xba, offset 0x413 {value: 0x0010, lo: 0x80, hi: 0x9c}, - // Block 0xbb, offset 0x416 + // Block 0xbb, offset 0x414 {value: 0x0010, lo: 0x80, hi: 0x87}, {value: 0x0010, lo: 0x89, hi: 0xa4}, {value: 0x0024, lo: 0xa5, hi: 0xa5}, {value: 0x0034, lo: 0xa6, hi: 0xa6}, - // Block 0xbc, offset 0x41a + // Block 0xbc, offset 0x418 {value: 0x0010, lo: 0x80, hi: 0x95}, {value: 0x0010, lo: 0xa0, hi: 0xb2}, - // Block 0xbd, offset 0x41c + // Block 0xbd, offset 0x41a {value: 0x0010, lo: 0x80, hi: 0x91}, - // Block 0xbe, offset 0x41d + // Block 0xbe, offset 0x41b {value: 0x0010, lo: 0x80, hi: 0x88}, - // Block 0xbf, offset 0x41e + // Block 0xbf, offset 0x41c {value: 0x5653, lo: 0x80, hi: 0xb2}, - // Block 0xc0, offset 0x41f + // Block 0xc0, offset 0x41d {value: 0x5652, lo: 0x80, hi: 0xb2}, - // Block 0xc1, offset 0x420 + // Block 0xc1, offset 0x41e {value: 0x0010, lo: 0x80, hi: 0x80}, {value: 0x0014, lo: 0x81, hi: 0x81}, {value: 0x0010, lo: 0x82, hi: 0xb7}, {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xc2, offset 0x424 + // Block 0xc2, offset 0x422 {value: 0x0014, lo: 0x80, hi: 0x85}, {value: 0x0034, lo: 0x86, hi: 0x86}, {value: 0x0010, lo: 0xa6, hi: 0xaf}, {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xc3, offset 0x428 + // Block 0xc3, offset 0x426 {value: 0x0014, lo: 0x80, hi: 0x81}, {value: 0x0010, lo: 0x82, hi: 0xb2}, {value: 0x0014, lo: 0xb3, hi: 0xb6}, {value: 0x0010, lo: 0xb7, hi: 0xb8}, {value: 0x0034, lo: 0xb9, hi: 0xba}, {value: 0x0014, lo: 0xbd, hi: 0xbd}, - // Block 0xc4, offset 0x42e + // Block 0xc4, offset 0x42c {value: 0x0010, lo: 0x90, hi: 0xa8}, {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xc5, offset 0x430 + // Block 0xc5, offset 0x42e {value: 0x0024, lo: 0x80, hi: 0x82}, {value: 0x0010, lo: 0x83, hi: 0xa6}, {value: 0x0014, lo: 0xa7, hi: 0xab}, @@ -1852,23 +1850,23 @@ var sparseValues = [1362]valueRange{ {value: 0x0014, lo: 0xad, hi: 0xb2}, {value: 0x0034, lo: 0xb3, hi: 0xb4}, {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0xc6, offset 0x437 + // Block 0xc6, offset 0x435 {value: 0x0010, lo: 0x90, hi: 0xb2}, {value: 0x0034, lo: 0xb3, hi: 0xb3}, {value: 0x0010, lo: 0xb6, hi: 0xb6}, - // Block 0xc7, offset 0x43a + // Block 0xc7, offset 0x438 {value: 0x0014, lo: 0x80, hi: 0x81}, {value: 0x0010, lo: 0x82, hi: 0xb5}, {value: 0x0014, lo: 0xb6, hi: 0xbe}, {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xc8, offset 0x43e + // Block 0xc8, offset 0x43c {value: 0x0030, lo: 0x80, hi: 0x80}, {value: 0x0010, lo: 0x81, hi: 0x84}, {value: 0x0034, lo: 0x8a, hi: 0x8a}, {value: 0x0014, lo: 0x8b, hi: 0x8c}, {value: 0x0010, lo: 0x90, hi: 0x9a}, {value: 0x0010, lo: 0x9c, hi: 0x9c}, - // Block 0xc9, offset 0x444 + // Block 0xc9, offset 0x442 {value: 0x0010, lo: 0x80, hi: 0x91}, {value: 0x0010, lo: 0x93, hi: 0xae}, {value: 0x0014, lo: 0xaf, hi: 0xb1}, @@ -1878,21 +1876,21 @@ var sparseValues = [1362]valueRange{ {value: 0x0034, lo: 0xb6, hi: 0xb6}, {value: 0x0014, lo: 0xb7, hi: 0xb7}, {value: 0x0014, lo: 0xbe, hi: 0xbe}, - // Block 0xca, offset 0x44d + // Block 0xca, offset 0x44b {value: 0x0010, lo: 0x80, hi: 0x86}, {value: 0x0010, lo: 0x88, hi: 0x88}, {value: 0x0010, lo: 0x8a, hi: 0x8d}, {value: 0x0010, lo: 0x8f, hi: 0x9d}, {value: 0x0010, lo: 0x9f, hi: 0xa8}, {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xcb, offset 0x453 + // Block 0xcb, offset 0x451 {value: 0x0010, lo: 0x80, hi: 0x9e}, {value: 0x0014, lo: 0x9f, hi: 0x9f}, {value: 0x0010, lo: 0xa0, hi: 0xa2}, {value: 0x0014, lo: 0xa3, hi: 0xa8}, {value: 0x0034, lo: 0xa9, hi: 0xaa}, {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xcc, offset 0x459 + // Block 0xcc, offset 0x457 {value: 0x0014, lo: 0x80, hi: 0x81}, {value: 0x0010, lo: 0x82, hi: 0x83}, {value: 0x0010, lo: 0x85, hi: 0x8c}, @@ -1903,7 +1901,7 @@ var sparseValues = [1362]valueRange{ {value: 0x0010, lo: 0xb5, hi: 0xb9}, {value: 0x0034, lo: 0xbc, hi: 0xbc}, {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0xcd, offset 0x463 + // Block 0xcd, offset 0x461 {value: 0x0014, lo: 0x80, hi: 0x80}, {value: 0x0010, lo: 0x81, hi: 0x84}, {value: 0x0010, lo: 0x87, hi: 0x88}, @@ -1914,10 +1912,10 @@ var sparseValues = [1362]valueRange{ {value: 0x0010, lo: 0x9d, hi: 0xa3}, {value: 0x0024, lo: 0xa6, hi: 0xac}, {value: 0x0024, lo: 0xb0, hi: 0xb4}, - // Block 0xce, offset 0x46d + // Block 0xce, offset 0x46b {value: 0x0010, lo: 0x80, hi: 0xb7}, {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xcf, offset 0x46f + // Block 0xcf, offset 0x46d {value: 0x0010, lo: 0x80, hi: 0x81}, {value: 0x0034, lo: 0x82, hi: 0x82}, {value: 0x0014, lo: 0x83, hi: 0x84}, @@ -1925,43 +1923,43 @@ var sparseValues = [1362]valueRange{ {value: 0x0034, lo: 0x86, hi: 0x86}, {value: 0x0010, lo: 0x87, hi: 0x8a}, {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd0, offset 0x476 + // Block 0xd0, offset 0x474 {value: 0x0010, lo: 0x80, hi: 0xb2}, {value: 0x0014, lo: 0xb3, hi: 0xb8}, {value: 0x0010, lo: 0xb9, hi: 0xb9}, {value: 0x0014, lo: 0xba, hi: 0xba}, {value: 0x0010, lo: 0xbb, hi: 0xbe}, {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0xd1, offset 0x47c + // Block 0xd1, offset 0x47a {value: 0x0014, lo: 0x80, hi: 0x80}, {value: 0x0010, lo: 0x81, hi: 0x81}, {value: 0x0034, lo: 0x82, hi: 0x83}, {value: 0x0010, lo: 0x84, hi: 0x85}, {value: 0x0010, lo: 0x87, hi: 0x87}, {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd2, offset 0x482 + // Block 0xd2, offset 0x480 {value: 0x0010, lo: 0x80, hi: 0xb1}, {value: 0x0014, lo: 0xb2, hi: 0xb5}, {value: 0x0010, lo: 0xb8, hi: 0xbb}, {value: 0x0014, lo: 0xbc, hi: 0xbd}, {value: 0x0010, lo: 0xbe, hi: 0xbe}, {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xd3, offset 0x488 + // Block 0xd3, offset 0x486 {value: 0x0034, lo: 0x80, hi: 0x80}, {value: 0x0010, lo: 0x98, hi: 0x9b}, {value: 0x0014, lo: 0x9c, hi: 0x9d}, - // Block 0xd4, offset 0x48b + // Block 0xd4, offset 0x489 {value: 0x0010, lo: 0x80, hi: 0xb2}, {value: 0x0014, lo: 0xb3, hi: 0xba}, {value: 0x0010, lo: 0xbb, hi: 0xbc}, {value: 0x0014, lo: 0xbd, hi: 0xbd}, {value: 0x0010, lo: 0xbe, hi: 0xbe}, {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xd5, offset 0x491 + // Block 0xd5, offset 0x48f {value: 0x0014, lo: 0x80, hi: 0x80}, {value: 0x0010, lo: 0x84, hi: 0x84}, {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd6, offset 0x494 + // Block 0xd6, offset 0x492 {value: 0x0010, lo: 0x80, hi: 0xaa}, {value: 0x0014, lo: 0xab, hi: 0xab}, {value: 0x0010, lo: 0xac, hi: 0xac}, @@ -1970,9 +1968,9 @@ var sparseValues = [1362]valueRange{ {value: 0x0014, lo: 0xb0, hi: 0xb5}, {value: 0x0030, lo: 0xb6, hi: 0xb6}, {value: 0x0034, lo: 0xb7, hi: 0xb7}, - // Block 0xd7, offset 0x49c + // Block 0xd7, offset 0x49a {value: 0x0010, lo: 0x80, hi: 0x89}, - // Block 0xd8, offset 0x49d + // Block 0xd8, offset 0x49b {value: 0x0014, lo: 0x9d, hi: 0x9f}, {value: 0x0010, lo: 0xa0, hi: 0xa1}, {value: 0x0014, lo: 0xa2, hi: 0xa5}, @@ -1980,26 +1978,26 @@ var sparseValues = [1362]valueRange{ {value: 0x0014, lo: 0xa7, hi: 0xaa}, {value: 0x0034, lo: 0xab, hi: 0xab}, {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xd9, offset 0x4a4 + // Block 0xd9, offset 0x4a2 {value: 0x5f53, lo: 0xa0, hi: 0xbf}, - // Block 0xda, offset 0x4a5 + // Block 0xda, offset 0x4a3 {value: 0x5f52, lo: 0x80, hi: 0x9f}, {value: 0x0010, lo: 0xa0, hi: 0xa9}, {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xdb, offset 0x4a8 + // Block 0xdb, offset 0x4a6 {value: 0x0010, lo: 0x80, hi: 0xb8}, - // Block 0xdc, offset 0x4a9 + // Block 0xdc, offset 0x4a7 {value: 0x0010, lo: 0x80, hi: 0x88}, {value: 0x0010, lo: 0x8a, hi: 0xaf}, {value: 0x0014, lo: 0xb0, hi: 0xb6}, {value: 0x0014, lo: 0xb8, hi: 0xbd}, {value: 0x0010, lo: 0xbe, hi: 0xbe}, {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xdd, offset 0x4af + // Block 0xdd, offset 0x4ad {value: 0x0010, lo: 0x80, hi: 0x80}, {value: 0x0010, lo: 0x90, hi: 0x99}, {value: 0x0010, lo: 0xb2, hi: 0xbf}, - // Block 0xde, offset 0x4b2 + // Block 0xde, offset 0x4b0 {value: 0x0010, lo: 0x80, hi: 0x8f}, {value: 0x0014, lo: 0x92, hi: 0xa7}, {value: 0x0010, lo: 0xa9, hi: 0xa9}, @@ -2008,69 +2006,69 @@ var sparseValues = [1362]valueRange{ {value: 0x0014, lo: 0xb2, hi: 0xb3}, {value: 0x0010, lo: 0xb4, hi: 0xb4}, {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0xdf, offset 0x4ba + // Block 0xdf, offset 0x4b8 {value: 0x0010, lo: 0x80, hi: 0x99}, - // Block 0xe0, offset 0x4bb + // Block 0xe0, offset 0x4b9 {value: 0x0010, lo: 0x80, hi: 0xae}, - // Block 0xe1, offset 0x4bc + // Block 0xe1, offset 0x4ba {value: 0x0010, lo: 0x80, hi: 0x83}, - // Block 0xe2, offset 0x4bd + // Block 0xe2, offset 0x4bb {value: 0x0010, lo: 0x80, hi: 0x86}, - // Block 0xe3, offset 0x4be + // Block 0xe3, offset 0x4bc {value: 0x0010, lo: 0x80, hi: 0x9e}, {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0xe4, offset 0x4c0 + // Block 0xe4, offset 0x4be {value: 0x0010, lo: 0x90, hi: 0xad}, {value: 0x0034, lo: 0xb0, hi: 0xb4}, - // Block 0xe5, offset 0x4c2 + // Block 0xe5, offset 0x4c0 {value: 0x0010, lo: 0x80, hi: 0xaf}, {value: 0x0024, lo: 0xb0, hi: 0xb6}, - // Block 0xe6, offset 0x4c4 + // Block 0xe6, offset 0x4c2 {value: 0x0014, lo: 0x80, hi: 0x83}, {value: 0x0010, lo: 0x90, hi: 0x99}, {value: 0x0010, lo: 0xa3, hi: 0xb7}, {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0xe7, offset 0x4c8 + // Block 0xe7, offset 0x4c6 {value: 0x0010, lo: 0x80, hi: 0x8f}, - // Block 0xe8, offset 0x4c9 + // Block 0xe8, offset 0x4c7 {value: 0x0010, lo: 0x80, hi: 0x84}, {value: 0x0010, lo: 0x90, hi: 0xbe}, - // Block 0xe9, offset 0x4cb + // Block 0xe9, offset 0x4c9 {value: 0x0014, lo: 0x8f, hi: 0x9f}, - // Block 0xea, offset 0x4cc + // Block 0xea, offset 0x4ca {value: 0x0014, lo: 0xa0, hi: 0xa0}, - // Block 0xeb, offset 0x4cd + // Block 0xeb, offset 0x4cb {value: 0x0010, lo: 0x80, hi: 0xaa}, {value: 0x0010, lo: 0xb0, hi: 0xbc}, - // Block 0xec, offset 0x4cf + // Block 0xec, offset 0x4cd {value: 0x0010, lo: 0x80, hi: 0x88}, {value: 0x0010, lo: 0x90, hi: 0x99}, {value: 0x0014, lo: 0x9d, hi: 0x9d}, {value: 0x0034, lo: 0x9e, hi: 0x9e}, {value: 0x0014, lo: 0xa0, hi: 0xa3}, - // Block 0xed, offset 0x4d4 + // Block 0xed, offset 0x4d2 {value: 0x0030, lo: 0xa5, hi: 0xa6}, {value: 0x0034, lo: 0xa7, hi: 0xa9}, {value: 0x0030, lo: 0xad, hi: 0xb2}, {value: 0x0014, lo: 0xb3, hi: 0xba}, {value: 0x0034, lo: 0xbb, hi: 0xbf}, - // Block 0xee, offset 0x4d9 + // Block 0xee, offset 0x4d7 {value: 0x0034, lo: 0x80, hi: 0x82}, {value: 0x0024, lo: 0x85, hi: 0x89}, {value: 0x0034, lo: 0x8a, hi: 0x8b}, {value: 0x0024, lo: 0xaa, hi: 0xad}, - // Block 0xef, offset 0x4dd + // Block 0xef, offset 0x4db {value: 0x0024, lo: 0x82, hi: 0x84}, - // Block 0xf0, offset 0x4de + // Block 0xf0, offset 0x4dc {value: 0x0013, lo: 0x80, hi: 0x99}, {value: 0x0012, lo: 0x9a, hi: 0xb3}, {value: 0x0013, lo: 0xb4, hi: 0xbf}, - // Block 0xf1, offset 0x4e1 + // Block 0xf1, offset 0x4df {value: 0x0013, lo: 0x80, hi: 0x8d}, {value: 0x0012, lo: 0x8e, hi: 0x94}, {value: 0x0012, lo: 0x96, hi: 0xa7}, {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0xf2, offset 0x4e5 + // Block 0xf2, offset 0x4e3 {value: 0x0013, lo: 0x80, hi: 0x81}, {value: 0x0012, lo: 0x82, hi: 0x9b}, {value: 0x0013, lo: 0x9c, hi: 0x9c}, @@ -2082,12 +2080,12 @@ var sparseValues = [1362]valueRange{ {value: 0x0012, lo: 0xb6, hi: 0xb9}, {value: 0x0012, lo: 0xbb, hi: 0xbb}, {value: 0x0012, lo: 0xbd, hi: 0xbf}, - // Block 0xf3, offset 0x4f0 + // Block 0xf3, offset 0x4ee {value: 0x0012, lo: 0x80, hi: 0x83}, {value: 0x0012, lo: 0x85, hi: 0x8f}, {value: 0x0013, lo: 0x90, hi: 0xa9}, {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0xf4, offset 0x4f4 + // Block 0xf4, offset 0x4f2 {value: 0x0012, lo: 0x80, hi: 0x83}, {value: 0x0013, lo: 0x84, hi: 0x85}, {value: 0x0013, lo: 0x87, hi: 0x8a}, @@ -2096,86 +2094,86 @@ var sparseValues = [1362]valueRange{ {value: 0x0012, lo: 0x9e, hi: 0xb7}, {value: 0x0013, lo: 0xb8, hi: 0xb9}, {value: 0x0013, lo: 0xbb, hi: 0xbe}, - // Block 0xf5, offset 0x4fc + // Block 0xf5, offset 0x4fa {value: 0x0013, lo: 0x80, hi: 0x84}, {value: 0x0013, lo: 0x86, hi: 0x86}, {value: 0x0013, lo: 0x8a, hi: 0x90}, {value: 0x0012, lo: 0x92, hi: 0xab}, {value: 0x0013, lo: 0xac, hi: 0xbf}, - // Block 0xf6, offset 0x501 + // Block 0xf6, offset 0x4ff {value: 0x0013, lo: 0x80, hi: 0x85}, {value: 0x0012, lo: 0x86, hi: 0x9f}, {value: 0x0013, lo: 0xa0, hi: 0xb9}, {value: 0x0012, lo: 0xba, hi: 0xbf}, - // Block 0xf7, offset 0x505 + // Block 0xf7, offset 0x503 {value: 0x0012, lo: 0x80, hi: 0x93}, {value: 0x0013, lo: 0x94, hi: 0xad}, {value: 0x0012, lo: 0xae, hi: 0xbf}, - // Block 0xf8, offset 0x508 + // Block 0xf8, offset 0x506 {value: 0x0012, lo: 0x80, hi: 0x87}, {value: 0x0013, lo: 0x88, hi: 0xa1}, {value: 0x0012, lo: 0xa2, hi: 0xbb}, {value: 0x0013, lo: 0xbc, hi: 0xbf}, - // Block 0xf9, offset 0x50c + // Block 0xf9, offset 0x50a {value: 0x0013, lo: 0x80, hi: 0x95}, {value: 0x0012, lo: 0x96, hi: 0xaf}, {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0xfa, offset 0x50f + // Block 0xfa, offset 0x50d {value: 0x0013, lo: 0x80, hi: 0x89}, {value: 0x0012, lo: 0x8a, hi: 0xa5}, {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0xfb, offset 0x512 + // Block 0xfb, offset 0x510 {value: 0x0013, lo: 0x80, hi: 0x80}, {value: 0x0012, lo: 0x82, hi: 0x9a}, {value: 0x0012, lo: 0x9c, hi: 0xa1}, {value: 0x0013, lo: 0xa2, hi: 0xba}, {value: 0x0012, lo: 0xbc, hi: 0xbf}, - // Block 0xfc, offset 0x517 + // Block 0xfc, offset 0x515 {value: 0x0012, lo: 0x80, hi: 0x94}, {value: 0x0012, lo: 0x96, hi: 0x9b}, {value: 0x0013, lo: 0x9c, hi: 0xb4}, {value: 0x0012, lo: 0xb6, hi: 0xbf}, - // Block 0xfd, offset 0x51b + // Block 0xfd, offset 0x519 {value: 0x0012, lo: 0x80, hi: 0x8e}, {value: 0x0012, lo: 0x90, hi: 0x95}, {value: 0x0013, lo: 0x96, hi: 0xae}, {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0xfe, offset 0x51f + // Block 0xfe, offset 0x51d {value: 0x0012, lo: 0x80, hi: 0x88}, {value: 0x0012, lo: 0x8a, hi: 0x8f}, {value: 0x0013, lo: 0x90, hi: 0xa8}, {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0xff, offset 0x523 + // Block 0xff, offset 0x521 {value: 0x0012, lo: 0x80, hi: 0x82}, {value: 0x0012, lo: 0x84, hi: 0x89}, {value: 0x0017, lo: 0x8a, hi: 0x8b}, {value: 0x0010, lo: 0x8e, hi: 0xbf}, - // Block 0x100, offset 0x527 + // Block 0x100, offset 0x525 {value: 0x0014, lo: 0x80, hi: 0xb6}, {value: 0x0014, lo: 0xbb, hi: 0xbf}, - // Block 0x101, offset 0x529 + // Block 0x101, offset 0x527 {value: 0x0014, lo: 0x80, hi: 0xac}, {value: 0x0014, lo: 0xb5, hi: 0xb5}, - // Block 0x102, offset 0x52b + // Block 0x102, offset 0x529 {value: 0x0014, lo: 0x84, hi: 0x84}, {value: 0x0014, lo: 0x9b, hi: 0x9f}, {value: 0x0014, lo: 0xa1, hi: 0xaf}, - // Block 0x103, offset 0x52e + // Block 0x103, offset 0x52c {value: 0x0024, lo: 0x80, hi: 0x86}, {value: 0x0024, lo: 0x88, hi: 0x98}, {value: 0x0024, lo: 0x9b, hi: 0xa1}, {value: 0x0024, lo: 0xa3, hi: 0xa4}, {value: 0x0024, lo: 0xa6, hi: 0xaa}, - // Block 0x104, offset 0x533 + // Block 0x104, offset 0x531 {value: 0x0010, lo: 0x80, hi: 0x84}, {value: 0x0034, lo: 0x90, hi: 0x96}, - // Block 0x105, offset 0x535 + // Block 0x105, offset 0x533 {value: 0xb552, lo: 0x80, hi: 0x81}, {value: 0xb852, lo: 0x82, hi: 0x83}, {value: 0x0024, lo: 0x84, hi: 0x89}, {value: 0x0034, lo: 0x8a, hi: 0x8a}, {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x106, offset 0x53a + // Block 0x106, offset 0x538 {value: 0x0010, lo: 0x80, hi: 0x83}, {value: 0x0010, lo: 0x85, hi: 0x9f}, {value: 0x0010, lo: 0xa1, hi: 0xa2}, @@ -2185,29 +2183,29 @@ var sparseValues = [1362]valueRange{ {value: 0x0010, lo: 0xb4, hi: 0xb7}, {value: 0x0010, lo: 0xb9, hi: 0xb9}, {value: 0x0010, lo: 0xbb, hi: 0xbb}, - // Block 0x107, offset 0x543 + // Block 0x107, offset 0x541 {value: 0x0010, lo: 0x80, hi: 0x89}, {value: 0x0010, lo: 0x8b, hi: 0x9b}, {value: 0x0010, lo: 0xa1, hi: 0xa3}, {value: 0x0010, lo: 0xa5, hi: 0xa9}, {value: 0x0010, lo: 0xab, hi: 0xbb}, - // Block 0x108, offset 0x548 + // Block 0x108, offset 0x546 {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x109, offset 0x549 + // Block 0x109, offset 0x547 {value: 0x0013, lo: 0x80, hi: 0x89}, {value: 0x0013, lo: 0x90, hi: 0xa9}, {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x10a, offset 0x54c + // Block 0x10a, offset 0x54a {value: 0x0013, lo: 0x80, hi: 0x89}, - // Block 0x10b, offset 0x54d + // Block 0x10b, offset 0x54b {value: 0x0004, lo: 0xbb, hi: 0xbf}, - // Block 0x10c, offset 0x54e + // Block 0x10c, offset 0x54c {value: 0x0014, lo: 0x81, hi: 0x81}, {value: 0x0014, lo: 0xa0, hi: 0xbf}, - // Block 0x10d, offset 0x550 + // Block 0x10d, offset 0x54e {value: 0x0014, lo: 0x80, hi: 0xbf}, - // Block 0x10e, offset 0x551 + // Block 0x10e, offset 0x54f {value: 0x0014, lo: 0x80, hi: 0xaf}, } -// Total table size 13819 bytes (13KiB); checksum: 4CC48DA3 +// Total table size 13811 bytes (13KiB); checksum: 4CC48DA3 diff --git a/vendor/golang.org/x/text/cases/trieval.go b/vendor/golang.org/x/text/cases/trieval.go index 7f2aa5b..fb221f8 100644 --- a/vendor/golang.org/x/text/cases/trieval.go +++ b/vendor/golang.org/x/text/cases/trieval.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package cases @@ -22,6 +22,7 @@ package cases // Only 13..8 are used for XOR patterns. // 7 inverseFold (fold to upper, not to lower) // 6 index: interpret the XOR pattern as an index +// or isMid if case mode is cIgnorableUncased. // 5..4 CCC: zero (normal or break), above or other // } // 3 exception: interpret this value as an exception index @@ -44,6 +45,7 @@ const ( ignorableValue = 0x0004 inverseFoldBit = 1 << 7 + isMidBit = 1 << 6 exceptionBit = 1 << 3 exceptionShift = 5 @@ -53,7 +55,7 @@ const ( xorShift = 8 // There is no mapping if all xor bits and the exception bit are zero. - hasMappingMask = 0xffc0 | exceptionBit + hasMappingMask = 0xff80 | exceptionBit ) // The case mode bits encodes the case type of a rune. This includes uncased, @@ -91,10 +93,6 @@ func (c info) isCaseIgnorable() bool { return c&ignorableMask == ignorableValue } -func (c info) isCaseIgnorableAndNonBreakStarter() bool { - return c&(fullCasedMask|cccMask) == (ignorableValue | cccZero) -} - func (c info) isNotCasedAndNotCaseIgnorable() bool { return c&fullCasedMask == 0 } @@ -103,6 +101,10 @@ func (c info) isCaseIgnorableAndNotCased() bool { return c&fullCasedMask == cIgnorableUncased } +func (c info) isMid() bool { + return c&(fullCasedMask|isMidBit) == isMidBit|cIgnorableUncased +} + // The case mapping implementation will need to know about various Canonical // Combining Class (CCC) values. We encode two of these in the trie value: // cccZero (0) and cccAbove (230). If the value is cccOther, it means that diff --git a/vendor/golang.org/x/text/internal/gen.go b/vendor/golang.org/x/text/internal/gen.go new file mode 100644 index 0000000..1d678af --- /dev/null +++ b/vendor/golang.org/x/text/internal/gen.go @@ -0,0 +1,52 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +import ( + "log" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/language" + "golang.org/x/text/unicode/cldr" +) + +func main() { + r := gen.OpenCLDRCoreZip() + defer r.Close() + + d := &cldr.Decoder{} + data, err := d.DecodeZip(r) + if err != nil { + log.Fatalf("DecodeZip: %v", err) + } + + w := gen.NewCodeWriter() + defer w.WriteGoFile("tables.go", "internal") + + // Create parents table. + parents := make([]uint16, language.NumCompactTags) + for _, loc := range data.Locales() { + tag := language.MustParse(loc) + index, ok := language.CompactIndex(tag) + if !ok { + continue + } + parentIndex := 0 // und + for p := tag.Parent(); p != language.Und; p = p.Parent() { + if x, ok := language.CompactIndex(p); ok { + parentIndex = x + break + } + } + parents[index] = uint16(parentIndex) + } + + w.WriteComment(` + Parent maps a compact index of a tag to the compact index of the parent of + this tag.`) + w.WriteVar("Parent", parents) +} diff --git a/vendor/golang.org/x/text/internal/internal.go b/vendor/golang.org/x/text/internal/internal.go new file mode 100644 index 0000000..b39dc21 --- /dev/null +++ b/vendor/golang.org/x/text/internal/internal.go @@ -0,0 +1,51 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go + +// Package internal contains non-exported functionality that are used by +// packages in the text repository. +package internal + +import ( + "sort" + + "golang.org/x/text/language" +) + +// SortTags sorts tags in place. +func SortTags(tags []language.Tag) { + sort.Sort(sorter(tags)) +} + +type sorter []language.Tag + +func (s sorter) Len() int { + return len(s) +} + +func (s sorter) Swap(i, j int) { + s[i], s[j] = s[j], s[i] +} + +func (s sorter) Less(i, j int) bool { + return s[i].String() < s[j].String() +} + +// UniqueTags sorts and filters duplicate tags in place and returns a slice with +// only unique tags. +func UniqueTags(tags []language.Tag) []language.Tag { + if len(tags) <= 1 { + return tags + } + SortTags(tags) + k := 0 + for i := 1; i < len(tags); i++ { + if tags[k].String() < tags[i].String() { + k++ + tags[k] = tags[i] + } + } + return tags[:k+1] +} diff --git a/vendor/golang.org/x/text/internal/match.go b/vendor/golang.org/x/text/internal/match.go new file mode 100644 index 0000000..a67fcac --- /dev/null +++ b/vendor/golang.org/x/text/internal/match.go @@ -0,0 +1,67 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package internal + +// This file contains matchers that implement CLDR inheritance. +// +// See http://unicode.org/reports/tr35/#Locale_Inheritance. +// +// Some of the inheritance described in this document is already handled by +// the cldr package. + +import ( + "golang.org/x/text/language" +) + +// TODO: consider if (some of the) matching algorithm needs to be public after +// getting some feel about what is generic and what is specific. + +// NewInheritanceMatcher returns a matcher that matches based on the inheritance +// chain. +// +// The matcher uses canonicalization and the parent relationship to find a +// match. The resulting match will always be either Und or a language with the +// same language and script as the requested language. It will not match +// languages for which there is understood to be mutual or one-directional +// intelligibility. +// +// A Match will indicate an Exact match if the language matches after +// canonicalization and High if the matched tag is a parent. +func NewInheritanceMatcher(t []language.Tag) *InheritanceMatcher { + tags := &InheritanceMatcher{make(map[language.Tag]int)} + for i, tag := range t { + ct, err := language.All.Canonicalize(tag) + if err != nil { + ct = tag + } + tags.index[ct] = i + } + return tags +} + +type InheritanceMatcher struct { + index map[language.Tag]int +} + +func (m InheritanceMatcher) Match(want ...language.Tag) (language.Tag, int, language.Confidence) { + for _, t := range want { + ct, err := language.All.Canonicalize(t) + if err != nil { + ct = t + } + conf := language.Exact + for { + if index, ok := m.index[ct]; ok { + return ct, index, conf + } + if ct == language.Und { + break + } + ct = ct.Parent() + conf = language.High + } + } + return language.Und, 0, language.No +} diff --git a/vendor/golang.org/x/text/internal/tables.go b/vendor/golang.org/x/text/internal/tables.go new file mode 100644 index 0000000..a53042a --- /dev/null +++ b/vendor/golang.org/x/text/internal/tables.go @@ -0,0 +1,117 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package internal + +// Parent maps a compact index of a tag to the compact index of the parent of +// this tag. +var Parent = []uint16{ // 754 elements + // Entry 0 - 3F + 0x0000, 0x0053, 0x00e5, 0x0000, 0x0003, 0x0003, 0x0000, 0x0006, + 0x0000, 0x0008, 0x0000, 0x000a, 0x0000, 0x000c, 0x000c, 0x000c, + 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, + 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, + 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, + 0x000c, 0x0000, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x002e, + 0x0000, 0x0000, 0x0031, 0x0030, 0x0030, 0x0000, 0x0035, 0x0000, + 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x003d, 0x0000, + // Entry 40 - 7F + 0x0000, 0x0040, 0x0000, 0x0042, 0x0042, 0x0000, 0x0045, 0x0045, + 0x0000, 0x0048, 0x0000, 0x004a, 0x0000, 0x0000, 0x004d, 0x004c, + 0x004c, 0x0000, 0x0051, 0x0051, 0x0051, 0x0051, 0x0000, 0x0056, + 0x0000, 0x0058, 0x0000, 0x005a, 0x0000, 0x005c, 0x005c, 0x0000, + 0x005f, 0x0000, 0x0061, 0x0000, 0x0063, 0x0000, 0x0065, 0x0065, + 0x0000, 0x0068, 0x0000, 0x006a, 0x006a, 0x006a, 0x006a, 0x006a, + 0x006a, 0x006a, 0x0000, 0x0072, 0x0000, 0x0074, 0x0000, 0x0076, + 0x0000, 0x0000, 0x0079, 0x0000, 0x007b, 0x0000, 0x007d, 0x0000, + // Entry 80 - BF + 0x007f, 0x007f, 0x0000, 0x0082, 0x0082, 0x0000, 0x0085, 0x0086, + 0x0086, 0x0086, 0x0085, 0x0087, 0x0086, 0x0086, 0x0086, 0x0085, + 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0087, 0x0086, + 0x0086, 0x0086, 0x0086, 0x0087, 0x0086, 0x0087, 0x0086, 0x0086, + 0x0087, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, + 0x0086, 0x0086, 0x0085, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, + 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, + 0x0086, 0x0086, 0x0086, 0x0086, 0x0085, 0x0086, 0x0085, 0x0086, + // Entry C0 - FF + 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0087, + 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0085, + 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0087, 0x0086, 0x0086, + 0x0087, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, + 0x0086, 0x0086, 0x0086, 0x0086, 0x0085, 0x0085, 0x0086, 0x0086, + 0x0085, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0000, 0x00ee, + 0x0000, 0x00f0, 0x00f1, 0x00f1, 0x00f1, 0x00f1, 0x00f1, 0x00f1, + 0x00f1, 0x00f1, 0x00f1, 0x00f0, 0x00f1, 0x00f0, 0x00f0, 0x00f1, + // Entry 100 - 13F + 0x00f1, 0x00f0, 0x00f1, 0x00f1, 0x00f1, 0x00f1, 0x00f0, 0x00f1, + 0x00f1, 0x00f1, 0x00f1, 0x00f1, 0x00f1, 0x0000, 0x010d, 0x0000, + 0x010f, 0x0000, 0x0111, 0x0000, 0x0113, 0x0113, 0x0000, 0x0116, + 0x0116, 0x0116, 0x0116, 0x0000, 0x011b, 0x0000, 0x011d, 0x0000, + 0x011f, 0x011f, 0x0000, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, + 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, + 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, + 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, + // Entry 140 - 17F + 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, + 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, + 0x0122, 0x0000, 0x0151, 0x0000, 0x0153, 0x0000, 0x0155, 0x0000, + 0x0157, 0x0000, 0x0159, 0x0000, 0x015b, 0x015b, 0x015b, 0x0000, + 0x015f, 0x0000, 0x0000, 0x0162, 0x0000, 0x0164, 0x0000, 0x0166, + 0x0166, 0x0166, 0x0000, 0x016a, 0x0000, 0x016c, 0x0000, 0x016e, + 0x0000, 0x0170, 0x0170, 0x0000, 0x0173, 0x0000, 0x0175, 0x0000, + 0x0177, 0x0000, 0x0179, 0x0000, 0x017b, 0x0000, 0x017d, 0x0000, + // Entry 180 - 1BF + 0x017f, 0x0000, 0x0181, 0x0181, 0x0181, 0x0181, 0x0000, 0x0000, + 0x0187, 0x0000, 0x0000, 0x018a, 0x0000, 0x018c, 0x0000, 0x0000, + 0x018f, 0x0000, 0x0191, 0x0000, 0x0000, 0x0194, 0x0000, 0x0000, + 0x0197, 0x0000, 0x0199, 0x0000, 0x019b, 0x0000, 0x019d, 0x0000, + 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, + 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x01ab, 0x0000, 0x01ae, + 0x0000, 0x01b0, 0x0000, 0x01b2, 0x0000, 0x01b4, 0x0000, 0x01b6, + 0x0000, 0x0000, 0x01b9, 0x0000, 0x01bb, 0x0000, 0x01bd, 0x0000, + // Entry 1C0 - 1FF + 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x01c5, + 0x01c5, 0x01c5, 0x0000, 0x01ca, 0x0000, 0x01cc, 0x01cc, 0x0000, + 0x01cf, 0x0000, 0x01d1, 0x0000, 0x01d3, 0x0000, 0x01d5, 0x0000, + 0x01d7, 0x0000, 0x01d9, 0x01d9, 0x0000, 0x01dc, 0x0000, 0x01de, + 0x0000, 0x01e0, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, + 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, + 0x01ee, 0x01ee, 0x0000, 0x01f2, 0x0000, 0x01f4, 0x0000, 0x01f6, + 0x0000, 0x01f8, 0x0000, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x01fd, + // Entry 200 - 23F + 0x0000, 0x0200, 0x0000, 0x0202, 0x0202, 0x0000, 0x0205, 0x0205, + 0x0000, 0x0208, 0x0208, 0x0208, 0x0208, 0x0208, 0x0208, 0x0208, + 0x0000, 0x0210, 0x0000, 0x0212, 0x0000, 0x0214, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x021a, 0x0000, 0x0000, 0x021d, 0x0000, + 0x021f, 0x021f, 0x0000, 0x0222, 0x0000, 0x0224, 0x0224, 0x0000, + 0x0000, 0x0228, 0x0227, 0x0227, 0x0000, 0x0000, 0x022d, 0x0000, + 0x022f, 0x0000, 0x0231, 0x0000, 0x023d, 0x0233, 0x023d, 0x023d, + 0x023d, 0x023d, 0x023d, 0x023d, 0x023d, 0x0233, 0x023d, 0x023d, + // Entry 240 - 27F + 0x0000, 0x0240, 0x0240, 0x0240, 0x0000, 0x0244, 0x0000, 0x0246, + 0x0000, 0x0248, 0x0248, 0x0000, 0x024b, 0x0000, 0x024d, 0x024d, + 0x024d, 0x024d, 0x024d, 0x024d, 0x0000, 0x0254, 0x0000, 0x0256, + 0x0000, 0x0258, 0x0000, 0x025a, 0x0000, 0x025c, 0x0000, 0x0000, + 0x025f, 0x025f, 0x025f, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, + 0x0267, 0x0000, 0x0000, 0x026a, 0x0269, 0x0269, 0x0000, 0x026e, + 0x0000, 0x0270, 0x0000, 0x0272, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0277, 0x0000, 0x0000, 0x027a, 0x0000, 0x027c, 0x027c, 0x027c, + // Entry 280 - 2BF + 0x027c, 0x0000, 0x0281, 0x0281, 0x0281, 0x0000, 0x0285, 0x0285, + 0x0285, 0x0285, 0x0285, 0x0000, 0x028b, 0x028b, 0x028b, 0x028b, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0293, 0x0293, 0x0293, 0x0000, + 0x0297, 0x0297, 0x0297, 0x0297, 0x0000, 0x0000, 0x029d, 0x029d, + 0x029d, 0x029d, 0x0000, 0x02a2, 0x0000, 0x02a4, 0x02a4, 0x0000, + 0x02a7, 0x0000, 0x02a9, 0x02a9, 0x0000, 0x0000, 0x02ad, 0x0000, + 0x0000, 0x02b0, 0x0000, 0x02b2, 0x02b2, 0x0000, 0x0000, 0x02b6, + 0x0000, 0x02b8, 0x0000, 0x02ba, 0x0000, 0x02bc, 0x0000, 0x02be, + // Entry 2C0 - 2FF + 0x02be, 0x0000, 0x0000, 0x02c2, 0x0000, 0x02c4, 0x02c1, 0x02c1, + 0x0000, 0x0000, 0x02c9, 0x02c8, 0x02c8, 0x0000, 0x0000, 0x02ce, + 0x0000, 0x02d0, 0x0000, 0x02d2, 0x0000, 0x0000, 0x02d5, 0x0000, + 0x0000, 0x0000, 0x02d9, 0x0000, 0x02db, 0x0000, 0x02dd, 0x0000, + 0x02df, 0x02df, 0x0000, 0x02e2, 0x0000, 0x02e4, 0x0000, 0x02e6, + 0x02e6, 0x02e6, 0x02e6, 0x02e6, 0x0000, 0x02ec, 0x02ed, 0x02ec, + 0x0000, 0x02f0, +} // Size: 1532 bytes + +// Total table size 1532 bytes (1KiB); checksum: 90718A2 diff --git a/vendor/golang.org/x/text/language/common.go b/vendor/golang.org/x/text/language/common.go index a255bb0..9d86e18 100644 --- a/vendor/golang.org/x/text/language/common.go +++ b/vendor/golang.org/x/text/language/common.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package language diff --git a/vendor/golang.org/x/text/language/maketables.go b/vendor/golang.org/x/text/language/gen.go similarity index 91% rename from vendor/golang.org/x/text/language/maketables.go rename to vendor/golang.org/x/text/language/gen.go index 2cc995b..153269b 100644 --- a/vendor/golang.org/x/text/language/maketables.go +++ b/vendor/golang.org/x/text/language/gen.go @@ -678,6 +678,8 @@ func (b *builder) parseIndices() { b.locale.parse(meta.DefaultContent.Locales) } +// TODO: region inclusion data will probably not be use used in future matchers. + func (b *builder) computeRegionGroups() { b.groups = make(map[int]index) @@ -686,6 +688,11 @@ func (b *builder) computeRegionGroups() { b.groups[i] = index(len(b.groups)) } for _, g := range b.supp.TerritoryContainment.Group { + // Skip UN and EURO zone as they are flattening the containment + // relationship. + if g.Type == "EZ" || g.Type == "UN" { + continue + } group := b.region.index(g.Type) if _, ok := b.groups[group]; !ok { b.groups[group] = index(len(b.groups)) @@ -782,6 +789,7 @@ func (b *builder) writeLanguage() { lang.updateLater("tw", "twi") lang.updateLater("nb", "nob") lang.updateLater("ak", "aka") + lang.updateLater("bh", "bih") // Ensure that each 2-letter code is matched with a 3-letter code. for _, v := range lang.s[1:] { @@ -798,10 +806,10 @@ func (b *builder) writeLanguage() { } } - // Complete canonialized language tags. + // Complete canonicalized language tags. lang.freeze() for i, v := range lang.s { - // We can avoid these manual entries by using the IANI registry directly. + // We can avoid these manual entries by using the IANA registry directly. // Seems easier to update the list manually, as changes are rare. // The panic in this loop will trigger if we miss an entry. add := "" @@ -908,7 +916,7 @@ func (b *builder) writeRegion() { i := b.region.index(s) for _, d := range e.description { if strings.Contains(d, "Private use") { - regionTypes[i] = iso3166UserAssgined + regionTypes[i] = iso3166UserAssigned } } regionTypes[i] |= bcp47Region @@ -1065,7 +1073,7 @@ const ( ) const ( - iso3166UserAssgined = 1 << iota + iso3166UserAssigned = 1 << iota ccTLD bcp47Region ) @@ -1355,42 +1363,23 @@ func (b *builder) writeLikelyData() { type mutualIntelligibility struct { want, have uint16 - conf uint8 + distance uint8 oneway bool } type scriptIntelligibility struct { - lang uint16 // langID or 0 if * - want, have uint8 - conf uint8 -} - -type sortByConf []mutualIntelligibility - -func (l sortByConf) Less(a, b int) bool { - return l[a].conf > l[b].conf + wantLang, haveLang uint16 + wantScript, haveScript uint8 + distance uint8 + // Always oneway } -func (l sortByConf) Swap(a, b int) { - l[a], l[b] = l[b], l[a] -} - -func (l sortByConf) Len() int { - return len(l) -} - -// toConf converts a percentage value [0, 100] to a confidence class. -func toConf(pct uint8) uint8 { - switch { - case pct == 100: - return 3 // Exact - case pct >= 90: - return 2 // High - case pct > 50: - return 1 // Low - default: - return 0 // No - } +type regionIntelligibility struct { + lang uint16 // compact language id + script uint8 // 0 means any + group uint8 // 0 means any; if bit 7 is set it means inverse + distance uint8 + // Always twoway. } // writeMatchData writes tables with languages and scripts for which there is @@ -1400,13 +1389,50 @@ func toConf(pct uint8) uint8 { // We also drop all region-related data as we use a different algorithm to // determine region equivalence. func (b *builder) writeMatchData() { - b.writeType(mutualIntelligibility{}) - b.writeType(scriptIntelligibility{}) lm := b.supp.LanguageMatching.LanguageMatches - cldr.MakeSlice(&lm).SelectAnyOf("type", "written") + cldr.MakeSlice(&lm).SelectAnyOf("type", "written_new") + + regionHierarchy := map[string][]string{} + for _, g := range b.supp.TerritoryContainment.Group { + regions := strings.Split(g.Contains, " ") + regionHierarchy[g.Type] = append(regionHierarchy[g.Type], regions...) + } + regionToGroups := make([]uint8, len(b.region.s)) - matchLang := []mutualIntelligibility{} + idToIndex := map[string]uint8{} + for i, mv := range lm[0].MatchVariable { + if i > 6 { + log.Fatalf("Too many groups: %d", i) + } + idToIndex[mv.Id] = uint8(i + 1) + // TODO: also handle '-' + for _, r := range strings.Split(mv.Value, "+") { + todo := []string{r} + for k := 0; k < len(todo); k++ { + r := todo[k] + regionToGroups[b.region.index(r)] |= 1 << uint8(i) + todo = append(todo, regionHierarchy[r]...) + } + } + } + b.writeSlice("regionToGroups", regionToGroups) + + b.writeType(mutualIntelligibility{}) + b.writeType(scriptIntelligibility{}) + b.writeType(regionIntelligibility{}) + + matchLang := []mutualIntelligibility{{ + // TODO: remove once CLDR is fixed. + want: uint16(b.langIndex("sr")), + have: uint16(b.langIndex("hr")), + distance: uint8(5), + }, { + want: uint16(b.langIndex("sr")), + have: uint16(b.langIndex("bs")), + distance: uint8(5), + }} matchScript := []scriptIntelligibility{} + matchRegion := []regionIntelligibility{} // Convert the languageMatch entries in lists keyed by desired language. for _, m := range lm[0].LanguageMatch { // Different versions of CLDR use different separators. @@ -1414,33 +1440,38 @@ func (b *builder) writeMatchData() { supported := strings.Replace(m.Supported, "-", "_", -1) d := strings.Split(desired, "_") s := strings.Split(supported, "_") - if len(d) != len(s) || len(d) > 2 { - // Skip all entries with regions and work around CLDR bug. + if len(d) != len(s) { + log.Fatalf("not supported: desired=%q; supported=%q", desired, supported) continue } - pct, _ := strconv.ParseInt(m.Percent, 10, 8) - if len(d) == 2 && d[0] == s[0] && len(d[1]) == 4 { - // language-script pair. - lang := uint16(0) - if d[0] != "*" { - lang = uint16(b.langIndex(d[0])) + distance, _ := strconv.ParseInt(m.Distance, 10, 8) + switch len(d) { + case 2: + if desired == supported && desired == "*_*" { + continue } + // language-script pair. matchScript = append(matchScript, scriptIntelligibility{ - lang: lang, - want: uint8(b.script.index(d[1])), - have: uint8(b.script.index(s[1])), - conf: toConf(uint8(pct)), + wantLang: uint16(b.langIndex(d[0])), + haveLang: uint16(b.langIndex(s[0])), + wantScript: uint8(b.script.index(d[1])), + haveScript: uint8(b.script.index(s[1])), + distance: uint8(distance), }) if m.Oneway != "true" { matchScript = append(matchScript, scriptIntelligibility{ - lang: lang, - want: uint8(b.script.index(s[1])), - have: uint8(b.script.index(d[1])), - conf: toConf(uint8(pct)), + wantLang: uint16(b.langIndex(s[0])), + haveLang: uint16(b.langIndex(d[0])), + wantScript: uint8(b.script.index(s[1])), + haveScript: uint8(b.script.index(d[1])), + distance: uint8(distance), }) } - } else if len(d) == 1 && d[0] != "*" { - if pct == 100 { + case 1: + if desired == supported && desired == "*" { + continue + } + if distance == 1 { // nb == no is already handled by macro mapping. Check there // really is only this case. if d[0] != "no" || s[0] != "nb" { @@ -1448,28 +1479,57 @@ func (b *builder) writeMatchData() { } continue } + // TODO: consider dropping oneway field and just doubling the entry. matchLang = append(matchLang, mutualIntelligibility{ - want: uint16(b.langIndex(d[0])), - have: uint16(b.langIndex(s[0])), - conf: uint8(pct), - oneway: m.Oneway == "true", + want: uint16(b.langIndex(d[0])), + have: uint16(b.langIndex(s[0])), + distance: uint8(distance), + oneway: m.Oneway == "true", }) - } else { - // TODO: Handle other mappings. - a := []string{"*;*", "*_*;*_*", "es_MX;es_419"} - s := strings.Join([]string{desired, supported}, ";") - if i := sort.SearchStrings(a, s); i == len(a) || a[i] != s { - log.Printf("%q not handled", s) + case 3: + if desired == supported && desired == "*_*_*" { + continue + } + if desired != supported { // (Weird but correct.) + log.Fatalf("not supported: desired=%q; supported=%q", desired, supported) + continue + } + ri := regionIntelligibility{ + lang: b.langIndex(d[0]), + distance: uint8(distance), } + if d[1] != "*" { + ri.script = uint8(b.script.index(d[1])) + } + switch { + case d[2] == "*": + ri.group = 0x80 // not contained in anything + case strings.HasPrefix(d[2], "$!"): + ri.group = 0x80 + d[2] = "$" + d[2][len("$!"):] + fallthrough + case strings.HasPrefix(d[2], "$"): + ri.group |= idToIndex[d[2]] + } + matchRegion = append(matchRegion, ri) + default: + log.Fatalf("not supported: desired=%q; supported=%q", desired, supported) } } - sort.Stable(sortByConf(matchLang)) - // collapse percentage into confidence classes - for i, m := range matchLang { - matchLang[i].conf = toConf(m.conf) - } + sort.SliceStable(matchLang, func(i, j int) bool { + return matchLang[i].distance < matchLang[j].distance + }) b.writeSlice("matchLang", matchLang) + + sort.SliceStable(matchScript, func(i, j int) bool { + return matchScript[i].distance < matchScript[j].distance + }) b.writeSlice("matchScript", matchScript) + + sort.SliceStable(matchRegion, func(i, j int) bool { + return matchRegion[i].distance < matchRegion[j].distance + }) + b.writeSlice("matchRegion", matchRegion) } func (b *builder) writeRegionInclusionData() { @@ -1482,6 +1542,11 @@ func (b *builder) writeRegionInclusionData() { containment = make(map[index][]index) ) for _, g := range b.supp.TerritoryContainment.Group { + // Skip UN and EURO zone as they are flattening the containment + // relationship. + if g.Type == "EZ" || g.Type == "UN" { + continue + } group := b.region.index(g.Type) groupIdx := b.groups[group] for _, mem := range strings.Split(g.Contains, " ") { @@ -1508,7 +1573,6 @@ func (b *builder) writeRegionInclusionData() { for _, v := range l { regionContainment[g] |= 1 << v } - // log.Printf("%d: %X", g, regionContainment[g]) } b.writeSlice("regionContainment", regionContainment) diff --git a/vendor/golang.org/x/text/language/index.go b/vendor/golang.org/x/text/language/index.go index 7fa9cc8..973db9f 100644 --- a/vendor/golang.org/x/text/language/index.go +++ b/vendor/golang.org/x/text/language/index.go @@ -1,762 +1,769 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package language // NumCompactTags is the number of common tags. The maximum tag is // NumCompactTags-1. -const NumCompactTags = 747 +const NumCompactTags = 754 var specialTags = []Tag{ // 2 elements - 0: {lang: 0x61, region: 0x6d, script: 0x0, pVariant: 0x5, pExt: 0xe, str: "ca-ES-valencia"}, - 1: {lang: 0x9b, region: 0x132, script: 0x0, pVariant: 0x5, pExt: 0x5, str: "en-US-u-va-posix"}, + 0: {lang: 0xd7, region: 0x6d, script: 0x0, pVariant: 0x5, pExt: 0xe, str: "ca-ES-valencia"}, + 1: {lang: 0x138, region: 0x134, script: 0x0, pVariant: 0x5, pExt: 0x5, str: "en-US-u-va-posix"}, } // Size: 72 bytes var coreTags = map[uint32]uint16{ 0x0: 0, // und - 0x00a00000: 3, // af - 0x00a000d0: 4, // af-NA - 0x00a0015e: 5, // af-ZA - 0x00b00000: 6, // agq - 0x00b00051: 7, // agq-CM - 0x00d00000: 8, // ak - 0x00d0007e: 9, // ak-GH - 0x01100000: 10, // am - 0x0110006e: 11, // am-ET - 0x01500000: 12, // ar - 0x01500001: 13, // ar-001 - 0x01500022: 14, // ar-AE - 0x01500038: 15, // ar-BH - 0x01500061: 16, // ar-DJ - 0x01500066: 17, // ar-DZ - 0x0150006a: 18, // ar-EG - 0x0150006b: 19, // ar-EH - 0x0150006c: 20, // ar-ER - 0x01500095: 21, // ar-IL - 0x01500099: 22, // ar-IQ - 0x0150009f: 23, // ar-JO - 0x015000a6: 24, // ar-KM - 0x015000aa: 25, // ar-KW - 0x015000ae: 26, // ar-LB - 0x015000b7: 27, // ar-LY - 0x015000b8: 28, // ar-MA - 0x015000c7: 29, // ar-MR - 0x015000df: 30, // ar-OM - 0x015000eb: 31, // ar-PS - 0x015000f1: 32, // ar-QA - 0x01500106: 33, // ar-SA - 0x01500109: 34, // ar-SD - 0x01500113: 35, // ar-SO - 0x01500115: 36, // ar-SS - 0x0150011a: 37, // ar-SY - 0x0150011e: 38, // ar-TD - 0x01500126: 39, // ar-TN - 0x0150015b: 40, // ar-YE - 0x01c00000: 41, // as - 0x01c00097: 42, // as-IN - 0x01d00000: 43, // asa - 0x01d0012d: 44, // asa-TZ - 0x01f00000: 45, // ast - 0x01f0006d: 46, // ast-ES - 0x02400000: 47, // az - 0x0241e000: 48, // az-Cyrl - 0x0241e031: 49, // az-Cyrl-AZ - 0x02452000: 50, // az-Latn - 0x02452031: 51, // az-Latn-AZ - 0x02a00000: 52, // bas - 0x02a00051: 53, // bas-CM - 0x02f00000: 54, // be - 0x02f00046: 55, // be-BY - 0x03100000: 56, // bem - 0x0310015f: 57, // bem-ZM - 0x03300000: 58, // bez - 0x0330012d: 59, // bez-TZ - 0x03800000: 60, // bg - 0x03800037: 61, // bg-BG - 0x03c00000: 62, // bh - 0x04900000: 63, // bm - 0x049000c1: 64, // bm-ML - 0x04b00000: 65, // bn - 0x04b00034: 66, // bn-BD - 0x04b00097: 67, // bn-IN - 0x04c00000: 68, // bo - 0x04c00052: 69, // bo-CN - 0x04c00097: 70, // bo-IN - 0x05000000: 71, // br - 0x05000076: 72, // br-FR - 0x05300000: 73, // brx - 0x05300097: 74, // brx-IN - 0x05400000: 75, // bs - 0x0541e000: 76, // bs-Cyrl - 0x0541e032: 77, // bs-Cyrl-BA - 0x05452000: 78, // bs-Latn - 0x05452032: 79, // bs-Latn-BA - 0x06100000: 80, // ca - 0x06100021: 81, // ca-AD - 0x0610006d: 82, // ca-ES - 0x06100076: 83, // ca-FR - 0x0610009c: 84, // ca-IT - 0x06400000: 85, // ce - 0x06400104: 86, // ce-RU - 0x06600000: 87, // cgg - 0x0660012f: 88, // cgg-UG - 0x06c00000: 89, // chr - 0x06c00132: 90, // chr-US - 0x06f00000: 91, // ckb - 0x06f00099: 92, // ckb-IQ - 0x06f0009a: 93, // ckb-IR - 0x07900000: 94, // cs - 0x0790005d: 95, // cs-CZ - 0x07d00000: 96, // cu - 0x07d00104: 97, // cu-RU - 0x07f00000: 98, // cy - 0x07f00079: 99, // cy-GB - 0x08000000: 100, // da - 0x08000062: 101, // da-DK - 0x08000080: 102, // da-GL - 0x08300000: 103, // dav - 0x083000a2: 104, // dav-KE - 0x08500000: 105, // de - 0x0850002d: 106, // de-AT - 0x08500035: 107, // de-BE - 0x0850004d: 108, // de-CH - 0x0850005f: 109, // de-DE - 0x085000b0: 110, // de-LI - 0x085000b5: 111, // de-LU - 0x08800000: 112, // dje - 0x088000d2: 113, // dje-NE - 0x08b00000: 114, // dsb - 0x08b0005f: 115, // dsb-DE - 0x08f00000: 116, // dua - 0x08f00051: 117, // dua-CM - 0x09000000: 118, // dv - 0x09100000: 119, // dyo - 0x09100112: 120, // dyo-SN - 0x09300000: 121, // dz - 0x09300042: 122, // dz-BT - 0x09400000: 123, // ebu - 0x094000a2: 124, // ebu-KE - 0x09500000: 125, // ee - 0x0950007e: 126, // ee-GH - 0x09500120: 127, // ee-TG - 0x09a00000: 128, // el - 0x09a0005c: 129, // el-CY - 0x09a00085: 130, // el-GR - 0x09b00000: 131, // en - 0x09b00001: 132, // en-001 - 0x09b0001a: 133, // en-150 - 0x09b00024: 134, // en-AG - 0x09b00025: 135, // en-AI - 0x09b0002c: 136, // en-AS - 0x09b0002d: 137, // en-AT - 0x09b0002e: 138, // en-AU - 0x09b00033: 139, // en-BB - 0x09b00035: 140, // en-BE - 0x09b00039: 141, // en-BI - 0x09b0003c: 142, // en-BM - 0x09b00041: 143, // en-BS - 0x09b00045: 144, // en-BW - 0x09b00047: 145, // en-BZ - 0x09b00048: 146, // en-CA - 0x09b00049: 147, // en-CC - 0x09b0004d: 148, // en-CH - 0x09b0004f: 149, // en-CK - 0x09b00051: 150, // en-CM - 0x09b0005b: 151, // en-CX - 0x09b0005c: 152, // en-CY - 0x09b0005f: 153, // en-DE - 0x09b00060: 154, // en-DG - 0x09b00062: 155, // en-DK - 0x09b00063: 156, // en-DM - 0x09b0006c: 157, // en-ER - 0x09b00070: 158, // en-FI - 0x09b00071: 159, // en-FJ - 0x09b00072: 160, // en-FK - 0x09b00073: 161, // en-FM - 0x09b00079: 162, // en-GB - 0x09b0007a: 163, // en-GD - 0x09b0007d: 164, // en-GG - 0x09b0007e: 165, // en-GH - 0x09b0007f: 166, // en-GI - 0x09b00081: 167, // en-GM - 0x09b00088: 168, // en-GU - 0x09b0008a: 169, // en-GY - 0x09b0008b: 170, // en-HK - 0x09b00094: 171, // en-IE - 0x09b00095: 172, // en-IL - 0x09b00096: 173, // en-IM - 0x09b00097: 174, // en-IN - 0x09b00098: 175, // en-IO - 0x09b0009d: 176, // en-JE - 0x09b0009e: 177, // en-JM - 0x09b000a2: 178, // en-KE - 0x09b000a5: 179, // en-KI - 0x09b000a7: 180, // en-KN - 0x09b000ab: 181, // en-KY - 0x09b000af: 182, // en-LC - 0x09b000b2: 183, // en-LR - 0x09b000b3: 184, // en-LS - 0x09b000bd: 185, // en-MG - 0x09b000be: 186, // en-MH - 0x09b000c4: 187, // en-MO - 0x09b000c5: 188, // en-MP - 0x09b000c8: 189, // en-MS - 0x09b000c9: 190, // en-MT - 0x09b000ca: 191, // en-MU - 0x09b000cc: 192, // en-MW - 0x09b000ce: 193, // en-MY - 0x09b000d0: 194, // en-NA - 0x09b000d3: 195, // en-NF - 0x09b000d4: 196, // en-NG - 0x09b000d7: 197, // en-NL - 0x09b000db: 198, // en-NR - 0x09b000dd: 199, // en-NU - 0x09b000de: 200, // en-NZ - 0x09b000e4: 201, // en-PG - 0x09b000e5: 202, // en-PH - 0x09b000e6: 203, // en-PK - 0x09b000e9: 204, // en-PN - 0x09b000ea: 205, // en-PR - 0x09b000ee: 206, // en-PW - 0x09b00105: 207, // en-RW - 0x09b00107: 208, // en-SB - 0x09b00108: 209, // en-SC - 0x09b00109: 210, // en-SD - 0x09b0010a: 211, // en-SE - 0x09b0010b: 212, // en-SG - 0x09b0010c: 213, // en-SH - 0x09b0010d: 214, // en-SI - 0x09b00110: 215, // en-SL - 0x09b00115: 216, // en-SS - 0x09b00119: 217, // en-SX - 0x09b0011b: 218, // en-SZ - 0x09b0011d: 219, // en-TC - 0x09b00123: 220, // en-TK - 0x09b00127: 221, // en-TO - 0x09b0012a: 222, // en-TT - 0x09b0012b: 223, // en-TV - 0x09b0012d: 224, // en-TZ - 0x09b0012f: 225, // en-UG - 0x09b00131: 226, // en-UM - 0x09b00132: 227, // en-US - 0x09b00136: 228, // en-VC - 0x09b00139: 229, // en-VG - 0x09b0013a: 230, // en-VI - 0x09b0013c: 231, // en-VU - 0x09b0013f: 232, // en-WS - 0x09b0015e: 233, // en-ZA - 0x09b0015f: 234, // en-ZM - 0x09b00161: 235, // en-ZW - 0x09c00000: 236, // eo - 0x09c00001: 237, // eo-001 - 0x09d00000: 238, // es - 0x09d0001e: 239, // es-419 - 0x09d0002b: 240, // es-AR - 0x09d0003e: 241, // es-BO - 0x09d00040: 242, // es-BR - 0x09d00050: 243, // es-CL - 0x09d00053: 244, // es-CO - 0x09d00055: 245, // es-CR - 0x09d00058: 246, // es-CU - 0x09d00064: 247, // es-DO - 0x09d00067: 248, // es-EA - 0x09d00068: 249, // es-EC - 0x09d0006d: 250, // es-ES - 0x09d00084: 251, // es-GQ - 0x09d00087: 252, // es-GT - 0x09d0008d: 253, // es-HN - 0x09d00092: 254, // es-IC - 0x09d000cd: 255, // es-MX - 0x09d000d6: 256, // es-NI - 0x09d000e0: 257, // es-PA - 0x09d000e2: 258, // es-PE - 0x09d000e5: 259, // es-PH - 0x09d000ea: 260, // es-PR - 0x09d000ef: 261, // es-PY - 0x09d00118: 262, // es-SV - 0x09d00132: 263, // es-US - 0x09d00133: 264, // es-UY - 0x09d00138: 265, // es-VE - 0x09f00000: 266, // et - 0x09f00069: 267, // et-EE - 0x0a100000: 268, // eu - 0x0a10006d: 269, // eu-ES - 0x0a200000: 270, // ewo - 0x0a200051: 271, // ewo-CM - 0x0a400000: 272, // fa - 0x0a400023: 273, // fa-AF - 0x0a40009a: 274, // fa-IR - 0x0a600000: 275, // ff - 0x0a600051: 276, // ff-CM - 0x0a600082: 277, // ff-GN - 0x0a6000c7: 278, // ff-MR - 0x0a600112: 279, // ff-SN - 0x0a800000: 280, // fi - 0x0a800070: 281, // fi-FI - 0x0aa00000: 282, // fil - 0x0aa000e5: 283, // fil-PH - 0x0ad00000: 284, // fo - 0x0ad00062: 285, // fo-DK - 0x0ad00074: 286, // fo-FO - 0x0af00000: 287, // fr - 0x0af00035: 288, // fr-BE - 0x0af00036: 289, // fr-BF - 0x0af00039: 290, // fr-BI - 0x0af0003a: 291, // fr-BJ - 0x0af0003b: 292, // fr-BL - 0x0af00048: 293, // fr-CA - 0x0af0004a: 294, // fr-CD - 0x0af0004b: 295, // fr-CF - 0x0af0004c: 296, // fr-CG - 0x0af0004d: 297, // fr-CH - 0x0af0004e: 298, // fr-CI - 0x0af00051: 299, // fr-CM - 0x0af00061: 300, // fr-DJ - 0x0af00066: 301, // fr-DZ - 0x0af00076: 302, // fr-FR - 0x0af00078: 303, // fr-GA - 0x0af0007c: 304, // fr-GF - 0x0af00082: 305, // fr-GN - 0x0af00083: 306, // fr-GP - 0x0af00084: 307, // fr-GQ - 0x0af0008f: 308, // fr-HT - 0x0af000a6: 309, // fr-KM - 0x0af000b5: 310, // fr-LU - 0x0af000b8: 311, // fr-MA - 0x0af000b9: 312, // fr-MC - 0x0af000bc: 313, // fr-MF - 0x0af000bd: 314, // fr-MG - 0x0af000c1: 315, // fr-ML - 0x0af000c6: 316, // fr-MQ - 0x0af000c7: 317, // fr-MR - 0x0af000ca: 318, // fr-MU - 0x0af000d1: 319, // fr-NC - 0x0af000d2: 320, // fr-NE - 0x0af000e3: 321, // fr-PF - 0x0af000e8: 322, // fr-PM - 0x0af00100: 323, // fr-RE - 0x0af00105: 324, // fr-RW - 0x0af00108: 325, // fr-SC - 0x0af00112: 326, // fr-SN - 0x0af0011a: 327, // fr-SY - 0x0af0011e: 328, // fr-TD - 0x0af00120: 329, // fr-TG - 0x0af00126: 330, // fr-TN - 0x0af0013c: 331, // fr-VU - 0x0af0013d: 332, // fr-WF - 0x0af0015c: 333, // fr-YT - 0x0b600000: 334, // fur - 0x0b60009c: 335, // fur-IT - 0x0b900000: 336, // fy - 0x0b9000d7: 337, // fy-NL - 0x0ba00000: 338, // ga - 0x0ba00094: 339, // ga-IE - 0x0c200000: 340, // gd - 0x0c200079: 341, // gd-GB - 0x0c800000: 342, // gl - 0x0c80006d: 343, // gl-ES - 0x0d200000: 344, // gsw - 0x0d20004d: 345, // gsw-CH - 0x0d200076: 346, // gsw-FR - 0x0d2000b0: 347, // gsw-LI - 0x0d300000: 348, // gu - 0x0d300097: 349, // gu-IN - 0x0d700000: 350, // guw - 0x0d800000: 351, // guz - 0x0d8000a2: 352, // guz-KE - 0x0d900000: 353, // gv - 0x0d900096: 354, // gv-IM - 0x0dc00000: 355, // ha - 0x0dc0007e: 356, // ha-GH - 0x0dc000d2: 357, // ha-NE - 0x0dc000d4: 358, // ha-NG - 0x0de00000: 359, // haw - 0x0de00132: 360, // haw-US - 0x0e000000: 361, // he - 0x0e000095: 362, // he-IL - 0x0e100000: 363, // hi - 0x0e100097: 364, // hi-IN - 0x0ee00000: 365, // hr - 0x0ee00032: 366, // hr-BA - 0x0ee0008e: 367, // hr-HR - 0x0ef00000: 368, // hsb - 0x0ef0005f: 369, // hsb-DE - 0x0f200000: 370, // hu - 0x0f200090: 371, // hu-HU - 0x0f300000: 372, // hy - 0x0f300027: 373, // hy-AM - 0x0f800000: 374, // id - 0x0f800093: 375, // id-ID - 0x0fa00000: 376, // ig - 0x0fa000d4: 377, // ig-NG - 0x0fb00000: 378, // ii - 0x0fb00052: 379, // ii-CN - 0x10200000: 380, // is - 0x1020009b: 381, // is-IS - 0x10300000: 382, // it - 0x1030004d: 383, // it-CH - 0x1030009c: 384, // it-IT - 0x10300111: 385, // it-SM - 0x10400000: 386, // iu - 0x10700000: 387, // ja - 0x107000a0: 388, // ja-JP - 0x10900000: 389, // jbo - 0x10a00000: 390, // jgo - 0x10a00051: 391, // jgo-CM - 0x10c00000: 392, // jmc - 0x10c0012d: 393, // jmc-TZ - 0x10f00000: 394, // jv - 0x11100000: 395, // ka - 0x1110007b: 396, // ka-GE - 0x11300000: 397, // kab - 0x11300066: 398, // kab-DZ - 0x11500000: 399, // kaj - 0x11600000: 400, // kam - 0x116000a2: 401, // kam-KE - 0x11900000: 402, // kcg - 0x11b00000: 403, // kde - 0x11b0012d: 404, // kde-TZ - 0x11d00000: 405, // kea - 0x11d00059: 406, // kea-CV - 0x12800000: 407, // khq - 0x128000c1: 408, // khq-ML - 0x12b00000: 409, // ki - 0x12b000a2: 410, // ki-KE - 0x12f00000: 411, // kk - 0x12f000ac: 412, // kk-KZ - 0x13000000: 413, // kkj - 0x13000051: 414, // kkj-CM - 0x13100000: 415, // kl - 0x13100080: 416, // kl-GL - 0x13200000: 417, // kln - 0x132000a2: 418, // kln-KE - 0x13300000: 419, // km - 0x133000a4: 420, // km-KH - 0x13500000: 421, // kn - 0x13500097: 422, // kn-IN - 0x13600000: 423, // ko - 0x136000a8: 424, // ko-KP - 0x136000a9: 425, // ko-KR - 0x13800000: 426, // kok - 0x13800097: 427, // kok-IN - 0x14100000: 428, // ks - 0x14100097: 429, // ks-IN - 0x14200000: 430, // ksb - 0x1420012d: 431, // ksb-TZ - 0x14300000: 432, // ksf - 0x14300051: 433, // ksf-CM - 0x14400000: 434, // ksh - 0x1440005f: 435, // ksh-DE - 0x14500000: 436, // ku - 0x14a00000: 437, // kw - 0x14a00079: 438, // kw-GB - 0x14d00000: 439, // ky - 0x14d000a3: 440, // ky-KG - 0x15100000: 441, // lag - 0x1510012d: 442, // lag-TZ - 0x15400000: 443, // lb - 0x154000b5: 444, // lb-LU - 0x15a00000: 445, // lg - 0x15a0012f: 446, // lg-UG - 0x16100000: 447, // lkt - 0x16100132: 448, // lkt-US - 0x16400000: 449, // ln - 0x16400029: 450, // ln-AO - 0x1640004a: 451, // ln-CD - 0x1640004b: 452, // ln-CF - 0x1640004c: 453, // ln-CG - 0x16500000: 454, // lo - 0x165000ad: 455, // lo-LA - 0x16800000: 456, // lrc - 0x16800099: 457, // lrc-IQ - 0x1680009a: 458, // lrc-IR - 0x16900000: 459, // lt - 0x169000b4: 460, // lt-LT - 0x16b00000: 461, // lu - 0x16b0004a: 462, // lu-CD - 0x16d00000: 463, // luo - 0x16d000a2: 464, // luo-KE - 0x16e00000: 465, // luy - 0x16e000a2: 466, // luy-KE - 0x17000000: 467, // lv - 0x170000b6: 468, // lv-LV - 0x17a00000: 469, // mas - 0x17a000a2: 470, // mas-KE - 0x17a0012d: 471, // mas-TZ - 0x18000000: 472, // mer - 0x180000a2: 473, // mer-KE - 0x18200000: 474, // mfe - 0x182000ca: 475, // mfe-MU - 0x18300000: 476, // mg - 0x183000bd: 477, // mg-MG - 0x18400000: 478, // mgh - 0x184000cf: 479, // mgh-MZ - 0x18500000: 480, // mgo - 0x18500051: 481, // mgo-CM - 0x18c00000: 482, // mk - 0x18c000c0: 483, // mk-MK - 0x18d00000: 484, // ml - 0x18d00097: 485, // ml-IN - 0x18f00000: 486, // mn - 0x18f000c3: 487, // mn-MN - 0x19600000: 488, // mr - 0x19600097: 489, // mr-IN - 0x19a00000: 490, // ms - 0x19a0003d: 491, // ms-BN - 0x19a000ce: 492, // ms-MY - 0x19a0010b: 493, // ms-SG - 0x19b00000: 494, // mt - 0x19b000c9: 495, // mt-MT - 0x19d00000: 496, // mua - 0x19d00051: 497, // mua-CM - 0x1a500000: 498, // my - 0x1a5000c2: 499, // my-MM - 0x1a900000: 500, // mzn - 0x1a90009a: 501, // mzn-IR - 0x1ab00000: 502, // nah - 0x1ae00000: 503, // naq - 0x1ae000d0: 504, // naq-NA - 0x1af00000: 505, // nb - 0x1af000d8: 506, // nb-NO - 0x1af0010e: 507, // nb-SJ - 0x1b100000: 508, // nd - 0x1b100161: 509, // nd-ZW - 0x1b400000: 510, // ne - 0x1b400097: 511, // ne-IN - 0x1b4000d9: 512, // ne-NP - 0x1bd00000: 513, // nl - 0x1bd0002f: 514, // nl-AW - 0x1bd00035: 515, // nl-BE - 0x1bd0003f: 516, // nl-BQ - 0x1bd0005a: 517, // nl-CW - 0x1bd000d7: 518, // nl-NL - 0x1bd00114: 519, // nl-SR - 0x1bd00119: 520, // nl-SX - 0x1be00000: 521, // nmg - 0x1be00051: 522, // nmg-CM - 0x1bf00000: 523, // nn - 0x1bf000d8: 524, // nn-NO - 0x1c000000: 525, // nnh - 0x1c000051: 526, // nnh-CM - 0x1c100000: 527, // no - 0x1c500000: 528, // nqo - 0x1c600000: 529, // nr - 0x1c800000: 530, // nso - 0x1c900000: 531, // nus - 0x1c900115: 532, // nus-SS - 0x1cc00000: 533, // ny - 0x1ce00000: 534, // nyn - 0x1ce0012f: 535, // nyn-UG - 0x1d200000: 536, // om - 0x1d20006e: 537, // om-ET - 0x1d2000a2: 538, // om-KE - 0x1d300000: 539, // or - 0x1d300097: 540, // or-IN - 0x1d400000: 541, // os - 0x1d40007b: 542, // os-GE - 0x1d400104: 543, // os-RU - 0x1d700000: 544, // pa - 0x1d705000: 545, // pa-Arab - 0x1d7050e6: 546, // pa-Arab-PK - 0x1d72f000: 547, // pa-Guru - 0x1d72f097: 548, // pa-Guru-IN - 0x1db00000: 549, // pap - 0x1e700000: 550, // pl - 0x1e7000e7: 551, // pl-PL - 0x1ed00000: 552, // prg - 0x1ed00001: 553, // prg-001 - 0x1ee00000: 554, // ps - 0x1ee00023: 555, // ps-AF - 0x1ef00000: 556, // pt - 0x1ef00029: 557, // pt-AO - 0x1ef00040: 558, // pt-BR - 0x1ef0004d: 559, // pt-CH - 0x1ef00059: 560, // pt-CV - 0x1ef00084: 561, // pt-GQ - 0x1ef00089: 562, // pt-GW - 0x1ef000b5: 563, // pt-LU - 0x1ef000c4: 564, // pt-MO - 0x1ef000cf: 565, // pt-MZ - 0x1ef000ec: 566, // pt-PT - 0x1ef00116: 567, // pt-ST - 0x1ef00124: 568, // pt-TL - 0x1f100000: 569, // qu - 0x1f10003e: 570, // qu-BO - 0x1f100068: 571, // qu-EC - 0x1f1000e2: 572, // qu-PE - 0x1fc00000: 573, // rm - 0x1fc0004d: 574, // rm-CH - 0x20100000: 575, // rn - 0x20100039: 576, // rn-BI - 0x20300000: 577, // ro - 0x203000ba: 578, // ro-MD - 0x20300102: 579, // ro-RO - 0x20500000: 580, // rof - 0x2050012d: 581, // rof-TZ - 0x20700000: 582, // ru - 0x20700046: 583, // ru-BY - 0x207000a3: 584, // ru-KG - 0x207000ac: 585, // ru-KZ - 0x207000ba: 586, // ru-MD - 0x20700104: 587, // ru-RU - 0x2070012e: 588, // ru-UA - 0x20a00000: 589, // rw - 0x20a00105: 590, // rw-RW - 0x20b00000: 591, // rwk - 0x20b0012d: 592, // rwk-TZ - 0x20f00000: 593, // sah - 0x20f00104: 594, // sah-RU - 0x21000000: 595, // saq - 0x210000a2: 596, // saq-KE - 0x21400000: 597, // sbp - 0x2140012d: 598, // sbp-TZ - 0x21c00000: 599, // sdh - 0x21d00000: 600, // se - 0x21d00070: 601, // se-FI - 0x21d000d8: 602, // se-NO - 0x21d0010a: 603, // se-SE - 0x21f00000: 604, // seh - 0x21f000cf: 605, // seh-MZ - 0x22100000: 606, // ses - 0x221000c1: 607, // ses-ML - 0x22200000: 608, // sg - 0x2220004b: 609, // sg-CF - 0x22600000: 610, // shi - 0x22652000: 611, // shi-Latn - 0x226520b8: 612, // shi-Latn-MA - 0x226d2000: 613, // shi-Tfng - 0x226d20b8: 614, // shi-Tfng-MA - 0x22800000: 615, // si - 0x228000b1: 616, // si-LK - 0x22a00000: 617, // sk - 0x22a0010f: 618, // sk-SK - 0x22c00000: 619, // sl - 0x22c0010d: 620, // sl-SI - 0x23000000: 621, // sma - 0x23100000: 622, // smi - 0x23200000: 623, // smj - 0x23300000: 624, // smn - 0x23300070: 625, // smn-FI - 0x23500000: 626, // sms - 0x23600000: 627, // sn - 0x23600161: 628, // sn-ZW - 0x23800000: 629, // so - 0x23800061: 630, // so-DJ - 0x2380006e: 631, // so-ET - 0x238000a2: 632, // so-KE - 0x23800113: 633, // so-SO - 0x23a00000: 634, // sq - 0x23a00026: 635, // sq-AL - 0x23a000c0: 636, // sq-MK - 0x23a0014a: 637, // sq-XK - 0x23b00000: 638, // sr - 0x23b1e000: 639, // sr-Cyrl - 0x23b1e032: 640, // sr-Cyrl-BA - 0x23b1e0bb: 641, // sr-Cyrl-ME - 0x23b1e103: 642, // sr-Cyrl-RS - 0x23b1e14a: 643, // sr-Cyrl-XK - 0x23b52000: 644, // sr-Latn - 0x23b52032: 645, // sr-Latn-BA - 0x23b520bb: 646, // sr-Latn-ME - 0x23b52103: 647, // sr-Latn-RS - 0x23b5214a: 648, // sr-Latn-XK - 0x24000000: 649, // ss - 0x24100000: 650, // ssy - 0x24200000: 651, // st - 0x24700000: 652, // sv - 0x24700030: 653, // sv-AX - 0x24700070: 654, // sv-FI - 0x2470010a: 655, // sv-SE - 0x24800000: 656, // sw - 0x2480004a: 657, // sw-CD - 0x248000a2: 658, // sw-KE - 0x2480012d: 659, // sw-TZ - 0x2480012f: 660, // sw-UG - 0x24f00000: 661, // syr - 0x25100000: 662, // ta - 0x25100097: 663, // ta-IN - 0x251000b1: 664, // ta-LK - 0x251000ce: 665, // ta-MY - 0x2510010b: 666, // ta-SG - 0x25800000: 667, // te - 0x25800097: 668, // te-IN - 0x25a00000: 669, // teo - 0x25a000a2: 670, // teo-KE - 0x25a0012f: 671, // teo-UG - 0x25d00000: 672, // th - 0x25d00121: 673, // th-TH - 0x26100000: 674, // ti - 0x2610006c: 675, // ti-ER - 0x2610006e: 676, // ti-ET - 0x26200000: 677, // tig - 0x26400000: 678, // tk - 0x26400125: 679, // tk-TM - 0x26b00000: 680, // tn - 0x26c00000: 681, // to - 0x26c00127: 682, // to-TO - 0x26f00000: 683, // tr - 0x26f0005c: 684, // tr-CY - 0x26f00129: 685, // tr-TR - 0x27200000: 686, // ts - 0x27e00000: 687, // twq - 0x27e000d2: 688, // twq-NE - 0x28200000: 689, // tzm - 0x282000b8: 690, // tzm-MA - 0x28400000: 691, // ug - 0x28400052: 692, // ug-CN - 0x28600000: 693, // uk - 0x2860012e: 694, // uk-UA - 0x28c00000: 695, // ur - 0x28c00097: 696, // ur-IN - 0x28c000e6: 697, // ur-PK - 0x28d00000: 698, // uz - 0x28d05000: 699, // uz-Arab - 0x28d05023: 700, // uz-Arab-AF - 0x28d1e000: 701, // uz-Cyrl - 0x28d1e134: 702, // uz-Cyrl-UZ - 0x28d52000: 703, // uz-Latn - 0x28d52134: 704, // uz-Latn-UZ - 0x28e00000: 705, // vai - 0x28e52000: 706, // vai-Latn - 0x28e520b2: 707, // vai-Latn-LR - 0x28ed9000: 708, // vai-Vaii - 0x28ed90b2: 709, // vai-Vaii-LR - 0x28f00000: 710, // ve - 0x29200000: 711, // vi - 0x2920013b: 712, // vi-VN - 0x29700000: 713, // vo - 0x29700001: 714, // vo-001 - 0x29a00000: 715, // vun - 0x29a0012d: 716, // vun-TZ - 0x29b00000: 717, // wa - 0x29c00000: 718, // wae - 0x29c0004d: 719, // wae-CH - 0x2a400000: 720, // wo - 0x2a900000: 721, // xh - 0x2b100000: 722, // xog - 0x2b10012f: 723, // xog-UG - 0x2b700000: 724, // yav - 0x2b700051: 725, // yav-CM - 0x2b900000: 726, // yi - 0x2b900001: 727, // yi-001 - 0x2ba00000: 728, // yo - 0x2ba0003a: 729, // yo-BJ - 0x2ba000d4: 730, // yo-NG - 0x2bd00000: 731, // yue - 0x2bd0008b: 732, // yue-HK - 0x2c300000: 733, // zgh - 0x2c3000b8: 734, // zgh-MA - 0x2c400000: 735, // zh - 0x2c434000: 736, // zh-Hans - 0x2c434052: 737, // zh-Hans-CN - 0x2c43408b: 738, // zh-Hans-HK - 0x2c4340c4: 739, // zh-Hans-MO - 0x2c43410b: 740, // zh-Hans-SG - 0x2c435000: 741, // zh-Hant - 0x2c43508b: 742, // zh-Hant-HK - 0x2c4350c4: 743, // zh-Hant-MO - 0x2c43512c: 744, // zh-Hant-TW - 0x2c600000: 745, // zu - 0x2c60015e: 746, // zu-ZA + 0x01600000: 3, // af + 0x016000d1: 4, // af-NA + 0x01600160: 5, // af-ZA + 0x01c00000: 6, // agq + 0x01c00051: 7, // agq-CM + 0x02100000: 8, // ak + 0x0210007f: 9, // ak-GH + 0x02700000: 10, // am + 0x0270006e: 11, // am-ET + 0x03a00000: 12, // ar + 0x03a00001: 13, // ar-001 + 0x03a00022: 14, // ar-AE + 0x03a00038: 15, // ar-BH + 0x03a00061: 16, // ar-DJ + 0x03a00066: 17, // ar-DZ + 0x03a0006a: 18, // ar-EG + 0x03a0006b: 19, // ar-EH + 0x03a0006c: 20, // ar-ER + 0x03a00096: 21, // ar-IL + 0x03a0009a: 22, // ar-IQ + 0x03a000a0: 23, // ar-JO + 0x03a000a7: 24, // ar-KM + 0x03a000ab: 25, // ar-KW + 0x03a000af: 26, // ar-LB + 0x03a000b8: 27, // ar-LY + 0x03a000b9: 28, // ar-MA + 0x03a000c8: 29, // ar-MR + 0x03a000e0: 30, // ar-OM + 0x03a000ec: 31, // ar-PS + 0x03a000f2: 32, // ar-QA + 0x03a00107: 33, // ar-SA + 0x03a0010a: 34, // ar-SD + 0x03a00114: 35, // ar-SO + 0x03a00116: 36, // ar-SS + 0x03a0011b: 37, // ar-SY + 0x03a0011f: 38, // ar-TD + 0x03a00127: 39, // ar-TN + 0x03a0015d: 40, // ar-YE + 0x04000000: 41, // ars + 0x04300000: 42, // as + 0x04300098: 43, // as-IN + 0x04400000: 44, // asa + 0x0440012e: 45, // asa-TZ + 0x04800000: 46, // ast + 0x0480006d: 47, // ast-ES + 0x05800000: 48, // az + 0x0581e000: 49, // az-Cyrl + 0x0581e031: 50, // az-Cyrl-AZ + 0x05852000: 51, // az-Latn + 0x05852031: 52, // az-Latn-AZ + 0x05e00000: 53, // bas + 0x05e00051: 54, // bas-CM + 0x07100000: 55, // be + 0x07100046: 56, // be-BY + 0x07500000: 57, // bem + 0x07500161: 58, // bem-ZM + 0x07900000: 59, // bez + 0x0790012e: 60, // bez-TZ + 0x07e00000: 61, // bg + 0x07e00037: 62, // bg-BG + 0x08200000: 63, // bh + 0x0a000000: 64, // bm + 0x0a0000c2: 65, // bm-ML + 0x0a500000: 66, // bn + 0x0a500034: 67, // bn-BD + 0x0a500098: 68, // bn-IN + 0x0a900000: 69, // bo + 0x0a900052: 70, // bo-CN + 0x0a900098: 71, // bo-IN + 0x0b200000: 72, // br + 0x0b200077: 73, // br-FR + 0x0b500000: 74, // brx + 0x0b500098: 75, // brx-IN + 0x0b700000: 76, // bs + 0x0b71e000: 77, // bs-Cyrl + 0x0b71e032: 78, // bs-Cyrl-BA + 0x0b752000: 79, // bs-Latn + 0x0b752032: 80, // bs-Latn-BA + 0x0d700000: 81, // ca + 0x0d700021: 82, // ca-AD + 0x0d70006d: 83, // ca-ES + 0x0d700077: 84, // ca-FR + 0x0d70009d: 85, // ca-IT + 0x0dc00000: 86, // ce + 0x0dc00105: 87, // ce-RU + 0x0df00000: 88, // cgg + 0x0df00130: 89, // cgg-UG + 0x0e500000: 90, // chr + 0x0e500134: 91, // chr-US + 0x0e900000: 92, // ckb + 0x0e90009a: 93, // ckb-IQ + 0x0e90009b: 94, // ckb-IR + 0x0f900000: 95, // cs + 0x0f90005d: 96, // cs-CZ + 0x0fd00000: 97, // cu + 0x0fd00105: 98, // cu-RU + 0x0ff00000: 99, // cy + 0x0ff0007a: 100, // cy-GB + 0x10000000: 101, // da + 0x10000062: 102, // da-DK + 0x10000081: 103, // da-GL + 0x10700000: 104, // dav + 0x107000a3: 105, // dav-KE + 0x10c00000: 106, // de + 0x10c0002d: 107, // de-AT + 0x10c00035: 108, // de-BE + 0x10c0004d: 109, // de-CH + 0x10c0005f: 110, // de-DE + 0x10c0009d: 111, // de-IT + 0x10c000b1: 112, // de-LI + 0x10c000b6: 113, // de-LU + 0x11600000: 114, // dje + 0x116000d3: 115, // dje-NE + 0x11e00000: 116, // dsb + 0x11e0005f: 117, // dsb-DE + 0x12300000: 118, // dua + 0x12300051: 119, // dua-CM + 0x12700000: 120, // dv + 0x12a00000: 121, // dyo + 0x12a00113: 122, // dyo-SN + 0x12c00000: 123, // dz + 0x12c00042: 124, // dz-BT + 0x12e00000: 125, // ebu + 0x12e000a3: 126, // ebu-KE + 0x12f00000: 127, // ee + 0x12f0007f: 128, // ee-GH + 0x12f00121: 129, // ee-TG + 0x13500000: 130, // el + 0x1350005c: 131, // el-CY + 0x13500086: 132, // el-GR + 0x13800000: 133, // en + 0x13800001: 134, // en-001 + 0x1380001a: 135, // en-150 + 0x13800024: 136, // en-AG + 0x13800025: 137, // en-AI + 0x1380002c: 138, // en-AS + 0x1380002d: 139, // en-AT + 0x1380002e: 140, // en-AU + 0x13800033: 141, // en-BB + 0x13800035: 142, // en-BE + 0x13800039: 143, // en-BI + 0x1380003c: 144, // en-BM + 0x13800041: 145, // en-BS + 0x13800045: 146, // en-BW + 0x13800047: 147, // en-BZ + 0x13800048: 148, // en-CA + 0x13800049: 149, // en-CC + 0x1380004d: 150, // en-CH + 0x1380004f: 151, // en-CK + 0x13800051: 152, // en-CM + 0x1380005b: 153, // en-CX + 0x1380005c: 154, // en-CY + 0x1380005f: 155, // en-DE + 0x13800060: 156, // en-DG + 0x13800062: 157, // en-DK + 0x13800063: 158, // en-DM + 0x1380006c: 159, // en-ER + 0x13800071: 160, // en-FI + 0x13800072: 161, // en-FJ + 0x13800073: 162, // en-FK + 0x13800074: 163, // en-FM + 0x1380007a: 164, // en-GB + 0x1380007b: 165, // en-GD + 0x1380007e: 166, // en-GG + 0x1380007f: 167, // en-GH + 0x13800080: 168, // en-GI + 0x13800082: 169, // en-GM + 0x13800089: 170, // en-GU + 0x1380008b: 171, // en-GY + 0x1380008c: 172, // en-HK + 0x13800095: 173, // en-IE + 0x13800096: 174, // en-IL + 0x13800097: 175, // en-IM + 0x13800098: 176, // en-IN + 0x13800099: 177, // en-IO + 0x1380009e: 178, // en-JE + 0x1380009f: 179, // en-JM + 0x138000a3: 180, // en-KE + 0x138000a6: 181, // en-KI + 0x138000a8: 182, // en-KN + 0x138000ac: 183, // en-KY + 0x138000b0: 184, // en-LC + 0x138000b3: 185, // en-LR + 0x138000b4: 186, // en-LS + 0x138000be: 187, // en-MG + 0x138000bf: 188, // en-MH + 0x138000c5: 189, // en-MO + 0x138000c6: 190, // en-MP + 0x138000c9: 191, // en-MS + 0x138000ca: 192, // en-MT + 0x138000cb: 193, // en-MU + 0x138000cd: 194, // en-MW + 0x138000cf: 195, // en-MY + 0x138000d1: 196, // en-NA + 0x138000d4: 197, // en-NF + 0x138000d5: 198, // en-NG + 0x138000d8: 199, // en-NL + 0x138000dc: 200, // en-NR + 0x138000de: 201, // en-NU + 0x138000df: 202, // en-NZ + 0x138000e5: 203, // en-PG + 0x138000e6: 204, // en-PH + 0x138000e7: 205, // en-PK + 0x138000ea: 206, // en-PN + 0x138000eb: 207, // en-PR + 0x138000ef: 208, // en-PW + 0x13800106: 209, // en-RW + 0x13800108: 210, // en-SB + 0x13800109: 211, // en-SC + 0x1380010a: 212, // en-SD + 0x1380010b: 213, // en-SE + 0x1380010c: 214, // en-SG + 0x1380010d: 215, // en-SH + 0x1380010e: 216, // en-SI + 0x13800111: 217, // en-SL + 0x13800116: 218, // en-SS + 0x1380011a: 219, // en-SX + 0x1380011c: 220, // en-SZ + 0x1380011e: 221, // en-TC + 0x13800124: 222, // en-TK + 0x13800128: 223, // en-TO + 0x1380012b: 224, // en-TT + 0x1380012c: 225, // en-TV + 0x1380012e: 226, // en-TZ + 0x13800130: 227, // en-UG + 0x13800132: 228, // en-UM + 0x13800134: 229, // en-US + 0x13800138: 230, // en-VC + 0x1380013b: 231, // en-VG + 0x1380013c: 232, // en-VI + 0x1380013e: 233, // en-VU + 0x13800141: 234, // en-WS + 0x13800160: 235, // en-ZA + 0x13800161: 236, // en-ZM + 0x13800163: 237, // en-ZW + 0x13b00000: 238, // eo + 0x13b00001: 239, // eo-001 + 0x13d00000: 240, // es + 0x13d0001e: 241, // es-419 + 0x13d0002b: 242, // es-AR + 0x13d0003e: 243, // es-BO + 0x13d00040: 244, // es-BR + 0x13d00047: 245, // es-BZ + 0x13d00050: 246, // es-CL + 0x13d00053: 247, // es-CO + 0x13d00055: 248, // es-CR + 0x13d00058: 249, // es-CU + 0x13d00064: 250, // es-DO + 0x13d00067: 251, // es-EA + 0x13d00068: 252, // es-EC + 0x13d0006d: 253, // es-ES + 0x13d00085: 254, // es-GQ + 0x13d00088: 255, // es-GT + 0x13d0008e: 256, // es-HN + 0x13d00093: 257, // es-IC + 0x13d000ce: 258, // es-MX + 0x13d000d7: 259, // es-NI + 0x13d000e1: 260, // es-PA + 0x13d000e3: 261, // es-PE + 0x13d000e6: 262, // es-PH + 0x13d000eb: 263, // es-PR + 0x13d000f0: 264, // es-PY + 0x13d00119: 265, // es-SV + 0x13d00134: 266, // es-US + 0x13d00135: 267, // es-UY + 0x13d0013a: 268, // es-VE + 0x13f00000: 269, // et + 0x13f00069: 270, // et-EE + 0x14400000: 271, // eu + 0x1440006d: 272, // eu-ES + 0x14500000: 273, // ewo + 0x14500051: 274, // ewo-CM + 0x14700000: 275, // fa + 0x14700023: 276, // fa-AF + 0x1470009b: 277, // fa-IR + 0x14d00000: 278, // ff + 0x14d00051: 279, // ff-CM + 0x14d00083: 280, // ff-GN + 0x14d000c8: 281, // ff-MR + 0x14d00113: 282, // ff-SN + 0x15000000: 283, // fi + 0x15000071: 284, // fi-FI + 0x15200000: 285, // fil + 0x152000e6: 286, // fil-PH + 0x15700000: 287, // fo + 0x15700062: 288, // fo-DK + 0x15700075: 289, // fo-FO + 0x15d00000: 290, // fr + 0x15d00035: 291, // fr-BE + 0x15d00036: 292, // fr-BF + 0x15d00039: 293, // fr-BI + 0x15d0003a: 294, // fr-BJ + 0x15d0003b: 295, // fr-BL + 0x15d00048: 296, // fr-CA + 0x15d0004a: 297, // fr-CD + 0x15d0004b: 298, // fr-CF + 0x15d0004c: 299, // fr-CG + 0x15d0004d: 300, // fr-CH + 0x15d0004e: 301, // fr-CI + 0x15d00051: 302, // fr-CM + 0x15d00061: 303, // fr-DJ + 0x15d00066: 304, // fr-DZ + 0x15d00077: 305, // fr-FR + 0x15d00079: 306, // fr-GA + 0x15d0007d: 307, // fr-GF + 0x15d00083: 308, // fr-GN + 0x15d00084: 309, // fr-GP + 0x15d00085: 310, // fr-GQ + 0x15d00090: 311, // fr-HT + 0x15d000a7: 312, // fr-KM + 0x15d000b6: 313, // fr-LU + 0x15d000b9: 314, // fr-MA + 0x15d000ba: 315, // fr-MC + 0x15d000bd: 316, // fr-MF + 0x15d000be: 317, // fr-MG + 0x15d000c2: 318, // fr-ML + 0x15d000c7: 319, // fr-MQ + 0x15d000c8: 320, // fr-MR + 0x15d000cb: 321, // fr-MU + 0x15d000d2: 322, // fr-NC + 0x15d000d3: 323, // fr-NE + 0x15d000e4: 324, // fr-PF + 0x15d000e9: 325, // fr-PM + 0x15d00101: 326, // fr-RE + 0x15d00106: 327, // fr-RW + 0x15d00109: 328, // fr-SC + 0x15d00113: 329, // fr-SN + 0x15d0011b: 330, // fr-SY + 0x15d0011f: 331, // fr-TD + 0x15d00121: 332, // fr-TG + 0x15d00127: 333, // fr-TN + 0x15d0013e: 334, // fr-VU + 0x15d0013f: 335, // fr-WF + 0x15d0015e: 336, // fr-YT + 0x16800000: 337, // fur + 0x1680009d: 338, // fur-IT + 0x16c00000: 339, // fy + 0x16c000d8: 340, // fy-NL + 0x16d00000: 341, // ga + 0x16d00095: 342, // ga-IE + 0x17c00000: 343, // gd + 0x17c0007a: 344, // gd-GB + 0x18e00000: 345, // gl + 0x18e0006d: 346, // gl-ES + 0x1a100000: 347, // gsw + 0x1a10004d: 348, // gsw-CH + 0x1a100077: 349, // gsw-FR + 0x1a1000b1: 350, // gsw-LI + 0x1a200000: 351, // gu + 0x1a200098: 352, // gu-IN + 0x1a700000: 353, // guw + 0x1a900000: 354, // guz + 0x1a9000a3: 355, // guz-KE + 0x1aa00000: 356, // gv + 0x1aa00097: 357, // gv-IM + 0x1b200000: 358, // ha + 0x1b20007f: 359, // ha-GH + 0x1b2000d3: 360, // ha-NE + 0x1b2000d5: 361, // ha-NG + 0x1b600000: 362, // haw + 0x1b600134: 363, // haw-US + 0x1ba00000: 364, // he + 0x1ba00096: 365, // he-IL + 0x1bc00000: 366, // hi + 0x1bc00098: 367, // hi-IN + 0x1cf00000: 368, // hr + 0x1cf00032: 369, // hr-BA + 0x1cf0008f: 370, // hr-HR + 0x1d000000: 371, // hsb + 0x1d00005f: 372, // hsb-DE + 0x1d300000: 373, // hu + 0x1d300091: 374, // hu-HU + 0x1d500000: 375, // hy + 0x1d500027: 376, // hy-AM + 0x1df00000: 377, // id + 0x1df00094: 378, // id-ID + 0x1e500000: 379, // ig + 0x1e5000d5: 380, // ig-NG + 0x1e800000: 381, // ii + 0x1e800052: 382, // ii-CN + 0x1f600000: 383, // is + 0x1f60009c: 384, // is-IS + 0x1f700000: 385, // it + 0x1f70004d: 386, // it-CH + 0x1f70009d: 387, // it-IT + 0x1f700112: 388, // it-SM + 0x1f700137: 389, // it-VA + 0x1f800000: 390, // iu + 0x1fe00000: 391, // ja + 0x1fe000a1: 392, // ja-JP + 0x20100000: 393, // jbo + 0x20500000: 394, // jgo + 0x20500051: 395, // jgo-CM + 0x20800000: 396, // jmc + 0x2080012e: 397, // jmc-TZ + 0x20c00000: 398, // jv + 0x20e00000: 399, // ka + 0x20e0007c: 400, // ka-GE + 0x21000000: 401, // kab + 0x21000066: 402, // kab-DZ + 0x21400000: 403, // kaj + 0x21500000: 404, // kam + 0x215000a3: 405, // kam-KE + 0x21d00000: 406, // kcg + 0x22100000: 407, // kde + 0x2210012e: 408, // kde-TZ + 0x22500000: 409, // kea + 0x22500059: 410, // kea-CV + 0x23200000: 411, // khq + 0x232000c2: 412, // khq-ML + 0x23700000: 413, // ki + 0x237000a3: 414, // ki-KE + 0x24000000: 415, // kk + 0x240000ad: 416, // kk-KZ + 0x24200000: 417, // kkj + 0x24200051: 418, // kkj-CM + 0x24300000: 419, // kl + 0x24300081: 420, // kl-GL + 0x24400000: 421, // kln + 0x244000a3: 422, // kln-KE + 0x24800000: 423, // km + 0x248000a5: 424, // km-KH + 0x24f00000: 425, // kn + 0x24f00098: 426, // kn-IN + 0x25200000: 427, // ko + 0x252000a9: 428, // ko-KP + 0x252000aa: 429, // ko-KR + 0x25400000: 430, // kok + 0x25400098: 431, // kok-IN + 0x26800000: 432, // ks + 0x26800098: 433, // ks-IN + 0x26900000: 434, // ksb + 0x2690012e: 435, // ksb-TZ + 0x26b00000: 436, // ksf + 0x26b00051: 437, // ksf-CM + 0x26c00000: 438, // ksh + 0x26c0005f: 439, // ksh-DE + 0x27200000: 440, // ku + 0x27f00000: 441, // kw + 0x27f0007a: 442, // kw-GB + 0x28800000: 443, // ky + 0x288000a4: 444, // ky-KG + 0x28f00000: 445, // lag + 0x28f0012e: 446, // lag-TZ + 0x29300000: 447, // lb + 0x293000b6: 448, // lb-LU + 0x2a100000: 449, // lg + 0x2a100130: 450, // lg-UG + 0x2ad00000: 451, // lkt + 0x2ad00134: 452, // lkt-US + 0x2b300000: 453, // ln + 0x2b300029: 454, // ln-AO + 0x2b30004a: 455, // ln-CD + 0x2b30004b: 456, // ln-CF + 0x2b30004c: 457, // ln-CG + 0x2b600000: 458, // lo + 0x2b6000ae: 459, // lo-LA + 0x2bd00000: 460, // lrc + 0x2bd0009a: 461, // lrc-IQ + 0x2bd0009b: 462, // lrc-IR + 0x2be00000: 463, // lt + 0x2be000b5: 464, // lt-LT + 0x2c000000: 465, // lu + 0x2c00004a: 466, // lu-CD + 0x2c200000: 467, // luo + 0x2c2000a3: 468, // luo-KE + 0x2c300000: 469, // luy + 0x2c3000a3: 470, // luy-KE + 0x2c500000: 471, // lv + 0x2c5000b7: 472, // lv-LV + 0x2cf00000: 473, // mas + 0x2cf000a3: 474, // mas-KE + 0x2cf0012e: 475, // mas-TZ + 0x2e700000: 476, // mer + 0x2e7000a3: 477, // mer-KE + 0x2eb00000: 478, // mfe + 0x2eb000cb: 479, // mfe-MU + 0x2ef00000: 480, // mg + 0x2ef000be: 481, // mg-MG + 0x2f000000: 482, // mgh + 0x2f0000d0: 483, // mgh-MZ + 0x2f200000: 484, // mgo + 0x2f200051: 485, // mgo-CM + 0x2fd00000: 486, // mk + 0x2fd000c1: 487, // mk-MK + 0x30200000: 488, // ml + 0x30200098: 489, // ml-IN + 0x30900000: 490, // mn + 0x309000c4: 491, // mn-MN + 0x31900000: 492, // mr + 0x31900098: 493, // mr-IN + 0x31d00000: 494, // ms + 0x31d0003d: 495, // ms-BN + 0x31d000cf: 496, // ms-MY + 0x31d0010c: 497, // ms-SG + 0x31e00000: 498, // mt + 0x31e000ca: 499, // mt-MT + 0x32300000: 500, // mua + 0x32300051: 501, // mua-CM + 0x32f00000: 502, // my + 0x32f000c3: 503, // my-MM + 0x33800000: 504, // mzn + 0x3380009b: 505, // mzn-IR + 0x33f00000: 506, // nah + 0x34300000: 507, // naq + 0x343000d1: 508, // naq-NA + 0x34500000: 509, // nb + 0x345000d9: 510, // nb-NO + 0x3450010f: 511, // nb-SJ + 0x34c00000: 512, // nd + 0x34c00163: 513, // nd-ZW + 0x34e00000: 514, // nds + 0x34e0005f: 515, // nds-DE + 0x34e000d8: 516, // nds-NL + 0x34f00000: 517, // ne + 0x34f00098: 518, // ne-IN + 0x34f000da: 519, // ne-NP + 0x36500000: 520, // nl + 0x3650002f: 521, // nl-AW + 0x36500035: 522, // nl-BE + 0x3650003f: 523, // nl-BQ + 0x3650005a: 524, // nl-CW + 0x365000d8: 525, // nl-NL + 0x36500115: 526, // nl-SR + 0x3650011a: 527, // nl-SX + 0x36600000: 528, // nmg + 0x36600051: 529, // nmg-CM + 0x36800000: 530, // nn + 0x368000d9: 531, // nn-NO + 0x36a00000: 532, // nnh + 0x36a00051: 533, // nnh-CM + 0x36d00000: 534, // no + 0x37300000: 535, // nqo + 0x37400000: 536, // nr + 0x37800000: 537, // nso + 0x37e00000: 538, // nus + 0x37e00116: 539, // nus-SS + 0x38500000: 540, // ny + 0x38700000: 541, // nyn + 0x38700130: 542, // nyn-UG + 0x38e00000: 543, // om + 0x38e0006e: 544, // om-ET + 0x38e000a3: 545, // om-KE + 0x39300000: 546, // or + 0x39300098: 547, // or-IN + 0x39600000: 548, // os + 0x3960007c: 549, // os-GE + 0x39600105: 550, // os-RU + 0x39b00000: 551, // pa + 0x39b05000: 552, // pa-Arab + 0x39b050e7: 553, // pa-Arab-PK + 0x39b2f000: 554, // pa-Guru + 0x39b2f098: 555, // pa-Guru-IN + 0x39f00000: 556, // pap + 0x3b100000: 557, // pl + 0x3b1000e8: 558, // pl-PL + 0x3bb00000: 559, // prg + 0x3bb00001: 560, // prg-001 + 0x3bc00000: 561, // ps + 0x3bc00023: 562, // ps-AF + 0x3be00000: 563, // pt + 0x3be00029: 564, // pt-AO + 0x3be00040: 565, // pt-BR + 0x3be0004d: 566, // pt-CH + 0x3be00059: 567, // pt-CV + 0x3be00085: 568, // pt-GQ + 0x3be0008a: 569, // pt-GW + 0x3be000b6: 570, // pt-LU + 0x3be000c5: 571, // pt-MO + 0x3be000d0: 572, // pt-MZ + 0x3be000ed: 573, // pt-PT + 0x3be00117: 574, // pt-ST + 0x3be00125: 575, // pt-TL + 0x3c200000: 576, // qu + 0x3c20003e: 577, // qu-BO + 0x3c200068: 578, // qu-EC + 0x3c2000e3: 579, // qu-PE + 0x3d200000: 580, // rm + 0x3d20004d: 581, // rm-CH + 0x3d700000: 582, // rn + 0x3d700039: 583, // rn-BI + 0x3da00000: 584, // ro + 0x3da000bb: 585, // ro-MD + 0x3da00103: 586, // ro-RO + 0x3dc00000: 587, // rof + 0x3dc0012e: 588, // rof-TZ + 0x3e000000: 589, // ru + 0x3e000046: 590, // ru-BY + 0x3e0000a4: 591, // ru-KG + 0x3e0000ad: 592, // ru-KZ + 0x3e0000bb: 593, // ru-MD + 0x3e000105: 594, // ru-RU + 0x3e00012f: 595, // ru-UA + 0x3e300000: 596, // rw + 0x3e300106: 597, // rw-RW + 0x3e400000: 598, // rwk + 0x3e40012e: 599, // rwk-TZ + 0x3e900000: 600, // sah + 0x3e900105: 601, // sah-RU + 0x3ea00000: 602, // saq + 0x3ea000a3: 603, // saq-KE + 0x3f100000: 604, // sbp + 0x3f10012e: 605, // sbp-TZ + 0x3fa00000: 606, // sdh + 0x3fb00000: 607, // se + 0x3fb00071: 608, // se-FI + 0x3fb000d9: 609, // se-NO + 0x3fb0010b: 610, // se-SE + 0x3fd00000: 611, // seh + 0x3fd000d0: 612, // seh-MZ + 0x3ff00000: 613, // ses + 0x3ff000c2: 614, // ses-ML + 0x40000000: 615, // sg + 0x4000004b: 616, // sg-CF + 0x40600000: 617, // shi + 0x40652000: 618, // shi-Latn + 0x406520b9: 619, // shi-Latn-MA + 0x406d2000: 620, // shi-Tfng + 0x406d20b9: 621, // shi-Tfng-MA + 0x40a00000: 622, // si + 0x40a000b2: 623, // si-LK + 0x41000000: 624, // sk + 0x41000110: 625, // sk-SK + 0x41400000: 626, // sl + 0x4140010e: 627, // sl-SI + 0x41a00000: 628, // sma + 0x41b00000: 629, // smi + 0x41c00000: 630, // smj + 0x41d00000: 631, // smn + 0x41d00071: 632, // smn-FI + 0x42000000: 633, // sms + 0x42100000: 634, // sn + 0x42100163: 635, // sn-ZW + 0x42700000: 636, // so + 0x42700061: 637, // so-DJ + 0x4270006e: 638, // so-ET + 0x427000a3: 639, // so-KE + 0x42700114: 640, // so-SO + 0x42f00000: 641, // sq + 0x42f00026: 642, // sq-AL + 0x42f000c1: 643, // sq-MK + 0x42f0014c: 644, // sq-XK + 0x43000000: 645, // sr + 0x4301e000: 646, // sr-Cyrl + 0x4301e032: 647, // sr-Cyrl-BA + 0x4301e0bc: 648, // sr-Cyrl-ME + 0x4301e104: 649, // sr-Cyrl-RS + 0x4301e14c: 650, // sr-Cyrl-XK + 0x43052000: 651, // sr-Latn + 0x43052032: 652, // sr-Latn-BA + 0x430520bc: 653, // sr-Latn-ME + 0x43052104: 654, // sr-Latn-RS + 0x4305214c: 655, // sr-Latn-XK + 0x43500000: 656, // ss + 0x43800000: 657, // ssy + 0x43900000: 658, // st + 0x44200000: 659, // sv + 0x44200030: 660, // sv-AX + 0x44200071: 661, // sv-FI + 0x4420010b: 662, // sv-SE + 0x44300000: 663, // sw + 0x4430004a: 664, // sw-CD + 0x443000a3: 665, // sw-KE + 0x4430012e: 666, // sw-TZ + 0x44300130: 667, // sw-UG + 0x44c00000: 668, // syr + 0x44e00000: 669, // ta + 0x44e00098: 670, // ta-IN + 0x44e000b2: 671, // ta-LK + 0x44e000cf: 672, // ta-MY + 0x44e0010c: 673, // ta-SG + 0x45f00000: 674, // te + 0x45f00098: 675, // te-IN + 0x46200000: 676, // teo + 0x462000a3: 677, // teo-KE + 0x46200130: 678, // teo-UG + 0x46900000: 679, // th + 0x46900122: 680, // th-TH + 0x46d00000: 681, // ti + 0x46d0006c: 682, // ti-ER + 0x46d0006e: 683, // ti-ET + 0x46f00000: 684, // tig + 0x47400000: 685, // tk + 0x47400126: 686, // tk-TM + 0x47e00000: 687, // tn + 0x48000000: 688, // to + 0x48000128: 689, // to-TO + 0x48800000: 690, // tr + 0x4880005c: 691, // tr-CY + 0x4880012a: 692, // tr-TR + 0x48c00000: 693, // ts + 0x4a200000: 694, // twq + 0x4a2000d3: 695, // twq-NE + 0x4a700000: 696, // tzm + 0x4a7000b9: 697, // tzm-MA + 0x4aa00000: 698, // ug + 0x4aa00052: 699, // ug-CN + 0x4ac00000: 700, // uk + 0x4ac0012f: 701, // uk-UA + 0x4b200000: 702, // ur + 0x4b200098: 703, // ur-IN + 0x4b2000e7: 704, // ur-PK + 0x4ba00000: 705, // uz + 0x4ba05000: 706, // uz-Arab + 0x4ba05023: 707, // uz-Arab-AF + 0x4ba1e000: 708, // uz-Cyrl + 0x4ba1e136: 709, // uz-Cyrl-UZ + 0x4ba52000: 710, // uz-Latn + 0x4ba52136: 711, // uz-Latn-UZ + 0x4bc00000: 712, // vai + 0x4bc52000: 713, // vai-Latn + 0x4bc520b3: 714, // vai-Latn-LR + 0x4bcd9000: 715, // vai-Vaii + 0x4bcd90b3: 716, // vai-Vaii-LR + 0x4be00000: 717, // ve + 0x4c100000: 718, // vi + 0x4c10013d: 719, // vi-VN + 0x4c700000: 720, // vo + 0x4c700001: 721, // vo-001 + 0x4ca00000: 722, // vun + 0x4ca0012e: 723, // vun-TZ + 0x4cc00000: 724, // wa + 0x4cd00000: 725, // wae + 0x4cd0004d: 726, // wae-CH + 0x4e300000: 727, // wo + 0x4f000000: 728, // xh + 0x4f900000: 729, // xog + 0x4f900130: 730, // xog-UG + 0x50700000: 731, // yav + 0x50700051: 732, // yav-CM + 0x51000000: 733, // yi + 0x51000001: 734, // yi-001 + 0x51600000: 735, // yo + 0x5160003a: 736, // yo-BJ + 0x516000d5: 737, // yo-NG + 0x51d00000: 738, // yue + 0x51d0008c: 739, // yue-HK + 0x52600000: 740, // zgh + 0x526000b9: 741, // zgh-MA + 0x52700000: 742, // zh + 0x52734000: 743, // zh-Hans + 0x52734052: 744, // zh-Hans-CN + 0x5273408c: 745, // zh-Hans-HK + 0x527340c5: 746, // zh-Hans-MO + 0x5273410c: 747, // zh-Hans-SG + 0x52735000: 748, // zh-Hant + 0x5273508c: 749, // zh-Hant-HK + 0x527350c5: 750, // zh-Hant-MO + 0x5273512d: 751, // zh-Hant-TW + 0x52c00000: 752, // zu + 0x52c00160: 753, // zu-ZA } -// Total table size 4550 bytes (4KiB); checksum: B6D49547 +// Total table size 4592 bytes (4KiB); checksum: C25F8AFF diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go index 5c6dcbd..e2da1ab 100644 --- a/vendor/golang.org/x/text/language/language.go +++ b/vendor/golang.org/x/text/language/language.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:generate go run maketables.go gen_common.go -output tables.go +//go:generate go run gen.go gen_common.go -output tables.go //go:generate go run gen_index.go // Package language implements BCP 47 language tags and related functionality. @@ -129,8 +129,15 @@ const ( // specific language or locale. All language tag values are guaranteed to be // well-formed. type Tag struct { - lang langID - region regionID + lang langID + region regionID + // TODO: we will soon run out of positions for script. Idea: instead of + // storing lang, region, and script codes, store only the compact index and + // have a lookup table from this code to its expansion. This greatly speeds + // up table lookup, speed up common variant cases. + // This will also immediately free up 3 extra bytes. Also, the pVariant + // field can now be moved to the lookup table, as the compact index uniquely + // determines the offset of a possible variant. script scriptID pVariant byte // offset in str, includes preceding '-' pExt uint16 // offset of first extension, includes preceding '-' @@ -593,7 +600,7 @@ func (t Tag) Extension(x byte) (ext Extension, ok bool) { return Extension{ext}, true } } - return Extension{string(x)}, false + return Extension{}, false } // Extensions returns all extensions of t. diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go index eec72bc..63bc744 100644 --- a/vendor/golang.org/x/text/language/match.go +++ b/vendor/golang.org/x/text/language/match.go @@ -6,6 +6,16 @@ package language import "errors" +// A MatchOption configures a Matcher. +type MatchOption func(*matcher) + +// PreferSameScript will, in the absence of a match, result in the first +// preferred tag with the same script as a supported tag to match this supported +// tag. The default is currently true, but this may change in the future. +func PreferSameScript(preferSame bool) MatchOption { + return func(m *matcher) { m.preferSameScript = preferSame } +} + // Matcher is the interface that wraps the Match method. // // Match returns the best match for any of the given tags, along with @@ -36,23 +46,44 @@ func Comprehends(speaker, alternative Tag) Confidence { // matched tag in t, but is augmented with the Unicode extension ('u')of the // corresponding preferred tag. This allows user locale options to be passed // transparently. -func NewMatcher(t []Tag) Matcher { - return newMatcher(t) +func NewMatcher(t []Tag, options ...MatchOption) Matcher { + return newMatcher(t, options) } func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { match, w, c := m.getBest(want...) - if match == nil { - t = m.default_.tag - } else { + if match != nil { t, index = match.tag, match.index + } else { + // TODO: this should be an option + t = m.default_.tag + if m.preferSameScript { + outer: + for _, w := range want { + script, _ := w.Script() + if script.scriptID == 0 { + // Don't do anything if there is no script, such as with + // private subtags. + continue + } + for i, h := range m.supported { + if script.scriptID == h.maxScript { + t, index = h.tag, i + break outer + } + } + } + } + // TODO: select first language tag based on script. + } + if w.region != 0 && t.region != 0 && t.region.contains(w.region) { + t, _ = Raw.Compose(t, Region{w.region}) } // Copy options from the user-provided tag into the result tag. This is hard // to do after the fact, so we do it here. - // TODO: consider also adding in variants that are compatible with the - // matched language. - // TODO: Add back region if it is non-ambiguous? Or create another tag to - // preserve the region? + // TODO: add in alternative variants to -u-va-. + // TODO: add preferred region to -u-rg-. + // TODO: add other extensions. Merge with existing extensions. if u, ok := w.Extension('u'); ok { t, _ = Raw.Compose(t, u) } @@ -388,16 +419,18 @@ func minimizeTags(t Tag) (Tag, error) { // matcher keeps a set of supported language tags, indexed by language. type matcher struct { - default_ *haveTag - index map[langID]*matchHeader - passSettings bool + default_ *haveTag + supported []*haveTag + index map[langID]*matchHeader + passSettings bool + preferSameScript bool } // matchHeader has the lists of tags for exact matches and matches based on // maximized and canonicalized tags for a given language. type matchHeader struct { - exact []haveTag - max []haveTag + exact []*haveTag + max []*haveTag } // haveTag holds a supported Tag and its maximized script and region. The maximized @@ -440,8 +473,10 @@ func makeHaveTag(tag Tag, index int) (haveTag, langID) { // script to map to another and we rely on this to keep the code simple. func altScript(l langID, s scriptID) scriptID { for _, alt := range matchScript { - if (alt.lang == 0 || langID(alt.lang) == l) && scriptID(alt.have) == s { - return scriptID(alt.want) + // TODO: also match cases where language is not the same. + if (langID(alt.wantLang) == l || langID(alt.haveLang) == l) && + scriptID(alt.haveScript) == s { + return scriptID(alt.wantScript) } } return 0 @@ -457,7 +492,7 @@ func (h *matchHeader) addIfNew(n haveTag, exact bool) { } } if exact { - h.exact = append(h.exact, n) + h.exact = append(h.exact, &n) } // Allow duplicate maximized tags, but create a linked list to allow quickly // comparing the equivalents and bail out. @@ -472,7 +507,7 @@ func (h *matchHeader) addIfNew(n haveTag, exact bool) { break } } - h.max = append(h.max, n) + h.max = append(h.max, &n) } // header returns the matchHeader for the given language. It creates one if @@ -486,12 +521,26 @@ func (m *matcher) header(l langID) *matchHeader { return h } +func toConf(d uint8) Confidence { + if d <= 10 { + return High + } + if d < 30 { + return Low + } + return No +} + // newMatcher builds an index for the given supported tags and returns it as // a matcher. It also expands the index by considering various equivalence classes // for a given tag. -func newMatcher(supported []Tag) *matcher { +func newMatcher(supported []Tag, options []MatchOption) *matcher { m := &matcher{ - index: make(map[langID]*matchHeader), + index: make(map[langID]*matchHeader), + preferSameScript: true, + } + for _, o := range options { + o(m) } if len(supported) == 0 { m.default_ = &haveTag{} @@ -502,8 +551,9 @@ func newMatcher(supported []Tag) *matcher { for i, tag := range supported { pair, _ := makeHaveTag(tag, i) m.header(tag.lang).addIfNew(pair, true) + m.supported = append(m.supported, &pair) } - m.default_ = &m.header(supported[0].lang).exact[0] + m.default_ = m.header(supported[0].lang).exact[0] for i, tag := range supported { pair, max := makeHaveTag(tag, i) if max != tag.lang { @@ -511,6 +561,9 @@ func newMatcher(supported []Tag) *matcher { } } + // TODO: include alt script. + // - don't replace regions, but allow regions to be made more specific. + // update is used to add indexes in the map for equivalent languages. // If force is true, the update will also apply to derived entries. To // avoid applying a "transitive closure", use false. @@ -520,7 +573,8 @@ func newMatcher(supported []Tag) *matcher { return } hw := m.header(langID(want)) - for _, v := range hh.max { + for _, ht := range hh.max { + v := *ht if conf < v.conf { v.conf = conf } @@ -536,9 +590,9 @@ func newMatcher(supported []Tag) *matcher { // Add entries for languages with mutual intelligibility as defined by CLDR's // languageMatch data. for _, ml := range matchLang { - update(ml.want, ml.have, Confidence(ml.conf), false) + update(ml.want, ml.have, toConf(ml.distance), false) if !ml.oneway { - update(ml.have, ml.want, Confidence(ml.conf), false) + update(ml.have, ml.want, toConf(ml.distance), false) } } @@ -580,7 +634,7 @@ func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) { continue } for i := range h.exact { - have := &h.exact[i] + have := h.exact[i] if have.tag.equalsRest(w) { return have, w, Exact } @@ -591,7 +645,7 @@ func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) { // Base language is not defined. if h != nil { for i := range h.exact { - have := &h.exact[i] + have := h.exact[i] if have.tag.equalsRest(w) { return have, w, Exact } @@ -609,11 +663,11 @@ func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) { } // Check for match based on maximized tag. for i := range h.max { - have := &h.max[i] + have := h.max[i] best.update(have, w, max.script, max.region) if best.conf == Exact { for have.nextMax != 0 { - have = &h.max[have.nextMax] + have = h.max[have.nextMax] best.update(have, w, max.script, max.region) } return best.have, best.want, High @@ -635,11 +689,12 @@ type bestMatch struct { want Tag conf Confidence // Cached results from applying tie-breaking rules. - origLang bool - origReg bool - regDist uint8 - origScript bool - parentDist uint8 // 255 if have is not an ancestor of want tag. + origLang bool + origReg bool + regGroupDist uint8 + regDist uint8 + origScript bool + parentDist uint8 // 255 if have is not an ancestor of want tag. } // update updates the existing best match if the new pair is considered to be a @@ -693,6 +748,14 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion beaten = true } + regGroupDist := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.lang) + if !beaten && m.regGroupDist != regGroupDist { + if regGroupDist > m.regGroupDist { + return + } + beaten = true + } + // We prefer if the pre-maximized region was specified and identical. origReg := have.tag.region == tag.region && tag.region != 0 if !beaten && m.origReg != origReg { @@ -702,8 +765,22 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion beaten = true } - // Next we prefer smaller distances between regions, as defined by regionDist. - regDist := regionDist(have.maxRegion, maxRegion, tag.lang) + // TODO: remove the region distance rule. Region distance has been replaced + // by the region grouping rule. For now we leave it as it still seems to + // have a net positive effect when applied after the grouping rule. + // Possible solutions: + // - apply the primary locale rule first to effectively disable region + // region distance if groups are defined. + // - express the following errors in terms of grouping (if possible) + // - find another method of handling the following cases. + // maximization of legacy: find mo in + // "sr-Cyrl, sr-Latn, ro, ro-MD": have ro; want ro-MD (High) + // region distance French: find fr-US in + // "en, fr, fr-CA, fr-CH": have fr; want fr-CA (High) + + // Next we prefer smaller distances between regions, as defined by + // regionDist. + regDist := uint8(regionDistance(have.maxRegion, maxRegion)) if !beaten && m.regDist != regDist { if regDist > m.regDist { return @@ -721,6 +798,9 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion } // Finally we prefer tags which have a closer parent relationship. + // TODO: the parent relationship no longer seems necessary. It doesn't hurt + // to leave it in as the final tie-breaker, though, especially until the + // grouping data has further matured. parentDist := parentDistance(have.tag.region, tag) if !beaten && m.parentDist != parentDist { if parentDist > m.parentDist { @@ -737,6 +817,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion m.origLang = origLang m.origReg = origReg m.origScript = origScript + m.regGroupDist = regGroupDist m.regDist = regDist m.parentDist = parentDist } @@ -759,15 +840,27 @@ func parentDistance(haveRegion regionID, tag Tag) uint8 { return d } -// regionDist wraps regionDistance with some exceptions to the algorithmic distance. -func regionDist(a, b regionID, lang langID) uint8 { - if lang == _en { - // Two variants of non-US English are close to each other, regardless of distance. - if a != _US && b != _US { - return 2 +// regionGroupDist computes the distance between two regions based on their +// CLDR grouping. +func regionGroupDist(a, b regionID, script scriptID, lang langID) uint8 { + aGroup := uint(regionToGroups[a]) << 1 + bGroup := uint(regionToGroups[b]) << 1 + for _, ri := range matchRegion { + if langID(ri.lang) == lang && (ri.script == 0 || scriptID(ri.script) == script) { + group := uint(1 << (ri.group &^ 0x80)) + if 0x80&ri.group == 0 { + if aGroup&bGroup&group != 0 { // Both regions are in the group. + return ri.distance + } + } else { + if (aGroup|bGroup)&group == 0 { // Both regions are not in the group. + return ri.distance + } + } } } - return uint8(regionDistance(a, b)) + const defaultDistance = 4 + return defaultDistance } // regionDistance computes the distance between two regions based on the diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go index 5de0f85..a108554 100644 --- a/vendor/golang.org/x/text/language/tables.go +++ b/vendor/golang.org/x/text/language/tables.go @@ -1,122 +1,122 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package language import "golang.org/x/text/internal/tag" // CLDRVersion is the CLDR version from which the tables in this package are derived. -const CLDRVersion = "29" +const CLDRVersion = "31" const numLanguages = 8654 const numScripts = 230 -const numRegions = 354 +const numRegions = 356 type fromTo struct { from uint16 to uint16 } -const nonCanonicalUnd = 649 +const nonCanonicalUnd = 1199 const ( - _af = 10 - _am = 17 - _ar = 21 - _az = 36 - _bg = 56 - _bn = 75 - _ca = 97 - _cs = 121 - _da = 128 - _de = 133 - _el = 154 - _en = 155 - _es = 157 - _et = 159 - _fa = 164 - _fi = 168 - _fil = 170 - _fr = 175 - _gu = 211 - _he = 224 - _hi = 225 - _hr = 238 - _hu = 242 - _hy = 243 - _id = 248 - _is = 258 - _it = 259 - _ja = 263 - _ka = 273 - _kk = 303 - _km = 307 - _kn = 309 - _ko = 310 - _ky = 333 - _lo = 357 - _lt = 361 - _lv = 368 - _mk = 396 - _ml = 397 - _mn = 399 - _mo = 402 - _mr = 406 - _ms = 410 - _mul = 414 - _my = 421 - _nb = 431 - _ne = 436 - _nl = 445 - _no = 449 - _pa = 471 - _pl = 487 - _pt = 495 - _ro = 515 - _ru = 519 - _sh = 549 - _si = 552 - _sk = 554 - _sl = 556 - _sq = 570 - _sr = 571 - _sv = 583 - _sw = 584 - _ta = 593 - _te = 600 - _th = 605 - _tl = 616 - _tn = 619 - _tr = 623 - _uk = 646 - _ur = 652 - _uz = 653 - _vi = 658 - _zh = 708 - _zu = 710 - _jbo = 265 - _ami = 1033 - _bnn = 1740 - _hak = 221 - _tlh = 13850 - _lb = 340 - _nv = 458 - _pwn = 11438 - _tao = 13571 - _tay = 13581 - _tsu = 14045 - _nn = 447 - _sfb = 13012 - _vgt = 15084 - _sgg = 13043 - _cmn = 2390 - _nan = 428 - _hsn = 240 + _af = 22 + _am = 39 + _ar = 58 + _az = 88 + _bg = 126 + _bn = 165 + _ca = 215 + _cs = 249 + _da = 256 + _de = 268 + _el = 309 + _en = 312 + _es = 317 + _et = 319 + _fa = 327 + _fi = 336 + _fil = 338 + _fr = 349 + _gu = 418 + _he = 442 + _hi = 444 + _hr = 463 + _hu = 467 + _hy = 469 + _id = 479 + _is = 502 + _it = 503 + _ja = 510 + _ka = 526 + _kk = 576 + _km = 584 + _kn = 591 + _ko = 594 + _ky = 648 + _lo = 694 + _lt = 702 + _lv = 709 + _mk = 765 + _ml = 770 + _mn = 777 + _mo = 782 + _mr = 793 + _ms = 797 + _mul = 804 + _my = 815 + _nb = 837 + _ne = 847 + _nl = 869 + _no = 877 + _pa = 923 + _pl = 945 + _pt = 958 + _ro = 986 + _ru = 992 + _sh = 1029 + _si = 1034 + _sk = 1040 + _sl = 1044 + _sq = 1071 + _sr = 1072 + _sv = 1090 + _sw = 1091 + _ta = 1102 + _te = 1119 + _th = 1129 + _tl = 1144 + _tn = 1150 + _tr = 1160 + _uk = 1196 + _ur = 1202 + _uz = 1210 + _vi = 1217 + _zh = 1319 + _zu = 1324 + _jbo = 513 + _ami = 1647 + _bnn = 2354 + _hak = 436 + _tlh = 14464 + _lb = 659 + _nv = 897 + _pwn = 12052 + _tao = 14185 + _tay = 14195 + _tsu = 14659 + _nn = 872 + _sfb = 13626 + _vgt = 15698 + _sgg = 13657 + _cmn = 3004 + _nan = 833 + _hsn = 465 ) -const langPrivateStart = 0x2d09 +const langPrivateStart = 0x2f6f -const langPrivateEnd = 0x2f10 +const langPrivateEnd = 0x3176 // lang holds an alphabetically sorted list of ISO-639 language identifiers. // All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. @@ -125,72 +125,133 @@ const langPrivateEnd = 0x2f10 // the second and third letter of the 3-letter ISO code. // - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. // For 3-byte language identifiers the 4th byte is 0. -var lang tag.Index = "" + // Size: 2856 bytes - "---\x00aaarabbkabr\x00ace\x00ach\x00ada\x00ady\x00aeveaeb\x00affragq\x00" + - "aho\x00akkaakk\x00aln\x00alt\x00ammhamo\x00anrgaoz\x00arraarc\x00arn\x00" + - "aro\x00arq\x00ary\x00arz\x00assmasa\x00ase\x00ast\x00atj\x00avvaawa\x00a" + - "yymazzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bax\x00bbc\x00bbj\x00bci" + - "\x00beelbej\x00bem\x00bew\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc" + - "\x00bgn\x00bgx\x00bhihbhb\x00bhi\x00bhk\x00bho\x00biisbik\x00bin\x00bjj" + - "\x00bjn\x00bkm\x00bku\x00blt\x00bmambmq\x00bnenboodbpy\x00bqi\x00bqv\x00" + - "brrebra\x00brh\x00brx\x00bsosbsq\x00bss\x00bto\x00btv\x00bua\x00buc\x00b" + - "ug\x00bum\x00bvb\x00byn\x00byv\x00bze\x00caatcch\x00ccp\x00ceheceb\x00cg" + - "g\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00ckb\x00cooscop" + - "\x00cps\x00crrecrj\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd" + - "\x00cuhucvhvcyymdaandak\x00dar\x00dav\x00dcc\x00deeuden\x00dgr\x00dje" + - "\x00dnj\x00doi\x00dsb\x00dtm\x00dtp\x00dty\x00dua\x00dvivdyo\x00dyu\x00d" + - "zzoebu\x00eeweefi\x00egl\x00egy\x00eky\x00elllenngeopoes\x00\x05esu\x00e" + - "tstett\x00euusewo\x00ext\x00faasfan\x00ffulffm\x00fiinfia\x00fil\x00fit" + - "\x00fjijfoaofon\x00frrafrc\x00frp\x00frr\x00frs\x00fud\x00fuq\x00fur\x00" + - "fuv\x00fvr\x00fyrygalegaa\x00gag\x00gan\x00gay\x00gbm\x00gbz\x00gcr\x00g" + - "dlagez\x00ggn\x00gil\x00gjk\x00gju\x00gllgglk\x00gnrngom\x00gon\x00gor" + - "\x00gos\x00got\x00grc\x00grt\x00gsw\x00guujgub\x00guc\x00gur\x00guw\x00g" + - "uz\x00gvlvgvr\x00gwi\x00haauhak\x00haw\x00haz\x00heebhiinhif\x00hil\x00h" + - "lu\x00hmd\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homohoc\x00hoj\x00hrrvhs" + - "b\x00hsn\x00htathuunhyyehzerianaiba\x00ibb\x00idndieleigboiiiiikpkikt" + - "\x00ilo\x00inndinh\x00iodoisslittaiukuiw\x00\x03izh\x00japnjam\x00jbo" + - "\x00jgo\x00ji\x00\x06jmc\x00jml\x00jut\x00jvavjwavkaatkaa\x00kab\x00kac" + - "\x00kaj\x00kam\x00kao\x00kbd\x00kcg\x00kck\x00kde\x00kdt\x00kea\x00ken" + - "\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgp\x00kha\x00khb\x00khn\x00khq\x00k" + - "ht\x00khw\x00kiikkiu\x00kjuakjg\x00kkazkkj\x00klalkln\x00kmhmkmb\x00knan" + - "koorkoi\x00kok\x00kos\x00kpe\x00kraukrc\x00kri\x00krj\x00krl\x00kru\x00k" + - "sasksb\x00ksf\x00ksh\x00kuurkum\x00kvomkvr\x00kvx\x00kw\x00\x01kxm\x00kx" + - "p\x00kyirlaatlab\x00lad\x00lag\x00lah\x00laj\x00lbtzlbe\x00lbw\x00lcp" + - "\x00lep\x00lez\x00lgugliimlif\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lmn" + - "\x00lmo\x00lninloaolol\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy" + - "\x00luz\x00lvavlwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00m" + - "an\x00mas\x00maz\x00mdf\x00mdh\x00mdr\x00men\x00mer\x00mfa\x00mfe\x00mgl" + - "gmgh\x00mgo\x00mgp\x00mgy\x00mhahmirimin\x00mis\x00mkkdmlalmls\x00mnonmn" + - "i\x00mnw\x00moolmoe\x00moh\x00mos\x00mrarmrd\x00mrj\x00mro\x00mssamtltmt" + - "r\x00mua\x00mul\x00mus\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00myyamyv\x00" + - "myx\x00myz\x00mzn\x00naaunah\x00nan\x00nap\x00naq\x00nbobnch\x00nddendc" + - "\x00nds\x00neepnew\x00ngdongl\x00nhe\x00nhw\x00nij\x00niu\x00njo\x00nlld" + - "nmg\x00nnnonnh\x00noornod\x00noe\x00non\x00nqo\x00nrblnsk\x00nso\x00nus" + - "\x00nvavnxq\x00nyyanym\x00nyn\x00nzi\x00occiojjiomrmorriosssosa\x00otk" + - "\x00paanpag\x00pal\x00pam\x00pap\x00pau\x00pcd\x00pcm\x00pdc\x00pdt\x00p" + - "eo\x00pfl\x00phn\x00pilipka\x00pko\x00plolpms\x00pnt\x00pon\x00pra\x00pr" + - "d\x00prg\x00psusptorpuu\x00quuequc\x00qug\x00raj\x00rcf\x00rej\x00rgn" + - "\x00ria\x00rif\x00rjs\x00rkt\x00rmohrmf\x00rmo\x00rmt\x00rmu\x00rnunrng" + - "\x00roonrob\x00rof\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00ryu\x00s" + - "aansaf\x00sah\x00saq\x00sas\x00sat\x00saz\x00sbp\x00scrdsck\x00scn\x00sc" + - "o\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00sei\x00ses\x00sgagsga" + - "\x00sgs\x00sh\x00\x02shi\x00shn\x00siinsid\x00sklkskr\x00sllvsli\x00sly" + - "\x00smmosma\x00smi\x00smj\x00smn\x00smp\x00sms\x00snnasnk\x00soomsou\x00" + - "sqqisrrpsrb\x00srn\x00srr\x00srx\x00ssswssy\x00stotstq\x00suunsuk\x00sus" + - "\x00svweswwaswb\x00swc\x00swg\x00swv\x00sxn\x00syl\x00syr\x00szl\x00taam" + - "taj\x00tbw\x00tcy\x00tdd\x00tdg\x00tdh\x00teeltem\x00teo\x00tet\x00tggkt" + - "hhathl\x00thq\x00thr\x00tiirtig\x00tiv\x00tkuktkl\x00tkr\x00tkt\x00tlglt" + - "ly\x00tmh\x00tnsntoontog\x00tpi\x00trurtru\x00trv\x00tssotsd\x00tsf\x00t" + - "sg\x00tsj\x00ttatttj\x00tts\x00ttt\x00tum\x00tvl\x00twwitwq\x00txg\x00ty" + - "ahtyv\x00tzm\x00udm\x00ugiguga\x00ukkruli\x00umb\x00und\x00unr\x00unx" + - "\x00urrduzzbvai\x00veenvec\x00vep\x00viievic\x00vls\x00vmf\x00vmw\x00voo" + - "lvot\x00vro\x00vun\x00walnwae\x00wal\x00war\x00wbp\x00wbq\x00wbr\x00wls" + - "\x00wni\x00woolwtm\x00wuu\x00xav\x00xcr\x00xhhoxlc\x00xld\x00xmf\x00xmn" + - "\x00xmr\x00xna\x00xnr\x00xog\x00xpr\x00xsa\x00xsr\x00yao\x00yap\x00yav" + - "\x00ybb\x00yiidyooryrl\x00yua\x00yue\x00zahazag\x00zbl\x00zdj\x00zea\x00" + - "zgh\x00zhhozmi\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" +const lang tag.Index = "" + // Size: 5312 bytes + "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + + "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + + "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + + "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + + "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + + "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + + "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + + "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + + "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + + "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + + "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + + "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + + "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + + "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + + "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + + "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + + "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + + "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + + "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + + "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + + "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + + "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + + "kl\x00cko\x00cky\x00cla\x00cme\x00cooscop\x00cps\x00crrecrh\x00crj\x00cr" + + "k\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymdaandad" + + "\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00ddn" + + "\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia\x00d" + + "je\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm\x00dtp" + + "\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00dyo\x00d" + + "yu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00elllema" + + "\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr\x00ett" + + "\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai\x00fan" + + "\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00foaofod" + + "\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00fub\x00f" + + "ud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyrygalega" + + "a\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gbf\x00gbm" + + "\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00gej\x00gel\x00g" + + "ez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju\x00gkn\x00gkp" + + "\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof\x00goi\x00gom" + + "\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw\x00gsw\x00guujg" + + "ub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf\x00gvr\x00gvs" + + "\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00haw\x00haz\x00h" + + "bb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hil\x00hla\x00hl" + + "u\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homohoc\x00hoj\x00" + + "hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian\x00iar\x00iba" + + "\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00ieleife\x00igbo" + + "igb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00ilo\x00imo\x00i" + + "nndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00iws\x00izh\x00i" + + "zi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo\x00ji\x00\x06jib" + + "\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab\x00kac\x00kad\x00" + + "kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq\x00kbx\x00kby\x00kc" + + "g\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt\x00kea\x00ken\x00kez" + + "\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00kha\x00khb\x00khn\x00k" + + "hq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu\x00kiw\x00kjuakjd\x00kj" + + "g\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00klq\x00klt\x00klx\x00kmh" + + "mkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knanknf\x00knp\x00koorkoi\x00" + + "kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo\x00kpr\x00kpx\x00kqb\x00kq" + + "f\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00krl\x00krs\x00kru\x00ksasksb" + + "\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb\x00ktm\x00kto\x00kuurkub\x00k" + + "ud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00kus\x00kvomkvg\x00kvr\x00kvx" + + "\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm\x00kxp\x00kxw\x00kxz\x00ky" + + "irkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag\x00lah\x00laj\x00las\x00lbt" + + "zlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00led\x00lee\x00lem\x00lep\x00l" + + "eq\x00leu\x00lez\x00lguglgg\x00liimlia\x00lid\x00lif\x00lig\x00lih\x00li" + + "j\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln\x00lmn\x00lmo\x00lmp\x00lnin" + + "lns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor\x00los\x00loz\x00lrc\x00ltitl" + + "tg\x00luublua\x00luo\x00luy\x00luz\x00lvavlwl\x00lzh\x00lzz\x00mad\x00ma" + + "f\x00mag\x00mai\x00mak\x00man\x00mas\x00maw\x00maz\x00mbh\x00mbo\x00mbq" + + "\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr\x00mcu\x00mda\x00mde\x00mdf" + + "\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee\x00mek\x00men\x00mer\x00met" + + "\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq\x00mglgmgh\x00mgl\x00mgo\x00m" + + "gp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00min\x00mis\x00miw\x00mkkdmki" + + "\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00mls\x00mmo\x00mmu\x00mmx\x00m" + + "nonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00moe\x00moh\x00mos\x00mox\x00mp" + + "p\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00mrj\x00mro\x00mssamtltmtc" + + "\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00mus\x00mva\x00mvn\x00mvy" + + "\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk\x00mym\x00myv\x00myw\x00m" + + "yx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw\x00mzz\x00naaunac\x00naf" + + "\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00nbobnca\x00nce\x00ncf\x00n" + + "ch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb\x00new\x00nex\x00nfr\x00ng" + + "donga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00nif\x00nii\x00nij\x00nin\x00" + + "niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nlldnmg\x00nmz\x00nnnonnf\x00n" + + "nh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00nop\x00nou\x00nqo\x00nrblnr" + + "b\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr\x00nui\x00nup\x00nus\x00nuv" + + "\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym\x00nyn\x00nzi\x00occiogc\x00" + + "ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00opm\x00orrioro\x00oru\x00osss" + + "osa\x00ota\x00otk\x00ozm\x00paanpag\x00pal\x00pam\x00pap\x00pau\x00pbi" + + "\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo\x00pex\x00pfl\x00phl\x00phn" + + "\x00pilipil\x00pip\x00pka\x00pko\x00plolpla\x00pms\x00png\x00pnn\x00pnt" + + "\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psuspss\x00ptorptp\x00puu\x00pwa" + + "\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rcf\x00rej\x00rel\x00res\x00r" + + "gn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmohrmf\x00rmo\x00rmt\x00rmu" + + "\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00rro\x00rtm\x00ruusrue\x00" + + "rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf\x00sah\x00saq\x00sas\x00sa" + + "t\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrdsck\x00scl\x00scn\x00sco\x00" + + "scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00sei\x00ses\x00sgagsga\x00sgs" + + "\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn\x00shu\x00siinsid\x00sig" + + "\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks\x00sllvsld\x00sli\x00sll" + + "\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp\x00smq\x00sms\x00snnasnc" + + "\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq\x00sou\x00soy\x00spd\x00s" + + "pl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx\x00ssswssd\x00ssg\x00ssy" + + "\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00sur\x00sus\x00svweswwaswb" + + "\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00syl\x00syr\x00szl\x00taamt" + + "aj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf\x00tbg\x00tbo\x00tbw\x00tbz" + + "\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelted\x00tem\x00teo\x00tet\x00t" + + "fi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00thq\x00thr\x00tiirtif\x00tig" + + "\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr\x00tkt\x00tlgltlf\x00tlx" + + "\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00tog\x00toq\x00tpi\x00tpm" + + "\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssotsd\x00tsf\x00tsg\x00tsj" + + "\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts\x00ttt\x00tuh\x00tul\x00t" + + "um\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00twq\x00txg\x00tyahtya\x00ty" + + "v\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli\x00umb\x00und\x00unr\x00unx" + + "\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00uvh\x00uvl\x00uzzbvag\x00vai" + + "\x00van\x00veenvec\x00vep\x00viievic\x00viv\x00vls\x00vmf\x00vmw\x00vool" + + "vot\x00vro\x00vun\x00vut\x00walnwae\x00waj\x00wal\x00wan\x00war\x00wbp" + + "\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg\x00wib\x00wiu\x00wiv\x00wja" + + "\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu\x00woolwob\x00wos\x00wrs\x00w" + + "sk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00xbi\x00xcr\x00xes\x00xhhoxla" + + "\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna\x00xnr\x00xog\x00xon\x00xpr" + + "\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe\x00yam\x00yao\x00yap\x00yas" + + "\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb\x00yby\x00yer\x00ygr\x00ygw" + + "\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00yooryon\x00yrb\x00yre\x00yrl" + + "\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw\x00zahazag\x00zbl\x00zdj\x00z" + + "ea\x00zgh\x00zhhozia\x00zlm\x00zmi\x00zne\x00zuulzxx\x00zza\x00\xff\xff" + + "\xff\xff" -const langNoIndexOffset = 713 +const langNoIndexOffset = 1327 // langNoIndex is a bit vector of all 3-letter language codes that are not used as an index // in lookup tables. The language ids for these language codes are derived directly @@ -198,194 +259,194 @@ const langNoIndexOffset = 713 // Size: 2197 bytes, 2197 elements var langNoIndex = [2197]uint8{ // Entry 0 - 3F - 0xff, 0xfd, 0xfd, 0xfe, 0xef, 0xf7, 0xbf, 0xd2, - 0xfb, 0xbf, 0xfe, 0xfa, 0xb7, 0x1d, 0x3c, 0x57, - 0x6f, 0x97, 0x73, 0xf8, 0xff, 0xef, 0xff, 0x70, - 0xaf, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x85, 0x62, - 0xe9, 0xbf, 0xfd, 0xff, 0xff, 0xf7, 0xfd, 0x77, - 0xbf, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xe3, - 0xc9, 0xff, 0xff, 0xff, 0x4d, 0xb8, 0x0a, 0x6a, - 0x7e, 0xfa, 0xe3, 0xfe, 0x7e, 0xff, 0x77, 0xff, + 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, + 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, + 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, + 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, + 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a, + 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, // Entry 40 - 7F - 0xff, 0xff, 0xff, 0xdf, 0x2b, 0xf4, 0xf1, 0xe0, - 0x5d, 0xe7, 0x9f, 0x14, 0x07, 0x20, 0xdf, 0xed, - 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0xf7, - 0x7e, 0xff, 0xff, 0xff, 0xfe, 0x7f, 0xff, 0xff, - 0xff, 0xff, 0x5f, 0xfc, 0xdb, 0xfd, 0xbf, 0xb5, - 0x7b, 0xdf, 0x7f, 0xf7, 0xeb, 0xfe, 0xff, 0xa7, - 0xbd, 0xff, 0x7f, 0xf7, 0xff, 0xef, 0xef, 0xef, - 0xff, 0xff, 0x9f, 0xff, 0xff, 0xef, 0xff, 0xdf, + 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, + 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, + 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, + 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, + 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, + 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, + 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, + 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, // Entry 80 - BF - 0xff, 0xff, 0xf3, 0xff, 0xfb, 0x2f, 0xff, 0xff, - 0xfb, 0xee, 0xff, 0xbd, 0xdb, 0xff, 0xdf, 0xf7, - 0xff, 0xfa, 0xfd, 0xff, 0x7e, 0xaf, 0x7b, 0xfe, - 0x7f, 0xff, 0xff, 0xfe, 0xff, 0xff, 0xdf, 0xff, - 0xff, 0xdf, 0xfb, 0xff, 0xfd, 0xfc, 0xfb, 0xff, - 0xff, 0xff, 0xff, 0xf7, 0x7f, 0xbf, 0xfd, 0xd5, + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff, + 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, + 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, + 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, + 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, + 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, - 0x08, 0x24, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, + 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, // Entry C0 - FF 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, - 0x9b, 0x14, 0x88, 0xf6, 0x7b, 0xe7, 0x17, 0x56, - 0x55, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef, + 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56, + 0x45, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef, 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, - 0xbc, 0x87, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35, + 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35, 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00, 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x40, 0x00, 0x40, 0x92, 0x21, 0xd0, 0xbf, 0x5d, + 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, // Entry 100 - 13F - 0xfd, 0xde, 0xfe, 0x5e, 0x00, 0x00, 0x02, 0x64, - 0x8d, 0x19, 0xc1, 0xdf, 0x79, 0x22, 0x00, 0x00, - 0x00, 0xdf, 0x6d, 0xdc, 0x26, 0xe5, 0xd9, 0xf3, + 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, + 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, + 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c, 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f, - 0x56, 0x89, 0x5e, 0xb7, 0xec, 0xef, 0x03, 0x00, - 0x02, 0x00, 0x00, 0x00, 0xc0, 0x77, 0xda, 0x57, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x79, 0xe0, 0xff, + 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, + 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, + 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, // Entry 140 - 17F - 0xff, 0x7f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x56, - 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x16, + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16, + 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09, 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04, - 0x00, 0x00, 0x50, 0xd5, 0x2d, 0x00, 0x64, 0x35, - 0x24, 0x53, 0xf5, 0xd4, 0xbd, 0xe2, 0xcd, 0x03, + 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, + 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03, // Entry 180 - 1BF 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x17, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x98, 0xa5, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, + 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0xb0, 0xfe, + 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x40, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, // Entry 1C0 - 1FF 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x20, 0x04, 0xa6, 0x08, 0x04, 0x00, 0x08, - 0x81, 0x50, 0x00, 0x00, 0x08, 0x11, 0x86, 0x40, - 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x06, 0x55, - 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x60, - 0x3b, 0x83, 0x11, 0x00, 0x00, 0x00, 0x11, 0x00, + 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, + 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, + 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, + 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xbe, 0xdf, 0xff, 0xfe, 0xbf, + 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7e, 0xbf, // Entry 200 - 23F - 0xdf, 0xc7, 0x83, 0x82, 0xc0, 0xff, 0xdf, 0x27, - 0xcf, 0x5f, 0xe7, 0x01, 0x10, 0x20, 0xb2, 0xc5, - 0xa4, 0x45, 0x25, 0x9b, 0x03, 0xcf, 0xf0, 0xdf, - 0x03, 0xc4, 0x08, 0x10, 0x01, 0x0e, 0x01, 0xe3, - 0x92, 0x54, 0xdb, 0x38, 0xf1, 0x7f, 0xf7, 0x6d, - 0xf9, 0xff, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, - 0x21, 0x12, 0x6c, 0x5f, 0xdd, 0x0f, 0x85, 0x4f, - 0x40, 0x40, 0x00, 0x04, 0xf9, 0xfd, 0xbd, 0xd4, + 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, + 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, + 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xcf, 0xe0, 0xdf, + 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3, + 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d, + 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, + 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, // Entry 240 - 27F - 0xe8, 0x13, 0xf4, 0x27, 0xa3, 0x0d, 0x00, 0x00, - 0x20, 0x7b, 0x39, 0x02, 0x05, 0x84, 0x00, 0xf0, - 0xbf, 0x7f, 0xda, 0x00, 0x18, 0x04, 0x81, 0x00, - 0x00, 0x00, 0x80, 0x10, 0x94, 0x1c, 0x01, 0x00, + 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, + 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0, + 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, + 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, - 0x08, 0xb4, 0x7c, 0xa5, 0x0c, 0x40, 0x00, 0x00, - 0x11, 0x04, 0x04, 0x6c, 0x00, 0x20, 0x70, 0xff, - 0xfb, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x6e, + 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, + 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, + 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66, // Entry 280 - 2BF 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, - 0xe2, 0xff, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, + 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x00, 0xa1, 0x02, 0x60, - 0xe5, 0x48, 0x14, 0x89, 0x20, 0xc0, 0x47, 0x80, - 0x07, 0x00, 0x00, 0x00, 0xcc, 0x50, 0x40, 0x24, - 0x85, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, + 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, + 0xe5, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, + 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, + 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, // Entry 2C0 - 2FF - 0x02, 0x50, 0x88, 0x11, 0x00, 0xd1, 0x6c, 0xee, - 0x50, 0x27, 0x1d, 0x11, 0x69, 0x06, 0x59, 0xe9, - 0x33, 0x08, 0x00, 0x20, 0x05, 0x40, 0x10, 0x00, - 0x00, 0x00, 0x50, 0x44, 0x96, 0x49, 0xd6, 0x5d, + 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, + 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, - 0x08, 0x00, 0x80, 0x00, 0x40, 0x45, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x04, 0x08, - 0xf8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x16, 0x00, + 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00, // Entry 300 - 33F - 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa2, - 0x01, 0x00, 0x00, 0x00, 0x12, 0x04, 0x00, 0x00, - 0x04, 0x10, 0xf0, 0x9d, 0x95, 0x13, 0x04, 0x80, + 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, + 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, + 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0, 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, - 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0xc0, + 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, // Entry 340 - 37F 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, - 0x00, 0x10, 0x00, 0x00, 0x00, 0xf8, 0x85, 0xe3, - 0xdd, 0xff, 0xff, 0xff, 0xbb, 0xff, 0x7f, 0xfb, - 0xff, 0xfc, 0xfe, 0xdf, 0xff, 0xff, 0xff, 0xf6, - 0xfb, 0xfe, 0xf7, 0x1f, 0xff, 0xb3, 0xed, 0xff, - 0xdb, 0xed, 0xff, 0xfe, 0xff, 0xfe, 0xdf, 0xff, - 0xff, 0xff, 0xf7, 0xff, 0xfd, 0xff, 0xff, 0xff, - 0xfd, 0xff, 0xdf, 0xaf, 0x9c, 0xff, 0xfb, 0xff, + 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, + 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, + 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, + 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, + 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, + 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, + 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, // Entry 380 - 3BF - 0xff, 0xff, 0xff, 0xff, 0xef, 0xd2, 0xbb, 0xdf, - 0xf5, 0xff, 0xff, 0xff, 0xff, 0xff, 0xfe, 0xef, - 0xfd, 0xff, 0xff, 0xf7, 0xfd, 0xff, 0xff, 0xff, - 0xef, 0xdb, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0x5f, 0xd3, 0x7b, 0xfd, 0xd9, 0xdf, 0xef, - 0xbc, 0x18, 0x05, 0x2c, 0xff, 0x07, 0xf0, 0xff, - 0xf7, 0x5f, 0x00, 0x08, 0x00, 0xc3, 0x3d, 0x1b, - 0x06, 0xe6, 0x72, 0xf0, 0xdd, 0x3c, 0x7f, 0x44, + 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, + 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, + 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, + 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, + 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, + 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, // Entry 3C0 - 3FF - 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xfd, 0xff, 0x57, - 0xf2, 0xff, 0x39, 0xff, 0xf2, 0x1e, 0x95, 0xf7, - 0xf7, 0xff, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, + 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, + 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11, 0x84, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01, 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10, 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, - 0xf9, 0xfd, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, // Entry 400 - 43F - 0xd7, 0x6f, 0xff, 0xff, 0xdf, 0x7d, 0xbb, 0xff, - 0xff, 0xff, 0xf7, 0xf3, 0xef, 0xff, 0xff, 0xf7, - 0xff, 0xdf, 0xdb, 0x7f, 0xff, 0xff, 0x7f, 0xff, - 0xff, 0xff, 0xef, 0xff, 0xbc, 0xff, 0xff, 0xfb, - 0xff, 0xfb, 0xff, 0xde, 0x76, 0xbd, 0xff, 0xf7, - 0xff, 0xff, 0xf7, 0xff, 0xff, 0xdf, 0xf3, 0xfe, - 0xef, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x7f, 0xde, - 0xf7, 0xbb, 0xef, 0xf7, 0xff, 0xfb, 0xbf, 0xdf, + 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, + 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, + 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, + 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, + 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, + 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, + 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, + 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, // Entry 440 - 47F - 0xfd, 0xfe, 0xff, 0xff, 0xfe, 0xff, 0x5f, 0x7d, - 0x7f, 0xff, 0xff, 0xf7, 0xe5, 0xfc, 0xff, 0xfd, - 0x7f, 0x7f, 0xff, 0x9e, 0xae, 0xff, 0xee, 0xff, - 0x7f, 0xf7, 0x7b, 0x02, 0x82, 0x04, 0xff, 0xf7, - 0xff, 0xbf, 0xd7, 0xef, 0xfe, 0xdf, 0xf7, 0xfe, - 0xe2, 0x8e, 0xe7, 0xff, 0xf7, 0xff, 0x56, 0xbd, - 0xcd, 0xff, 0xfb, 0xff, 0xff, 0xdf, 0xef, 0xff, - 0xe5, 0xdf, 0x7d, 0x0f, 0xa7, 0x51, 0x04, 0x44, + 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, + 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, + 0x7f, 0x4e, 0xbf, 0x8e, 0xae, 0xff, 0xee, 0xdf, + 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, + 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, + 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd, + 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, + 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x04, 0x44, // Entry 480 - 4BF - 0x13, 0xd0, 0x5d, 0xaf, 0xa6, 0xfd, 0xb9, 0xff, - 0x63, 0x5d, 0x5b, 0xff, 0xff, 0xbf, 0x3f, 0x20, - 0x14, 0x00, 0x57, 0x51, 0x82, 0x65, 0xf5, 0x49, + 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb, + 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, + 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05, 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04, 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x51, 0x60, 0x05, 0x04, 0x01, 0x00, 0x00, + 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1, // Entry 4C0 - 4FF - 0xfd, 0x67, 0x4b, 0x06, 0x95, 0x06, 0x57, 0xed, - 0xfb, 0x4c, 0x9d, 0x7b, 0x83, 0x04, 0x62, 0x40, - 0x00, 0x15, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, - 0xf9, 0x4f, 0x10, 0x8c, 0xc9, 0x46, 0xde, 0xf7, + 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed, + 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, + 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, + 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7, 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, - 0x01, 0x40, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x7d, + 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, // Entry 500 - 53F - 0xb0, 0xff, 0x79, 0x7a, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x77, 0xed, 0xf1, 0xbf, 0xef, - 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xfc, - 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xf5, 0xff, - 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7f, 0x10, + 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, + 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, + 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7, + 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, - 0x5f, 0x05, 0x86, 0xef, 0xf5, 0x77, 0xbd, 0x3c, - 0x00, 0x00, 0x00, 0x43, 0x71, 0x42, 0x00, 0x40, + 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, + 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, // Entry 540 - 57F 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, @@ -399,43 +460,43 @@ var langNoIndex = [2197]uint8{ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, - 0x00, 0x00, 0x00, 0x00, 0xf0, 0xde, 0xff, 0xbf, + 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, - 0x00, 0x30, 0x95, 0xe3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x01, 0x02, 0x00, 0x81, + 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x7e, 0x02, - 0xaa, 0x10, 0x5d, 0xd8, 0x52, 0x00, 0x80, 0x20, - 0x00, 0x00, 0x00, 0x00, 0x40, 0x10, 0x02, 0x02, + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, + 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, - 0x31, 0x00, 0x00, 0x00, 0x01, 0x50, 0x02, 0x20, + 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20, 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, - 0x00, 0x1f, 0xdf, 0xf2, 0xfd, 0xff, 0xfd, 0x3f, - 0x9f, 0x18, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe, + 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, + 0x1f, 0x18, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe, // Entry 600 - 63F - 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xfd, - 0xb7, 0xf7, 0xff, 0xf3, 0xdf, 0xff, 0x6f, 0xf1, - 0x7b, 0xf1, 0x7f, 0xdf, 0x7f, 0xbf, 0xfe, 0xb7, - 0xee, 0x1c, 0xfb, 0xdb, 0xef, 0xdf, 0xff, 0xfd, - 0x7e, 0xbe, 0x57, 0xff, 0x6f, 0x81, 0x76, 0x1f, - 0xd4, 0x77, 0xf5, 0xfd, 0xff, 0xff, 0xeb, 0xfe, - 0xbf, 0x5f, 0x57, 0x1b, 0xeb, 0x5f, 0x50, 0x18, - 0x02, 0xfa, 0xff, 0x9d, 0x15, 0x97, 0x15, 0x0f, + 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, + 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, + 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, + 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, + 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f, + 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, + 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18, + 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, // Entry 640 - 67F - 0x75, 0xc4, 0x7d, 0x81, 0x82, 0xf1, 0xd7, 0x7e, - 0xff, 0xff, 0xff, 0xef, 0xff, 0xfd, 0xdd, 0xde, - 0xfc, 0xfd, 0xf6, 0x5f, 0x7a, 0x1f, 0x40, 0x98, - 0x02, 0xff, 0xe3, 0xff, 0xf3, 0xd6, 0xf2, 0xff, - 0xfb, 0xdf, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4, - 0xf5, 0xbe, 0xff, 0xff, 0xf3, 0xf7, 0xff, 0xf7, - 0x7f, 0xff, 0xff, 0xbe, 0xdb, 0xf7, 0xd7, 0xf9, - 0xef, 0x2f, 0x80, 0xbf, 0xc5, 0xff, 0xff, 0xf3, + 0x75, 0xc4, 0x7d, 0x81, 0x82, 0xf1, 0x57, 0x6c, + 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, + 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98, + 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, + 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4, + 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, + 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, // Entry 680 - 6BF - 0x97, 0x9d, 0xff, 0xff, 0xf7, 0xcf, 0xfd, 0xbf, - 0xde, 0x7f, 0x06, 0x1d, 0x57, 0xff, 0xf8, 0xda, - 0x5d, 0xce, 0x7d, 0x16, 0xb9, 0xea, 0x69, 0xa0, - 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x48, + 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, + 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda, + 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0, + 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, @@ -443,64 +504,64 @@ var langNoIndex = [2197]uint8{ // Entry 6C0 - 6FF 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08, 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, - 0x00, 0xdc, 0xff, 0xeb, 0x1f, 0x58, 0x08, 0x41, - 0x04, 0xa0, 0x04, 0x00, 0x30, 0x12, 0x40, 0x22, + 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41, + 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xaf, - 0x6f, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, + 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, // Entry 700 - 73F 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x02, 0x00, 0x00, 0x00, 0x01, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79, 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x81, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 740 - 77F - 0x00, 0x00, 0x00, 0xef, 0xf7, 0xfd, 0xcf, 0x7e, - 0xa0, 0x11, 0x10, 0x00, 0x00, 0x92, 0x01, 0x44, - 0xcd, 0xf9, 0x5e, 0x00, 0x01, 0x00, 0x30, 0x14, - 0x04, 0x55, 0x10, 0x01, 0x04, 0xf6, 0x3f, 0x7a, - 0x05, 0x04, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55, - 0x97, 0x7c, 0x9f, 0x71, 0xcc, 0x78, 0xd1, 0x43, - 0xf5, 0x57, 0x67, 0x14, 0x01, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x2c, 0xf7, 0xdb, 0x1f, 0x54, 0x60, + 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, + 0xa0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, + 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, + 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55, + 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03, + 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0xaa, 0x01, - 0x00, 0x00, 0x30, 0x00, 0x24, 0x44, 0x00, 0x00, + 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, - 0xf5, 0xff, 0xd5, 0xd7, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x00, 0xa4, 0x84, 0xe9, 0x41, + 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, + 0x78, 0x15, 0x50, 0x00, 0xa4, 0x84, 0xa9, 0x41, 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, - 0xff, 0xef, 0xff, 0x4f, 0x85, 0x53, 0xf4, 0xed, + 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, // Entry 7C0 - 7FF - 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xf5, 0x42, - 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0xc0, 0x56, - 0xcc, 0x16, 0x9e, 0xfb, 0x35, 0x7d, 0xef, 0xff, - 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x5d, + 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42, + 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56, + 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, + 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, - 0x10, 0x20, 0x24, 0x00, 0xff, 0x3f, 0xdf, 0x67, - 0xfe, 0x01, 0x06, 0x88, 0x0a, 0x40, 0x16, 0x01, - 0x01, 0x15, 0x2b, 0x3e, 0x01, 0x00, 0x00, 0x10, + 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, + 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, // Entry 800 - 83F - 0x90, 0x69, 0x45, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa7, 0xd1, - 0x54, 0x9e, 0x44, 0xdf, 0xfd, 0x8f, 0x66, 0xb3, - 0x55, 0x20, 0xd4, 0xc3, 0xd8, 0x30, 0x3d, 0x80, - 0x00, 0x00, 0x00, 0x4c, 0xd4, 0x11, 0xc5, 0x84, - 0x6e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbf, 0xdb, + 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, + 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, + 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, + 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, // Entry 840 - 87F 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, - 0x84, 0x00, 0x33, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0xc8, 0x14, 0xf1, - 0xef, 0xff, 0x7f, 0x16, 0x01, 0x01, 0x84, 0x50, + 0x84, 0x00, 0x23, 0xc0, 0x23, 0x24, 0x00, 0x00, + 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1, + 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, // Entry 880 - 8BF @@ -512,194 +573,196 @@ var langNoIndex = [2197]uint8{ // altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives // to 2-letter language codes that cannot be derived using the method described above. // Each 3-letter code is followed by its 1-byte langID. -var altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" +const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" // altLangIndex is used to convert indexes in altLangISO3 to langIDs. // Size: 12 bytes, 6 elements var altLangIndex = [6]uint16{ - 0x014a, 0x0225, 0x0105, 0x020a, 0x009d, 0x010b, + 0x027f, 0x0405, 0x01f9, 0x03e3, 0x013d, 0x0206, } // langAliasMap maps langIDs to their suggested replacements. -// Size: 640 bytes, 160 elements -var langAliasMap = [160]fromTo{ - 0: {from: 0xc4, to: 0xda}, - 1: {from: 0xff, to: 0xf8}, - 2: {from: 0x105, to: 0xe0}, - 3: {from: 0x10b, to: 0x2b9}, - 4: {from: 0x110, to: 0x10f}, - 5: {from: 0x192, to: 0x203}, - 6: {from: 0x1af, to: 0x1c1}, - 7: {from: 0x225, to: 0x23b}, - 8: {from: 0x268, to: 0xaa}, - 9: {from: 0x274, to: 0x252}, - 10: {from: 0x27d, to: 0xd}, - 11: {from: 0x2d5, to: 0x2db}, - 12: {from: 0x326, to: 0x93}, - 13: {from: 0x3c7, to: 0x1c48}, - 14: {from: 0x3e8, to: 0x23a}, - 15: {from: 0x3f9, to: 0x23a}, - 16: {from: 0x484, to: 0x15}, - 17: {from: 0x48f, to: 0xf3}, - 18: {from: 0x4d5, to: 0x1f38}, - 19: {from: 0x54a, to: 0x23}, - 20: {from: 0x550, to: 0x2732}, - 21: {from: 0x55c, to: 0x24}, - 22: {from: 0x57d, to: 0xa1}, - 23: {from: 0x5a3, to: 0x26}, - 24: {from: 0x5ac, to: 0x42}, - 25: {from: 0x615, to: 0x5a7}, - 26: {from: 0x65a, to: 0xc7a}, - 27: {from: 0x786, to: 0x1a5}, - 28: {from: 0x7cd, to: 0x16e}, - 29: {from: 0x7d4, to: 0x59}, - 30: {from: 0x855, to: 0x30b9}, - 31: {from: 0x8cf, to: 0x2c4}, - 32: {from: 0x90c, to: 0x23f1}, - 33: {from: 0x915, to: 0x95a}, - 34: {from: 0x932, to: 0x24f}, - 35: {from: 0x953, to: 0x3fc0}, - 36: {from: 0x956, to: 0x2c4}, - 37: {from: 0x995, to: 0x2b3e}, - 38: {from: 0x9c5, to: 0x2f18}, - 39: {from: 0xa50, to: 0x73}, - 40: {from: 0xa9f, to: 0x79}, - 41: {from: 0xb5f, to: 0x8a}, - 42: {from: 0xb6e, to: 0x1a2}, - 43: {from: 0xb8f, to: 0xb92}, - 44: {from: 0xb95, to: 0x2c8}, - 45: {from: 0xc76, to: 0x1df1}, - 46: {from: 0xc85, to: 0x2c31}, - 47: {from: 0xcd0, to: 0x1bd}, - 48: {from: 0xe67, to: 0x9f}, - 49: {from: 0xe9b, to: 0x179}, - 50: {from: 0xf37, to: 0xfc}, - 51: {from: 0x1010, to: 0xd}, - 52: {from: 0x11bb, to: 0xaf}, - 53: {from: 0x1207, to: 0xa6}, - 54: {from: 0x12b6, to: 0xb32}, - 55: {from: 0x12ba, to: 0x1d2}, - 56: {from: 0x12c9, to: 0x145c}, - 57: {from: 0x1317, to: 0x111}, - 58: {from: 0x131a, to: 0x85}, - 59: {from: 0x133a, to: 0x3a46}, - 60: {from: 0x1401, to: 0xcc}, - 61: {from: 0x145f, to: 0x9a}, - 62: {from: 0x1497, to: 0x278f}, - 63: {from: 0x14af, to: 0xca}, - 64: {from: 0x14be, to: 0xcd6}, - 65: {from: 0x1511, to: 0x12bb}, - 66: {from: 0x15a0, to: 0x154d}, - 67: {from: 0x15ad, to: 0x168a}, - 68: {from: 0x1621, to: 0x23f}, - 69: {from: 0x1710, to: 0x1a98}, - 70: {from: 0x180b, to: 0x2947}, - 71: {from: 0x1821, to: 0x102}, - 72: {from: 0x18f1, to: 0x104}, - 73: {from: 0x191d, to: 0x12ac}, - 74: {from: 0x1dcf, to: 0x3548}, - 75: {from: 0x1dd4, to: 0x1e74}, - 76: {from: 0x1df1, to: 0x18f}, - 77: {from: 0x1e7a, to: 0x145}, - 78: {from: 0x1e85, to: 0x13b}, - 79: {from: 0x1e89, to: 0x122}, - 80: {from: 0x1e90, to: 0x138}, - 81: {from: 0x1ea6, to: 0x1f82}, - 82: {from: 0x1ecc, to: 0x147}, - 83: {from: 0x1f30, to: 0x8d}, - 84: {from: 0x1f65, to: 0x12f8}, - 85: {from: 0x1f7d, to: 0x4235}, - 86: {from: 0x1f8b, to: 0x371a}, - 87: {from: 0x1fc4, to: 0x8d}, - 88: {from: 0x1fce, to: 0x8d}, - 89: {from: 0x1ff9, to: 0x6c1}, - 90: {from: 0x20ad, to: 0x2fbd}, - 91: {from: 0x2119, to: 0x30fc}, - 92: {from: 0x2209, to: 0x170}, - 93: {from: 0x227b, to: 0x18c}, - 94: {from: 0x2287, to: 0x189}, - 95: {from: 0x2291, to: 0x19a}, - 96: {from: 0x22e7, to: 0x8f2}, - 97: {from: 0x2340, to: 0x69}, - 98: {from: 0x23d5, to: 0x179}, - 99: {from: 0x2460, to: 0x244b}, - 100: {from: 0x2490, to: 0x1f4}, - 101: {from: 0x24be, to: 0x3a46}, - 102: {from: 0x24fc, to: 0x244b}, - 103: {from: 0x2520, to: 0x40ef}, - 104: {from: 0x2686, to: 0x25ce}, - 105: {from: 0x26ab, to: 0x1b4}, - 106: {from: 0x271d, to: 0x2b3e}, - 107: {from: 0x28b1, to: 0x1d1}, - 108: {from: 0x2993, to: 0x1d3}, - 109: {from: 0x29d6, to: 0x3a46}, - 110: {from: 0x2a93, to: 0x1ee}, - 111: {from: 0x2aaa, to: 0x32e}, - 112: {from: 0x2ade, to: 0xa4}, - 113: {from: 0x2adf, to: 0xa4}, - 114: {from: 0x2b96, to: 0x183}, - 115: {from: 0x2b9f, to: 0x1763}, - 116: {from: 0x2bb1, to: 0x2b2c}, - 117: {from: 0x2bb8, to: 0x152}, - 118: {from: 0x2beb, to: 0x37}, - 119: {from: 0x2bfc, to: 0x2019}, - 120: {from: 0x2c37, to: 0x2c32}, - 121: {from: 0x2c86, to: 0x2c6e}, - 122: {from: 0x2f2a, to: 0x1f1}, - 123: {from: 0x30fd, to: 0x3125}, - 124: {from: 0x31c1, to: 0x203}, - 125: {from: 0x3285, to: 0x1667}, - 126: {from: 0x337d, to: 0x22a}, - 127: {from: 0x33ef, to: 0x132}, - 128: {from: 0x340d, to: 0x215}, - 129: {from: 0x3494, to: 0x248}, - 130: {from: 0x3557, to: 0x8d}, - 131: {from: 0x35ad, to: 0x3689}, - 132: {from: 0x35c2, to: 0x2a32}, - 133: {from: 0x35c6, to: 0x4c}, - 134: {from: 0x35c9, to: 0x2fbf}, - 135: {from: 0x3603, to: 0x373d}, - 136: {from: 0x3629, to: 0x3d57}, - 137: {from: 0x363c, to: 0x376e}, - 138: {from: 0x364b, to: 0x1d3b}, - 139: {from: 0x364c, to: 0x2c31}, - 140: {from: 0x36f3, to: 0x26a}, - 141: {from: 0x38e5, to: 0xb28}, - 142: {from: 0x390f, to: 0xe91}, - 143: {from: 0x3a30, to: 0x28d}, - 144: {from: 0x3d54, to: 0x7f}, - 145: {from: 0x3f9f, to: 0x828}, - 146: {from: 0x4055, to: 0x30a}, - 147: {from: 0x4090, to: 0x3cf7}, - 148: {from: 0x410f, to: 0x13a}, - 149: {from: 0x4162, to: 0x3462}, - 150: {from: 0x4164, to: 0x86}, - 151: {from: 0x4246, to: 0x30b9}, - 152: {from: 0x427a, to: 0x2b9}, - 153: {from: 0x4361, to: 0x21a0}, - 154: {from: 0x4374, to: 0x2473}, - 155: {from: 0x43a7, to: 0x4645}, - 156: {from: 0x4445, to: 0x4437}, - 157: {from: 0x44d5, to: 0x44dc}, - 158: {from: 0x46ad, to: 0x19a}, - 159: {from: 0x473e, to: 0x2be}, +// Size: 644 bytes, 161 elements +var langAliasMap = [161]fromTo{ + 0: {from: 0x82, to: 0x88}, + 1: {from: 0x185, to: 0x1ac}, + 2: {from: 0x1f1, to: 0x1df}, + 3: {from: 0x1f9, to: 0x1ba}, + 4: {from: 0x206, to: 0x510}, + 5: {from: 0x20d, to: 0x20c}, + 6: {from: 0x30e, to: 0x3da}, + 7: {from: 0x345, to: 0x36d}, + 8: {from: 0x405, to: 0x430}, + 9: {from: 0x478, to: 0x152}, + 10: {from: 0x48e, to: 0x44f}, + 11: {from: 0x4a0, to: 0x21}, + 12: {from: 0x53b, to: 0x541}, + 13: {from: 0x58c, to: 0x12c}, + 14: {from: 0x62d, to: 0x1eae}, + 15: {from: 0x64e, to: 0x42f}, + 16: {from: 0x65f, to: 0x42f}, + 17: {from: 0x6ea, to: 0x3a}, + 18: {from: 0x6f5, to: 0x1d5}, + 19: {from: 0x73b, to: 0x219e}, + 20: {from: 0x7b0, to: 0x56}, + 21: {from: 0x7b6, to: 0x2998}, + 22: {from: 0x7c2, to: 0x58}, + 23: {from: 0x7e3, to: 0x144}, + 24: {from: 0x809, to: 0x5a}, + 25: {from: 0x812, to: 0x8d}, + 26: {from: 0x87b, to: 0x80d}, + 27: {from: 0x8c0, to: 0xee0}, + 28: {from: 0x9ec, to: 0x32f}, + 29: {from: 0xa33, to: 0x2c3}, + 30: {from: 0xa3a, to: 0xbf}, + 31: {from: 0xabb, to: 0x331f}, + 32: {from: 0xb35, to: 0x527}, + 33: {from: 0xb72, to: 0x2657}, + 34: {from: 0xb7b, to: 0xbc0}, + 35: {from: 0xb98, to: 0x44c}, + 36: {from: 0xbb9, to: 0x4226}, + 37: {from: 0xbbc, to: 0x527}, + 38: {from: 0xbfb, to: 0x2da4}, + 39: {from: 0xc2b, to: 0x317e}, + 40: {from: 0xcb6, to: 0xf2}, + 41: {from: 0xd05, to: 0xf9}, + 42: {from: 0xdc5, to: 0x119}, + 43: {from: 0xdd4, to: 0x32b}, + 44: {from: 0xdf5, to: 0xdf8}, + 45: {from: 0xdfb, to: 0x52e}, + 46: {from: 0xedc, to: 0x2057}, + 47: {from: 0xeeb, to: 0x2e97}, + 48: {from: 0xf36, to: 0x365}, + 49: {from: 0x10cd, to: 0x13f}, + 50: {from: 0x1101, to: 0x2ce}, + 51: {from: 0x119d, to: 0x1ea}, + 52: {from: 0x1276, to: 0x21}, + 53: {from: 0x1421, to: 0x15d}, + 54: {from: 0x146d, to: 0x14d}, + 55: {from: 0x151c, to: 0xd98}, + 56: {from: 0x1520, to: 0x38e}, + 57: {from: 0x152f, to: 0x19d}, + 58: {from: 0x157d, to: 0x20e}, + 59: {from: 0x1580, to: 0x10c}, + 60: {from: 0x15a0, to: 0x3cac}, + 61: {from: 0x1667, to: 0x199}, + 62: {from: 0x16c5, to: 0x135}, + 63: {from: 0x16fd, to: 0x29f5}, + 64: {from: 0x1715, to: 0x192}, + 65: {from: 0x1724, to: 0xf3c}, + 66: {from: 0x1777, to: 0x1521}, + 67: {from: 0x1806, to: 0x17b3}, + 68: {from: 0x1813, to: 0x18f0}, + 69: {from: 0x1887, to: 0x434}, + 70: {from: 0x1976, to: 0x1cfe}, + 71: {from: 0x1a71, to: 0x2bad}, + 72: {from: 0x1a87, to: 0x1f6}, + 73: {from: 0x1b57, to: 0x1f8}, + 74: {from: 0x1b83, to: 0x1512}, + 75: {from: 0x2035, to: 0x37ae}, + 76: {from: 0x203a, to: 0x20da}, + 77: {from: 0x2057, to: 0x309}, + 78: {from: 0x20e0, to: 0x272}, + 79: {from: 0x20eb, to: 0x261}, + 80: {from: 0x20ef, to: 0x22b}, + 81: {from: 0x20f6, to: 0x254}, + 82: {from: 0x210c, to: 0x21e8}, + 83: {from: 0x2132, to: 0x27b}, + 84: {from: 0x2196, to: 0x120}, + 85: {from: 0x21cb, to: 0x155e}, + 86: {from: 0x21e3, to: 0x502}, + 87: {from: 0x21f1, to: 0x49d}, + 88: {from: 0x222a, to: 0x120}, + 89: {from: 0x2234, to: 0x120}, + 90: {from: 0x225f, to: 0x927}, + 91: {from: 0x2313, to: 0x3223}, + 92: {from: 0x237f, to: 0x3362}, + 93: {from: 0x246f, to: 0x2c5}, + 94: {from: 0x24e1, to: 0x2fd}, + 95: {from: 0x24ed, to: 0x2f8}, + 96: {from: 0x24f7, to: 0x31d}, + 97: {from: 0x254d, to: 0xb58}, + 98: {from: 0x25a6, to: 0xe2}, + 99: {from: 0x263b, to: 0x2ce}, + 100: {from: 0x26c6, to: 0x26b1}, + 101: {from: 0x26f6, to: 0x3c6}, + 102: {from: 0x2724, to: 0x3cac}, + 103: {from: 0x2762, to: 0x26b1}, + 104: {from: 0x2786, to: 0x4355}, + 105: {from: 0x28ec, to: 0x2834}, + 106: {from: 0x2911, to: 0x34f}, + 107: {from: 0x2983, to: 0x2da4}, + 108: {from: 0x2b17, to: 0x38b}, + 109: {from: 0x2bf9, to: 0x393}, + 110: {from: 0x2c3c, to: 0x3cac}, + 111: {from: 0x2cf9, to: 0x3bc}, + 112: {from: 0x2d10, to: 0x594}, + 113: {from: 0x2d44, to: 0x147}, + 114: {from: 0x2d45, to: 0x147}, + 115: {from: 0x2dfc, to: 0x2ef}, + 116: {from: 0x2e05, to: 0x19c9}, + 117: {from: 0x2e17, to: 0x2d92}, + 118: {from: 0x2e1e, to: 0x290}, + 119: {from: 0x2e51, to: 0x7d}, + 120: {from: 0x2e62, to: 0x227f}, + 121: {from: 0x2e9d, to: 0x2e98}, + 122: {from: 0x2eec, to: 0x2ed4}, + 123: {from: 0x3190, to: 0x3c2}, + 124: {from: 0x3363, to: 0x338b}, + 125: {from: 0x3427, to: 0x3da}, + 126: {from: 0x34eb, to: 0x18cd}, + 127: {from: 0x35e3, to: 0x410}, + 128: {from: 0x3655, to: 0x244}, + 129: {from: 0x3673, to: 0x3f2}, + 130: {from: 0x36fa, to: 0x443}, + 131: {from: 0x37bd, to: 0x120}, + 132: {from: 0x3813, to: 0x38ef}, + 133: {from: 0x3828, to: 0x2c98}, + 134: {from: 0x382c, to: 0xa9}, + 135: {from: 0x382f, to: 0x3225}, + 136: {from: 0x3869, to: 0x39a3}, + 137: {from: 0x388f, to: 0x3fbd}, + 138: {from: 0x38a2, to: 0x39d4}, + 139: {from: 0x38b1, to: 0x1fa1}, + 140: {from: 0x38b2, to: 0x2e97}, + 141: {from: 0x3959, to: 0x47c}, + 142: {from: 0x3b4b, to: 0xd8e}, + 143: {from: 0x3b75, to: 0x136}, + 144: {from: 0x3c96, to: 0x4ba}, + 145: {from: 0x3fba, to: 0xff}, + 146: {from: 0x4205, to: 0xa8e}, + 147: {from: 0x42bb, to: 0x570}, + 148: {from: 0x42f6, to: 0x3f5d}, + 149: {from: 0x4375, to: 0x258}, + 150: {from: 0x43c8, to: 0x36c8}, + 151: {from: 0x43ca, to: 0x10e}, + 152: {from: 0x44ac, to: 0x331f}, + 153: {from: 0x44e0, to: 0x510}, + 154: {from: 0x45c7, to: 0x2406}, + 155: {from: 0x45da, to: 0x26d9}, + 156: {from: 0x460d, to: 0x48ab}, + 157: {from: 0x46ab, to: 0x469d}, + 158: {from: 0x473b, to: 0x4742}, + 159: {from: 0x4913, to: 0x31d}, + 160: {from: 0x49a4, to: 0x521}, } -// Size: 160 bytes, 160 elements -var langAliasTypes = [160]langAliasType{ +// Size: 161 bytes, 161 elements +var langAliasTypes = [161]langAliasType{ // Entry 0 - 3F - 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, 1, - 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0, 2, - 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0, 2, - 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0, 1, + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, + 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0, + 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0, + 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0, // Entry 40 - 7F - 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 1, 1, 1, 1, - 1, 0, 1, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 2, 2, 2, - 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, 0, 1, 0, - 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 2, 1, + 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 1, 1, 1, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 2, 2, + 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, 0, 1, + 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 2, // Entry 80 - BF - 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, - 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, 1, 1, + 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, 0, + 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, 1, + 1, } const ( @@ -717,7 +780,7 @@ const ( // script is an alphabetically sorted list of ISO 15924 codes. The index // of the script in the string, divided by 4, is the internal scriptID. -var script tag.Index = "" + // Size: 928 bytes +const script tag.Index = "" + // Size: 928 bytes "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCprtCyrlCyrsDevaDsrtDuplEgyd" + "EgyhEgypElbaEthiGeokGeorGlagGothGranGrekGujrGuruHanbHangHaniHanoHansHant" + @@ -735,110 +798,195 @@ var script tag.Index = "" + // Size: 928 bytes // suppressScript is an index from langID to the dominant script for that language, // if it exists. If a script is given, it should be suppressed from the language tag. -// Size: 713 bytes, 713 elements -var suppressScript = [713]uint8{ +// Size: 1327 bytes, 1327 elements +var suppressScript = [1327]uint8{ // Entry 0 - 3F - 0x00, 0x00, 0x1e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x27, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x27, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x1e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 40 - 7F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 40 - 7F 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x1e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, // Entry 80 - BF - 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, - 0xd4, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x2d, 0x52, 0x52, 0x52, 0x00, 0x52, - 0x00, 0x52, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x52, 0x52, 0x00, 0x52, - 0x00, 0x00, 0x52, 0x52, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry C0 - FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x52, 0x2e, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x37, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x52, - 0x00, 0x52, 0x52, 0x08, 0x00, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - // Entry 100 - 13F - 0x00, 0x00, 0x52, 0x52, 0x00, 0x37, 0x00, 0x41, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x29, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, - 0x00, 0x52, 0x00, 0x46, 0x00, 0x4a, 0x4b, 0x00, - 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 140 - 17F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + // Entry 100 - 13F + 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x4f, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xd4, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x2d, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x52, 0x00, 0x52, 0x00, 0x52, + // Entry 140 - 17F + 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x05, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x52, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x52, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 180 - 1BF - 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x1e, 0x64, 0x00, 0x00, - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x20, 0x00, - 0x00, 0x00, 0x52, 0x52, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x52, 0x00, 0x52, 0x20, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x52, 0x00, 0x52, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x52, 0x2e, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x37, 0x00, 0x20, 0x00, 0x00, 0x00, // Entry 1C0 - 1FF - 0x00, 0x52, 0x00, 0x00, 0x00, 0x70, 0x52, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x52, 0x75, 0x00, 0x00, 0x00, 0x2f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x52, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, + 0x52, 0x00, 0x52, 0x52, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, 0x52, + 0x00, 0x37, 0x00, 0x00, 0x00, 0x00, 0x41, 0x00, // Entry 200 - 23F - 0x00, 0x52, 0x00, 0x52, 0x00, 0x00, 0x00, 0x1e, - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xc1, 0x00, 0x52, 0x00, 0x52, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 240 - 27F - 0x52, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x1e, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, + 0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x4a, + 0x00, 0x00, 0x4b, 0x00, 0x20, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 280 - 2BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x4f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + // Entry 2C0 - 2FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, + // Entry 300 - 33F + 0x00, 0x00, 0x64, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x20, 0x00, 0x00, 0x00, 0x52, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x6b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, + // Entry 340 - 37F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x52, 0x20, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x70, 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xcd, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xd0, 0x52, 0x00, 0x00, 0x00, 0xd5, 0x00, 0x00, - 0x00, 0x27, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x52, 0x00, 0x52, 0x52, 0x52, 0x00, 0x52, 0x52, + // Entry 380 - 3BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x2f, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x52, 0x00, + // Entry 3C0 - 3FF 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, - // Entry 280 - 2BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x1e, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 400 - 43F + 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 440 - 47F + 0x00, 0x00, 0x52, 0x52, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xcd, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xd0, + 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xd5, 0x00, 0x00, 0x00, 0x27, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x52, 0x00, + // Entry 480 - 4BF + 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, + // Entry 4C0 - 4FF 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x37, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 2C0 - 2FF - 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 500 - 53F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x37, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, } const ( @@ -847,15 +995,15 @@ const ( _BR = 64 _CA = 72 _ES = 109 - _GB = 121 - _MD = 186 - _PT = 236 - _UK = 304 - _US = 306 - _ZZ = 354 - _XA = 320 - _XC = 322 - _XK = 330 + _GB = 122 + _MD = 187 + _PT = 237 + _UK = 305 + _US = 308 + _ZZ = 356 + _XA = 322 + _XC = 324 + _XK = 332 ) // isoRegionOffset needs to be added to the index of regionISO to obtain the regionID @@ -864,8 +1012,8 @@ const ( const isoRegionOffset = 31 // regionTypes defines the status of a region for various standards. -// Size: 355 bytes, 355 elements -var regionTypes = [355]uint8{ +// Size: 357 bytes, 357 elements +var regionTypes = [357]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -882,41 +1030,41 @@ var regionTypes = [355]uint8{ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, + 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry 80 - BF 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - // Entry C0 - FF 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry C0 - FF + 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, - 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, + 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, // Entry 100 - 13F - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x02, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, + 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry 140 - 17F + 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x04, 0x06, 0x06, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, 0x04, + 0x06, 0x06, 0x04, 0x06, 0x05, } // regionISO holds a list of alphabetically sorted 2-letter ISO region codes. @@ -924,68 +1072,68 @@ var regionTypes = [355]uint8{ // - [A-Z}{2}: the first letter of the 2-letter code plus these two // letters form the 3-letter ISO code. // - 0, n: index into altRegionISO3. -var regionISO tag.Index = "" + // Size: 1300 bytes +const regionISO tag.Index = "" + // Size: 1308 bytes "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03FIINFJJIFKLKFMSMFOROFQ" + - "\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGRRC" + - "GS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSRIM" + - "MNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00\x09" + - "KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTULUUX" + - "LVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQMRRT" + - "MSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOORNPPL" + - "NQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00\x12" + - "PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTTQU" + - "\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYCSD" + - "DNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYRSZ" + - "WZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTVUV" + - "TWWNTZZAUAKRUGGAUK UMMIUSSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVUUTWFLF" + - "WKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXOOOXPPP" + - "XQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAFZMMBZR" + - "ARZWWEZZZZ\xff\xff\xff\xff" + "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + + "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + + "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + + "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + + "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + + "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + + "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + + "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + + "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + + "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + + "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + + "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + + "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + + "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + + "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + + "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" // altRegionISO3 holds a list of 3-letter region codes that cannot be // mapped to 2-letter codes using the default algorithm. This is a short list. -var altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" +const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" // altRegionIDs holds a list of regionIDs the positions of which match those // of the 3-letter ISO codes in altRegionISO3. // Size: 22 bytes, 11 elements var altRegionIDs = [11]uint16{ - 0x0056, 0x006f, 0x0086, 0x00a6, 0x00a8, 0x00ab, 0x00e8, 0x0103, - 0x011f, 0x015c, 0x00da, + 0x0056, 0x006f, 0x0087, 0x00a7, 0x00a9, 0x00ac, 0x00e9, 0x0104, + 0x0120, 0x015e, 0x00db, } // Size: 80 bytes, 20 elements var regionOldMap = [20]fromTo{ - 0: {from: 0x43, to: 0xc2}, - 1: {from: 0x57, to: 0xa5}, + 0: {from: 0x43, to: 0xc3}, + 1: {from: 0x57, to: 0xa6}, 2: {from: 0x5e, to: 0x5f}, 3: {from: 0x65, to: 0x3a}, - 4: {from: 0x77, to: 0x76}, - 5: {from: 0x91, to: 0x36}, - 6: {from: 0xa1, to: 0x131}, - 7: {from: 0xbf, to: 0x131}, - 8: {from: 0xd5, to: 0x13c}, - 9: {from: 0xda, to: 0x2a}, - 10: {from: 0xed, to: 0x131}, - 11: {from: 0xf0, to: 0xe0}, - 12: {from: 0xfa, to: 0x6f}, - 13: {from: 0x101, to: 0x161}, - 14: {from: 0x128, to: 0x124}, - 15: {from: 0x130, to: 0x79}, - 16: {from: 0x137, to: 0x13b}, - 17: {from: 0x13e, to: 0x131}, - 18: {from: 0x15a, to: 0x15b}, - 19: {from: 0x160, to: 0x4a}, + 4: {from: 0x78, to: 0x77}, + 5: {from: 0x92, to: 0x36}, + 6: {from: 0xa2, to: 0x132}, + 7: {from: 0xc0, to: 0x132}, + 8: {from: 0xd6, to: 0x13e}, + 9: {from: 0xdb, to: 0x2a}, + 10: {from: 0xee, to: 0x132}, + 11: {from: 0xf1, to: 0xe1}, + 12: {from: 0xfb, to: 0x6f}, + 13: {from: 0x102, to: 0x163}, + 14: {from: 0x129, to: 0x125}, + 15: {from: 0x131, to: 0x7a}, + 16: {from: 0x139, to: 0x13d}, + 17: {from: 0x140, to: 0x132}, + 18: {from: 0x15c, to: 0x15d}, + 19: {from: 0x162, to: 0x4a}, } // m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are // codes indicating collections of regions. -// Size: 710 bytes, 355 elements -var m49 = [355]int16{ +// Size: 714 bytes, 357 elements +var m49 = [357]int16{ // Entry 0 - 3F 0, 1, 2, 3, 5, 9, 11, 13, 14, 15, 17, 18, 19, 21, 29, 30, @@ -1002,41 +1150,41 @@ var m49 = [355]int16{ 192, 132, 531, 162, 196, 203, 278, 276, 0, 262, 208, 212, 214, 204, 12, 0, 218, 233, 818, 732, 232, 724, 231, 967, - 246, 242, 238, 583, 234, 0, 250, 249, - 266, 826, 308, 268, 254, 831, 288, 292, + 0, 246, 242, 238, 583, 234, 0, 250, + 249, 266, 826, 308, 268, 254, 831, 288, // Entry 80 - BF - 304, 270, 324, 312, 226, 300, 239, 320, - 316, 624, 328, 344, 334, 340, 191, 332, - 348, 854, 0, 360, 372, 376, 833, 356, - 86, 368, 364, 352, 380, 832, 388, 400, - 392, 581, 404, 417, 116, 296, 174, 659, - 408, 410, 414, 136, 398, 418, 422, 662, - 438, 144, 430, 426, 440, 442, 428, 434, - 504, 492, 498, 499, 663, 450, 584, 581, + 292, 304, 270, 324, 312, 226, 300, 239, + 320, 316, 624, 328, 344, 334, 340, 191, + 332, 348, 854, 0, 360, 372, 376, 833, + 356, 86, 368, 364, 352, 380, 832, 388, + 400, 392, 581, 404, 417, 116, 296, 174, + 659, 408, 410, 414, 136, 398, 418, 422, + 662, 438, 144, 430, 426, 440, 442, 428, + 434, 504, 492, 498, 499, 663, 450, 584, // Entry C0 - FF - 807, 466, 104, 496, 446, 580, 474, 478, - 500, 470, 480, 462, 454, 484, 458, 508, - 516, 540, 562, 574, 566, 548, 558, 528, - 578, 524, 10, 520, 536, 570, 554, 512, - 591, 0, 604, 258, 598, 608, 586, 616, - 666, 612, 630, 275, 620, 581, 585, 600, - 591, 634, 959, 960, 961, 962, 963, 964, - 965, 966, 967, 968, 969, 970, 971, 972, + 581, 807, 466, 104, 496, 446, 580, 474, + 478, 500, 470, 480, 462, 454, 484, 458, + 508, 516, 540, 562, 574, 566, 548, 558, + 528, 578, 524, 10, 520, 536, 570, 554, + 512, 591, 0, 604, 258, 598, 608, 586, + 616, 666, 612, 630, 275, 620, 581, 585, + 600, 591, 634, 959, 960, 961, 962, 963, + 964, 965, 966, 967, 968, 969, 970, 971, // Entry 100 - 13F - 638, 716, 642, 688, 643, 646, 682, 90, - 690, 729, 752, 702, 654, 705, 744, 703, - 694, 674, 686, 706, 740, 728, 678, 810, - 222, 534, 760, 748, 0, 796, 148, 260, - 768, 764, 762, 772, 626, 795, 788, 776, - 626, 792, 780, 798, 158, 834, 804, 800, - 826, 581, 840, 858, 860, 336, 670, 704, - 862, 92, 850, 704, 548, 876, 581, 882, + 972, 638, 716, 642, 688, 643, 646, 682, + 90, 690, 729, 752, 702, 654, 705, 744, + 703, 694, 674, 686, 706, 740, 728, 678, + 810, 222, 534, 760, 748, 0, 796, 148, + 260, 768, 764, 762, 772, 626, 795, 788, + 776, 626, 792, 780, 798, 158, 834, 804, + 800, 826, 581, 0, 840, 858, 860, 336, + 670, 704, 862, 92, 850, 704, 548, 876, // Entry 140 - 17F - 973, 974, 975, 976, 977, 978, 979, 980, - 981, 982, 983, 984, 985, 986, 987, 988, - 989, 990, 991, 992, 993, 994, 995, 996, - 997, 998, 720, 887, 175, 891, 710, 894, - 180, 716, 999, + 581, 882, 973, 974, 975, 976, 977, 978, + 979, 980, 981, 982, 983, 984, 985, 986, + 987, 988, 989, 990, 991, 992, 993, 994, + 995, 996, 997, 998, 720, 887, 175, 891, + 710, 894, 180, 716, 999, } // m49Index gives indexes into fromM49 based on the three most significant bits @@ -1060,50 +1208,50 @@ var fromM49 = [332]uint16{ 0x402b, 0x4410, 0x4611, 0x482e, 0x4e12, 0x502d, 0x5841, 0x6038, 0x6434, 0x6627, 0x6833, 0x6a13, 0x6c14, 0x7035, 0x7215, 0x783c, 0x7a16, 0x8042, 0x883e, 0x8c32, 0x9045, 0x9444, 0x9840, 0xa847, - 0xac98, 0xb507, 0xb939, 0xc03d, 0xc837, 0xd0c2, 0xd839, 0xe046, - 0xe8a4, 0xf051, 0xf848, 0x0859, 0x10ab, 0x184b, 0x1c17, 0x1e18, + 0xac99, 0xb508, 0xb93b, 0xc03d, 0xc837, 0xd0c3, 0xd839, 0xe046, + 0xe8a5, 0xf051, 0xf848, 0x0859, 0x10ac, 0x184b, 0x1c17, 0x1e18, // Entry 40 - 7F - 0x20b1, 0x2219, 0x291e, 0x2c1a, 0x2e1b, 0x3050, 0x341c, 0x361d, - 0x3852, 0x3d2c, 0x445b, 0x4c49, 0x5453, 0x5ca6, 0x5f5c, 0x644c, - 0x684a, 0x704f, 0x7855, 0x7e8e, 0x8058, 0x885c, 0x965d, 0x983a, - 0xa062, 0xa863, 0xac64, 0xb468, 0xbd18, 0xc484, 0xcc6e, 0xce6e, - 0xd06c, 0xd269, 0xd474, 0xdc72, 0xde86, 0xe471, 0xec70, 0xf030, - 0xf277, 0xf476, 0xfc7c, 0x04e3, 0x091f, 0x0c61, 0x1478, 0x187b, - 0x1c81, 0x26eb, 0x285f, 0x2c5e, 0x305f, 0x407e, 0x487f, 0x50a5, - 0x5885, 0x6080, 0x687a, 0x7083, 0x7888, 0x8087, 0x8882, 0x908a, + 0x20b2, 0x2219, 0x291f, 0x2c1a, 0x2e1b, 0x3050, 0x341c, 0x361d, + 0x3852, 0x3d2d, 0x445b, 0x4c49, 0x5453, 0x5ca7, 0x5f5e, 0x644c, + 0x684a, 0x704f, 0x7855, 0x7e8f, 0x8058, 0x885c, 0x965d, 0x983a, + 0xa062, 0xa863, 0xac64, 0xb468, 0xbd19, 0xc485, 0xcc6e, 0xce6e, + 0xd06c, 0xd269, 0xd475, 0xdc73, 0xde87, 0xe472, 0xec71, 0xf030, + 0xf278, 0xf477, 0xfc7d, 0x04e4, 0x0920, 0x0c61, 0x1479, 0x187c, + 0x1c82, 0x26ec, 0x285f, 0x2c5e, 0x305f, 0x407f, 0x4880, 0x50a6, + 0x5886, 0x6081, 0x687b, 0x7084, 0x7889, 0x8088, 0x8883, 0x908b, // Entry 80 - BF - 0x988f, 0x9c8c, 0xa135, 0xa88d, 0xb08b, 0xb890, 0xc09b, 0xc897, - 0xd093, 0xd89a, 0xe099, 0xe894, 0xf095, 0xf89c, 0x004e, 0x089e, - 0x10a0, 0x1cac, 0x209f, 0x28a2, 0x30a8, 0x34a9, 0x3caa, 0x42a3, - 0x44ad, 0x461e, 0x4cae, 0x54b3, 0x58b6, 0x5cb2, 0x64b7, 0x6cb0, - 0x70b4, 0x74b5, 0x7cc4, 0x84bd, 0x8ccc, 0x94ce, 0x9ccb, 0xa4c1, - 0xacc9, 0xb4c6, 0xbcc7, 0xc0ca, 0xc8cd, 0xd8b9, 0xe0c3, 0xe4ba, - 0xe6bb, 0xe8c8, 0xf0b8, 0xf8cf, 0x00df, 0x08d0, 0x10db, 0x18d9, - 0x20d7, 0x2428, 0x265a, 0x2a2f, 0x2d19, 0x2e3f, 0x30dc, 0x38d1, + 0x9890, 0x9c8d, 0xa137, 0xa88e, 0xb08c, 0xb891, 0xc09c, 0xc898, + 0xd094, 0xd89b, 0xe09a, 0xe895, 0xf096, 0xf89d, 0x004e, 0x089f, + 0x10a1, 0x1cad, 0x20a0, 0x28a3, 0x30a9, 0x34aa, 0x3cab, 0x42a4, + 0x44ae, 0x461e, 0x4caf, 0x54b4, 0x58b7, 0x5cb3, 0x64b8, 0x6cb1, + 0x70b5, 0x74b6, 0x7cc5, 0x84be, 0x8ccd, 0x94cf, 0x9ccc, 0xa4c2, + 0xacca, 0xb4c7, 0xbcc8, 0xc0cb, 0xc8ce, 0xd8ba, 0xe0c4, 0xe4bb, + 0xe6bc, 0xe8c9, 0xf0b9, 0xf8d0, 0x00e0, 0x08d1, 0x10dc, 0x18da, + 0x20d8, 0x2428, 0x265a, 0x2a2f, 0x2d1a, 0x2e3f, 0x30dd, 0x38d2, // Entry C0 - FF - 0x493c, 0x54de, 0x5cd6, 0x64d2, 0x6cd4, 0x74dd, 0x7cd3, 0x84d8, - 0x88c5, 0x8b31, 0x8e73, 0x90be, 0x92ee, 0x94e6, 0x9ee0, 0xace4, - 0xb0ef, 0xb8e2, 0xc0e5, 0xc8e9, 0xd0e7, 0xd8ec, 0xe089, 0xe524, - 0xecea, 0xf4f1, 0xfd00, 0x0502, 0x0704, 0x0d05, 0x183b, 0x1d0c, - 0x26a7, 0x2825, 0x2caf, 0x2ebc, 0x34e8, 0x3d36, 0x4511, 0x4d16, - 0x5506, 0x5d12, 0x6103, 0x6508, 0x6d10, 0x7d0b, 0x7f0f, 0x813b, - 0x830d, 0x8513, 0x8d5e, 0x9961, 0xa15a, 0xa86d, 0xb115, 0xb309, - 0xb86b, 0xc109, 0xc914, 0xd10e, 0xd91b, 0xe10a, 0xe84d, 0xf11a, + 0x493e, 0x54df, 0x5cd7, 0x64d3, 0x6cd5, 0x74de, 0x7cd4, 0x84d9, + 0x88c6, 0x8b32, 0x8e74, 0x90bf, 0x92ef, 0x94e7, 0x9ee1, 0xace5, + 0xb0f0, 0xb8e3, 0xc0e6, 0xc8ea, 0xd0e8, 0xd8ed, 0xe08a, 0xe525, + 0xeceb, 0xf4f2, 0xfd01, 0x0503, 0x0705, 0x0d06, 0x183b, 0x1d0d, + 0x26a8, 0x2825, 0x2cb0, 0x2ebd, 0x34e9, 0x3d38, 0x4512, 0x4d17, + 0x5507, 0x5d13, 0x6104, 0x6509, 0x6d11, 0x7d0c, 0x7f10, 0x813d, + 0x830e, 0x8514, 0x8d60, 0x9963, 0xa15c, 0xa86d, 0xb116, 0xb30a, + 0xb86b, 0xc10a, 0xc915, 0xd10f, 0xd91c, 0xe10b, 0xe84d, 0xf11b, // Entry 100 - 13F - 0xf522, 0xf921, 0x0120, 0x0923, 0x1127, 0x192a, 0x2022, 0x2926, - 0x3129, 0x3725, 0x391d, 0x3d2b, 0x412f, 0x492e, 0x4ec0, 0x5517, - 0x646a, 0x7479, 0x7e7d, 0x809d, 0x8296, 0x852d, 0x9132, 0xa53a, - 0xac36, 0xb533, 0xb934, 0xbd38, 0xd93d, 0xe53f, 0xed5b, 0xef5b, - 0xf656, 0xfd5f, 0x7c1f, 0x7ef2, 0x80f3, 0x82f4, 0x84f5, 0x86f6, - 0x88f7, 0x8af8, 0x8cf9, 0x8e6f, 0x90fb, 0x92fc, 0x94fd, 0x96fe, - 0x98ff, 0x9b40, 0x9d41, 0x9f42, 0xa143, 0xa344, 0xa545, 0xa746, - 0xa947, 0xab48, 0xad49, 0xaf4a, 0xb14b, 0xb34c, 0xb54d, 0xb74e, + 0xf523, 0xf922, 0x0121, 0x0924, 0x1128, 0x192b, 0x2022, 0x2927, + 0x312a, 0x3726, 0x391e, 0x3d2c, 0x4130, 0x492f, 0x4ec1, 0x5518, + 0x646a, 0x747a, 0x7e7e, 0x809e, 0x8297, 0x852e, 0x9134, 0xa53c, + 0xac36, 0xb535, 0xb936, 0xbd3a, 0xd93f, 0xe541, 0xed5d, 0xef5d, + 0xf656, 0xfd61, 0x7c1f, 0x7ef3, 0x80f4, 0x82f5, 0x84f6, 0x86f7, + 0x88f8, 0x8af9, 0x8cfa, 0x8e6f, 0x90fc, 0x92fd, 0x94fe, 0x96ff, + 0x9900, 0x9b42, 0x9d43, 0x9f44, 0xa145, 0xa346, 0xa547, 0xa748, + 0xa949, 0xab4a, 0xad4b, 0xaf4c, 0xb14d, 0xb34e, 0xb54f, 0xb750, // Entry 140 - 17F - 0xb94f, 0xbb50, 0xbd51, 0xbf52, 0xc153, 0xc354, 0xc555, 0xc756, - 0xc957, 0xcb58, 0xcd59, 0xcf62, + 0xb951, 0xbb52, 0xbd53, 0xbf54, 0xc155, 0xc356, 0xc557, 0xc758, + 0xc959, 0xcb5a, 0xcd5b, 0xcf64, } -// Size: 1444 bytes +// Size: 1463 bytes var variantIndex = map[string]uint8{ "1606nict": 0x0, "1694acad": 0x1, @@ -1132,8 +1280,9 @@ var variantIndex = map[string]uint8{ "ekavsk": 0x15, "emodeng": 0x16, "fonipa": 0x48, - "fonupa": 0x49, - "fonxsamp": 0x4a, + "fonnapa": 0x49, + "fonupa": 0x4a, + "fonxsamp": 0x4b, "hepburn": 0x17, "heploc": 0x46, "hognorsk": 0x18, @@ -1166,7 +1315,7 @@ var variantIndex = map[string]uint8{ "rumgr": 0x30, "scotland": 0x31, "scouse": 0x32, - "simple": 0x4b, + "simple": 0x4c, "solba": 0x44, "sotav": 0x33, "surmiran": 0x34, @@ -1198,145 +1347,145 @@ type likelyLangRegion struct { // languages and regions given a script. // Size: 928 bytes, 232 elements var likelyScript = [232]likelyLangRegion{ - 1: {lang: 0xa6, region: 0x82}, - 3: {lang: 0x159, region: 0x104}, - 4: {lang: 0xc, region: 0x97}, - 5: {lang: 0x15, region: 0x6a}, - 7: {lang: 0x16, region: 0x9a}, - 8: {lang: 0xf3, region: 0x27}, - 9: {lang: 0x8, region: 0x9a}, - 10: {lang: 0x27, region: 0x93}, - 11: {lang: 0x2b, region: 0x51}, - 12: {lang: 0x55, region: 0xb2}, - 13: {lang: 0x2c, region: 0x93}, - 14: {lang: 0x4b, region: 0x34}, - 15: {lang: 0x20d, region: 0x97}, - 17: {lang: 0x2c4, region: 0x12c}, - 18: {lang: 0x1e5, region: 0x97}, - 19: {lang: 0xaf, region: 0x76}, - 20: {lang: 0x5b, region: 0x93}, - 21: {lang: 0x47, region: 0xe5}, - 22: {lang: 0x63, region: 0x34}, - 23: {lang: 0x73, region: 0x48}, - 24: {lang: 0x2a8, region: 0x129}, - 25: {lang: 0x6e, region: 0x13b}, - 26: {lang: 0x6c, region: 0x132}, - 28: {lang: 0x71, region: 0x6a}, - 29: {lang: 0xd0, region: 0x5c}, - 30: {lang: 0x207, region: 0x104}, - 32: {lang: 0xe1, region: 0x97}, - 34: {lang: 0xaf, region: 0x76}, - 37: {lang: 0x98, region: 0x6a}, - 38: {lang: 0x23a, region: 0x26}, - 39: {lang: 0x11, region: 0x6e}, - 41: {lang: 0x111, region: 0x7b}, - 42: {lang: 0x7d, region: 0x37}, - 43: {lang: 0xcf, region: 0x12e}, - 44: {lang: 0x20d, region: 0x97}, - 45: {lang: 0x9a, region: 0x85}, - 46: {lang: 0xd3, region: 0x97}, - 47: {lang: 0x1d7, region: 0x97}, - 48: {lang: 0x2c4, region: 0x12c}, - 49: {lang: 0x136, region: 0xa9}, - 50: {lang: 0x2c4, region: 0x52}, - 51: {lang: 0xe9, region: 0xe5}, - 52: {lang: 0x2c4, region: 0x52}, - 53: {lang: 0x2c4, region: 0x12c}, - 54: {lang: 0x18b, region: 0x99}, - 55: {lang: 0xe0, region: 0x95}, - 56: {lang: 0x107, region: 0xa0}, - 57: {lang: 0xe4, region: 0x129}, - 58: {lang: 0xe8, region: 0xad}, - 60: {lang: 0xf2, region: 0x90}, - 62: {lang: 0xa0, region: 0x9c}, - 63: {lang: 0x136, region: 0xa9}, - 64: {lang: 0x10f, region: 0x93}, - 65: {lang: 0x107, region: 0xa0}, - 67: {lang: 0x99, region: 0xc2}, - 68: {lang: 0x107, region: 0xa0}, - 69: {lang: 0x1eb, region: 0xe6}, - 70: {lang: 0x133, region: 0xa4}, - 71: {lang: 0x21a, region: 0x97}, - 74: {lang: 0x135, region: 0x97}, - 75: {lang: 0x136, region: 0xa9}, - 77: {lang: 0x40, region: 0x97}, - 78: {lang: 0x1c2, region: 0x121}, - 79: {lang: 0x165, region: 0xad}, - 84: {lang: 0x158, region: 0x97}, - 85: {lang: 0x15c, region: 0x97}, - 86: {lang: 0x14f, region: 0x85}, - 87: {lang: 0xd0, region: 0x85}, - 88: {lang: 0x15e, region: 0x52}, - 90: {lang: 0x2aa, region: 0x129}, - 91: {lang: 0x2ab, region: 0x129}, - 92: {lang: 0xe1, region: 0x97}, - 93: {lang: 0x1a8, region: 0x9a}, - 94: {lang: 0x2ad, region: 0x52}, - 95: {lang: 0x4c, region: 0x52}, - 97: {lang: 0x17f, region: 0x110}, - 98: {lang: 0x2ae, region: 0x109}, - 99: {lang: 0x2ae, region: 0x109}, - 100: {lang: 0x18d, region: 0x97}, - 101: {lang: 0x196, region: 0x97}, - 102: {lang: 0x18f, region: 0x52}, - 104: {lang: 0x199, region: 0x34}, - 105: {lang: 0x190, region: 0x97}, - 106: {lang: 0x22b, region: 0xe6}, - 107: {lang: 0x1a5, region: 0xc2}, - 108: {lang: 0x2af, region: 0x106}, - 109: {lang: 0x16, region: 0x9f}, - 110: {lang: 0x1b5, region: 0xd9}, - 112: {lang: 0x179, region: 0x82}, - 114: {lang: 0x223, region: 0x94}, - 115: {lang: 0x212, region: 0x97}, - 116: {lang: 0x1d6, region: 0xc3}, - 117: {lang: 0x1d3, region: 0x97}, - 118: {lang: 0x1d5, region: 0x132}, - 119: {lang: 0x238, region: 0x113}, - 120: {lang: 0x16, region: 0x11a}, - 121: {lang: 0x7c, region: 0xc2}, - 122: {lang: 0x147, region: 0x104}, - 123: {lang: 0x172, region: 0x52}, - 124: {lang: 0x1d9, region: 0x9a}, - 125: {lang: 0x1d9, region: 0x52}, - 127: {lang: 0x1e3, region: 0xae}, - 129: {lang: 0xe5, region: 0x52}, - 130: {lang: 0x2b2, region: 0x9a}, - 181: {lang: 0x1f6, region: 0x93}, - 183: {lang: 0x1c4, region: 0x10a}, - 184: {lang: 0x234, region: 0x95}, - 186: {lang: 0x2b3, region: 0x15b}, - 187: {lang: 0x213, region: 0x97}, - 188: {lang: 0x1e, region: 0x132}, - 189: {lang: 0x9b, region: 0x79}, - 190: {lang: 0x20d, region: 0x97}, - 191: {lang: 0x20d, region: 0x97}, - 192: {lang: 0x21a, region: 0x97}, - 193: {lang: 0x228, region: 0xb1}, - 194: {lang: 0x23c, region: 0x97}, - 195: {lang: 0x244, region: 0x93}, - 196: {lang: 0x24e, region: 0x34}, - 197: {lang: 0x24f, region: 0x99}, - 201: {lang: 0x253, region: 0xe5}, - 202: {lang: 0x8a, region: 0x97}, - 203: {lang: 0x255, region: 0x52}, - 204: {lang: 0x126, region: 0x52}, - 205: {lang: 0x251, region: 0x97}, - 206: {lang: 0x27f, region: 0x52}, - 207: {lang: 0x48, region: 0x13b}, - 208: {lang: 0x258, region: 0x97}, - 210: {lang: 0x2c3, region: 0xb8}, - 211: {lang: 0xaa, region: 0xe5}, - 212: {lang: 0x90, region: 0xcb}, - 213: {lang: 0x25d, region: 0x121}, - 214: {lang: 0x4c, region: 0x52}, - 215: {lang: 0x177, region: 0x97}, - 216: {lang: 0x285, region: 0x11a}, - 217: {lang: 0x28e, region: 0xb2}, - 219: {lang: 0xec, region: 0x97}, - 221: {lang: 0x1e1, region: 0x9a}, - 222: {lang: 0xe, region: 0x99}, - 223: {lang: 0xfb, region: 0x52}, + 1: {lang: 0x14d, region: 0x83}, + 3: {lang: 0x2a0, region: 0x105}, + 4: {lang: 0x1f, region: 0x98}, + 5: {lang: 0x3a, region: 0x6a}, + 7: {lang: 0x3b, region: 0x9b}, + 8: {lang: 0x1d5, region: 0x27}, + 9: {lang: 0x13, region: 0x9b}, + 10: {lang: 0x5b, region: 0x94}, + 11: {lang: 0x60, region: 0x51}, + 12: {lang: 0xb9, region: 0xb3}, + 13: {lang: 0x63, region: 0x94}, + 14: {lang: 0xa5, region: 0x34}, + 15: {lang: 0x3e7, region: 0x98}, + 17: {lang: 0x527, region: 0x12d}, + 18: {lang: 0x3af, region: 0x98}, + 19: {lang: 0x15d, region: 0x77}, + 20: {lang: 0xc2, region: 0x94}, + 21: {lang: 0x9d, region: 0xe6}, + 22: {lang: 0xdb, region: 0x34}, + 23: {lang: 0xf2, region: 0x48}, + 24: {lang: 0x4ee, region: 0x12a}, + 25: {lang: 0xe7, region: 0x13d}, + 26: {lang: 0xe5, region: 0x134}, + 28: {lang: 0xf0, region: 0x6a}, + 29: {lang: 0x19e, region: 0x5c}, + 30: {lang: 0x3e0, region: 0x105}, + 32: {lang: 0x1bc, region: 0x98}, + 34: {lang: 0x15d, region: 0x77}, + 37: {lang: 0x132, region: 0x6a}, + 38: {lang: 0x42f, region: 0x26}, + 39: {lang: 0x27, region: 0x6e}, + 41: {lang: 0x20e, region: 0x7c}, + 42: {lang: 0xfd, region: 0x37}, + 43: {lang: 0x19c, region: 0x12f}, + 44: {lang: 0x3e7, region: 0x98}, + 45: {lang: 0x135, region: 0x86}, + 46: {lang: 0x1a2, region: 0x98}, + 47: {lang: 0x39b, region: 0x98}, + 48: {lang: 0x527, region: 0x12d}, + 49: {lang: 0x252, region: 0xaa}, + 50: {lang: 0x527, region: 0x52}, + 51: {lang: 0x1c9, region: 0xe6}, + 52: {lang: 0x527, region: 0x52}, + 53: {lang: 0x527, region: 0x12d}, + 54: {lang: 0x2fb, region: 0x9a}, + 55: {lang: 0x1ba, region: 0x96}, + 56: {lang: 0x1fe, region: 0xa1}, + 57: {lang: 0x1c3, region: 0x12a}, + 58: {lang: 0x1c8, region: 0xae}, + 60: {lang: 0x1d3, region: 0x91}, + 62: {lang: 0x141, region: 0x9d}, + 63: {lang: 0x252, region: 0xaa}, + 64: {lang: 0x20c, region: 0x94}, + 65: {lang: 0x1fe, region: 0xa1}, + 67: {lang: 0x134, region: 0xc3}, + 68: {lang: 0x1fe, region: 0xa1}, + 69: {lang: 0x3b9, region: 0xe7}, + 70: {lang: 0x248, region: 0xa5}, + 71: {lang: 0x3f8, region: 0x98}, + 74: {lang: 0x24f, region: 0x98}, + 75: {lang: 0x252, region: 0xaa}, + 77: {lang: 0x88, region: 0x98}, + 78: {lang: 0x36e, region: 0x122}, + 79: {lang: 0x2b6, region: 0xae}, + 84: {lang: 0x29d, region: 0x98}, + 85: {lang: 0x2a6, region: 0x98}, + 86: {lang: 0x28d, region: 0x86}, + 87: {lang: 0x19e, region: 0x86}, + 88: {lang: 0x2aa, region: 0x52}, + 90: {lang: 0x4f2, region: 0x12a}, + 91: {lang: 0x4f3, region: 0x12a}, + 92: {lang: 0x1bc, region: 0x98}, + 93: {lang: 0x335, region: 0x9b}, + 94: {lang: 0x4f5, region: 0x52}, + 95: {lang: 0xa9, region: 0x52}, + 97: {lang: 0x2e6, region: 0x111}, + 98: {lang: 0x4f6, region: 0x10a}, + 99: {lang: 0x4f6, region: 0x10a}, + 100: {lang: 0x302, region: 0x98}, + 101: {lang: 0x319, region: 0x98}, + 102: {lang: 0x309, region: 0x52}, + 104: {lang: 0x31c, region: 0x34}, + 105: {lang: 0x30c, region: 0x98}, + 106: {lang: 0x412, region: 0xe7}, + 107: {lang: 0x32f, region: 0xc3}, + 108: {lang: 0x4f7, region: 0x107}, + 109: {lang: 0x3b, region: 0xa0}, + 110: {lang: 0x351, region: 0xda}, + 112: {lang: 0x2ce, region: 0x83}, + 114: {lang: 0x401, region: 0x95}, + 115: {lang: 0x3ec, region: 0x98}, + 116: {lang: 0x399, region: 0xc4}, + 117: {lang: 0x393, region: 0x98}, + 118: {lang: 0x397, region: 0x134}, + 119: {lang: 0x427, region: 0x114}, + 120: {lang: 0x3b, region: 0x11b}, + 121: {lang: 0xfc, region: 0xc3}, + 122: {lang: 0x27b, region: 0x105}, + 123: {lang: 0x2c7, region: 0x52}, + 124: {lang: 0x39d, region: 0x9b}, + 125: {lang: 0x39d, region: 0x52}, + 127: {lang: 0x3ab, region: 0xaf}, + 129: {lang: 0x1c4, region: 0x52}, + 130: {lang: 0x4fb, region: 0x9b}, + 181: {lang: 0x3c9, region: 0x94}, + 183: {lang: 0x370, region: 0x10b}, + 184: {lang: 0x41e, region: 0x96}, + 186: {lang: 0x4fd, region: 0x15d}, + 187: {lang: 0x3ee, region: 0x98}, + 188: {lang: 0x45, region: 0x134}, + 189: {lang: 0x138, region: 0x7a}, + 190: {lang: 0x3e7, region: 0x98}, + 191: {lang: 0x3e7, region: 0x98}, + 192: {lang: 0x3f8, region: 0x98}, + 193: {lang: 0x40a, region: 0xb2}, + 194: {lang: 0x431, region: 0x98}, + 195: {lang: 0x43c, region: 0x94}, + 196: {lang: 0x44b, region: 0x34}, + 197: {lang: 0x44c, region: 0x9a}, + 201: {lang: 0x458, region: 0xe6}, + 202: {lang: 0x119, region: 0x98}, + 203: {lang: 0x45c, region: 0x52}, + 204: {lang: 0x230, region: 0x52}, + 205: {lang: 0x44e, region: 0x98}, + 206: {lang: 0x4a3, region: 0x52}, + 207: {lang: 0x9f, region: 0x13d}, + 208: {lang: 0x45f, region: 0x98}, + 210: {lang: 0x526, region: 0xb9}, + 211: {lang: 0x152, region: 0xe6}, + 212: {lang: 0x127, region: 0xcc}, + 213: {lang: 0x469, region: 0x122}, + 214: {lang: 0xa9, region: 0x52}, + 215: {lang: 0x2cc, region: 0x98}, + 216: {lang: 0x4ab, region: 0x11b}, + 217: {lang: 0x4bc, region: 0xb3}, + 219: {lang: 0x1cc, region: 0x98}, + 221: {lang: 0x3a7, region: 0x9b}, + 222: {lang: 0x22, region: 0x9a}, + 223: {lang: 0x1e8, region: 0x52}, } type likelyScriptRegion struct { @@ -1349,807 +1498,1419 @@ type likelyScriptRegion struct { // scripts and regions given incomplete information. If more entries exist for a // given language, region and script are the index and size respectively // of the list in likelyLangList. -// Size: 2852 bytes, 713 elements -var likelyLang = [713]likelyScriptRegion{ - 0: {region: 0x132, script: 0x52, flags: 0x0}, - 1: {region: 0x6e, script: 0x52, flags: 0x0}, - 2: {region: 0x7b, script: 0x1e, flags: 0x0}, - 3: {region: 0x7e, script: 0x52, flags: 0x0}, - 4: {region: 0x93, script: 0x52, flags: 0x0}, - 5: {region: 0x12f, script: 0x52, flags: 0x0}, - 6: {region: 0x7e, script: 0x52, flags: 0x0}, - 7: {region: 0x104, script: 0x1e, flags: 0x0}, - 8: {region: 0x9a, script: 0x9, flags: 0x0}, - 9: {region: 0x126, script: 0x5, flags: 0x0}, - 10: {region: 0x15e, script: 0x52, flags: 0x0}, - 11: {region: 0x51, script: 0x52, flags: 0x0}, - 12: {region: 0x97, script: 0x4, flags: 0x0}, - 13: {region: 0x7e, script: 0x52, flags: 0x0}, - 14: {region: 0x99, script: 0xde, flags: 0x0}, - 15: {region: 0x14a, script: 0x52, flags: 0x0}, - 16: {region: 0x104, script: 0x1e, flags: 0x0}, - 17: {region: 0x6e, script: 0x27, flags: 0x0}, - 18: {region: 0xd4, script: 0x52, flags: 0x0}, - 20: {region: 0x93, script: 0x52, flags: 0x0}, - 21: {region: 0x6a, script: 0x5, flags: 0x0}, - 22: {region: 0x0, script: 0x3, flags: 0x1}, - 23: {region: 0x50, script: 0x52, flags: 0x0}, - 24: {region: 0x3e, script: 0x52, flags: 0x0}, - 25: {region: 0x66, script: 0x5, flags: 0x0}, - 26: {region: 0xb8, script: 0x5, flags: 0x0}, - 27: {region: 0x6a, script: 0x5, flags: 0x0}, - 28: {region: 0x97, script: 0xe, flags: 0x0}, - 29: {region: 0x12d, script: 0x52, flags: 0x0}, - 30: {region: 0x132, script: 0xbc, flags: 0x0}, - 31: {region: 0x6d, script: 0x52, flags: 0x0}, - 32: {region: 0x48, script: 0x52, flags: 0x0}, - 33: {region: 0x104, script: 0x1e, flags: 0x0}, - 34: {region: 0x97, script: 0x20, flags: 0x0}, - 35: {region: 0x3e, script: 0x52, flags: 0x0}, - 36: {region: 0x3, script: 0x5, flags: 0x1}, - 37: {region: 0x104, script: 0x1e, flags: 0x0}, - 38: {region: 0xe6, script: 0x5, flags: 0x0}, - 39: {region: 0x93, script: 0x52, flags: 0x0}, - 40: {region: 0xd9, script: 0x20, flags: 0x0}, - 41: {region: 0x2d, script: 0x52, flags: 0x0}, - 42: {region: 0x51, script: 0x52, flags: 0x0}, - 43: {region: 0x51, script: 0xb, flags: 0x0}, - 44: {region: 0x93, script: 0x52, flags: 0x0}, - 45: {region: 0x51, script: 0x52, flags: 0x0}, - 46: {region: 0x4e, script: 0x52, flags: 0x0}, - 47: {region: 0x46, script: 0x1e, flags: 0x0}, - 48: {region: 0x109, script: 0x5, flags: 0x0}, - 49: {region: 0x15f, script: 0x52, flags: 0x0}, - 50: {region: 0x93, script: 0x52, flags: 0x0}, - 51: {region: 0x12d, script: 0x52, flags: 0x0}, - 52: {region: 0x51, script: 0x52, flags: 0x0}, - 53: {region: 0x97, script: 0xcd, flags: 0x0}, - 54: {region: 0xe6, script: 0x5, flags: 0x0}, - 55: {region: 0x97, script: 0x20, flags: 0x0}, - 56: {region: 0x37, script: 0x1e, flags: 0x0}, - 57: {region: 0x97, script: 0x20, flags: 0x0}, - 58: {region: 0xe6, script: 0x5, flags: 0x0}, - 59: {region: 0x129, script: 0x2d, flags: 0x0}, - 61: {region: 0x97, script: 0x20, flags: 0x0}, - 62: {region: 0x97, script: 0x20, flags: 0x0}, - 63: {region: 0xe5, script: 0x52, flags: 0x0}, - 64: {region: 0x97, script: 0x20, flags: 0x0}, - 65: {region: 0x13c, script: 0x52, flags: 0x0}, - 66: {region: 0xe5, script: 0x52, flags: 0x0}, - 67: {region: 0xd4, script: 0x52, flags: 0x0}, - 68: {region: 0x97, script: 0x20, flags: 0x0}, - 69: {region: 0x93, script: 0x52, flags: 0x0}, - 70: {region: 0x51, script: 0x52, flags: 0x0}, - 71: {region: 0xe5, script: 0x52, flags: 0x0}, - 72: {region: 0x13b, script: 0xcf, flags: 0x0}, - 73: {region: 0xc1, script: 0x52, flags: 0x0}, - 74: {region: 0xc1, script: 0x52, flags: 0x0}, - 75: {region: 0x34, script: 0xe, flags: 0x0}, - 76: {region: 0x52, script: 0xd6, flags: 0x0}, - 77: {region: 0x97, script: 0xe, flags: 0x0}, - 78: {region: 0x9a, script: 0x5, flags: 0x0}, - 79: {region: 0x4e, script: 0x52, flags: 0x0}, - 80: {region: 0x76, script: 0x52, flags: 0x0}, - 81: {region: 0x97, script: 0x20, flags: 0x0}, - 82: {region: 0xe6, script: 0x5, flags: 0x0}, - 83: {region: 0x97, script: 0x20, flags: 0x0}, - 84: {region: 0x32, script: 0x52, flags: 0x0}, - 85: {region: 0xb2, script: 0xc, flags: 0x0}, - 86: {region: 0x51, script: 0x52, flags: 0x0}, - 87: {region: 0xe5, script: 0x52, flags: 0x0}, - 88: {region: 0xe6, script: 0x20, flags: 0x0}, - 89: {region: 0x104, script: 0x1e, flags: 0x0}, - 90: {region: 0x15c, script: 0x52, flags: 0x0}, - 91: {region: 0x93, script: 0x52, flags: 0x0}, - 92: {region: 0x51, script: 0x52, flags: 0x0}, - 93: {region: 0x84, script: 0x52, flags: 0x0}, - 94: {region: 0x6c, script: 0x27, flags: 0x0}, - 95: {region: 0x51, script: 0x52, flags: 0x0}, - 96: {region: 0xc1, script: 0x52, flags: 0x0}, - 97: {region: 0x6d, script: 0x52, flags: 0x0}, - 98: {region: 0xd4, script: 0x52, flags: 0x0}, - 99: {region: 0x8, script: 0x2, flags: 0x1}, - 100: {region: 0x104, script: 0x1e, flags: 0x0}, - 101: {region: 0xe5, script: 0x52, flags: 0x0}, - 102: {region: 0x12f, script: 0x52, flags: 0x0}, - 103: {region: 0x88, script: 0x52, flags: 0x0}, - 104: {region: 0x73, script: 0x52, flags: 0x0}, - 105: {region: 0x104, script: 0x1e, flags: 0x0}, - 106: {region: 0x132, script: 0x52, flags: 0x0}, - 107: {region: 0x48, script: 0x52, flags: 0x0}, - 108: {region: 0x132, script: 0x1a, flags: 0x0}, - 109: {region: 0xa4, script: 0x5, flags: 0x0}, - 110: {region: 0x13b, script: 0x19, flags: 0x0}, - 111: {region: 0x99, script: 0x5, flags: 0x0}, - 112: {region: 0x76, script: 0x52, flags: 0x0}, - 113: {region: 0x6a, script: 0x1c, flags: 0x0}, - 114: {region: 0xe5, script: 0x52, flags: 0x0}, - 115: {region: 0x48, script: 0x17, flags: 0x0}, - 116: {region: 0x48, script: 0x17, flags: 0x0}, - 117: {region: 0x48, script: 0x17, flags: 0x0}, - 118: {region: 0x48, script: 0x17, flags: 0x0}, - 119: {region: 0x48, script: 0x17, flags: 0x0}, - 120: {region: 0x108, script: 0x52, flags: 0x0}, - 121: {region: 0x5d, script: 0x52, flags: 0x0}, - 122: {region: 0xe7, script: 0x52, flags: 0x0}, - 123: {region: 0x48, script: 0x17, flags: 0x0}, - 124: {region: 0xc2, script: 0x79, flags: 0x0}, - 125: {region: 0xa, script: 0x2, flags: 0x1}, - 126: {region: 0x104, script: 0x1e, flags: 0x0}, - 127: {region: 0x79, script: 0x52, flags: 0x0}, - 128: {region: 0x62, script: 0x52, flags: 0x0}, - 129: {region: 0x132, script: 0x52, flags: 0x0}, - 130: {region: 0x104, script: 0x1e, flags: 0x0}, - 131: {region: 0xa2, script: 0x52, flags: 0x0}, - 132: {region: 0x97, script: 0x5, flags: 0x0}, - 133: {region: 0x5f, script: 0x52, flags: 0x0}, - 134: {region: 0x48, script: 0x52, flags: 0x0}, - 135: {region: 0x48, script: 0x52, flags: 0x0}, - 136: {region: 0xd2, script: 0x52, flags: 0x0}, - 137: {region: 0x4e, script: 0x52, flags: 0x0}, - 138: {region: 0x97, script: 0x5, flags: 0x0}, - 139: {region: 0x5f, script: 0x52, flags: 0x0}, - 140: {region: 0xc1, script: 0x52, flags: 0x0}, - 141: {region: 0xce, script: 0x52, flags: 0x0}, - 142: {region: 0xd9, script: 0x20, flags: 0x0}, - 143: {region: 0x51, script: 0x52, flags: 0x0}, - 144: {region: 0xcb, script: 0xd4, flags: 0x0}, - 145: {region: 0x112, script: 0x52, flags: 0x0}, - 146: {region: 0x36, script: 0x52, flags: 0x0}, - 147: {region: 0x42, script: 0xd6, flags: 0x0}, - 148: {region: 0xa2, script: 0x52, flags: 0x0}, - 149: {region: 0x7e, script: 0x52, flags: 0x0}, - 150: {region: 0xd4, script: 0x52, flags: 0x0}, - 151: {region: 0x9c, script: 0x52, flags: 0x0}, - 152: {region: 0x6a, script: 0x25, flags: 0x0}, - 153: {region: 0xc2, script: 0x43, flags: 0x0}, - 154: {region: 0x85, script: 0x2d, flags: 0x0}, - 155: {region: 0xc, script: 0x2, flags: 0x1}, - 156: {region: 0x1, script: 0x52, flags: 0x0}, - 157: {region: 0x6d, script: 0x52, flags: 0x0}, - 158: {region: 0x132, script: 0x52, flags: 0x0}, - 159: {region: 0x69, script: 0x52, flags: 0x0}, - 160: {region: 0x9c, script: 0x3e, flags: 0x0}, - 161: {region: 0x6d, script: 0x52, flags: 0x0}, - 162: {region: 0x51, script: 0x52, flags: 0x0}, - 163: {region: 0x6d, script: 0x52, flags: 0x0}, - 164: {region: 0x9a, script: 0x5, flags: 0x0}, - 165: {region: 0x84, script: 0x52, flags: 0x0}, - 166: {region: 0xe, script: 0x2, flags: 0x1}, - 167: {region: 0xc1, script: 0x52, flags: 0x0}, - 168: {region: 0x70, script: 0x52, flags: 0x0}, - 169: {region: 0x109, script: 0x5, flags: 0x0}, - 170: {region: 0xe5, script: 0x52, flags: 0x0}, - 171: {region: 0x10a, script: 0x52, flags: 0x0}, - 172: {region: 0x71, script: 0x52, flags: 0x0}, - 173: {region: 0x74, script: 0x52, flags: 0x0}, - 174: {region: 0x3a, script: 0x52, flags: 0x0}, - 175: {region: 0x76, script: 0x52, flags: 0x0}, - 176: {region: 0x132, script: 0x52, flags: 0x0}, - 177: {region: 0x76, script: 0x52, flags: 0x0}, - 178: {region: 0x5f, script: 0x52, flags: 0x0}, - 179: {region: 0x5f, script: 0x52, flags: 0x0}, - 180: {region: 0x13d, script: 0x52, flags: 0x0}, - 181: {region: 0xd2, script: 0x52, flags: 0x0}, - 182: {region: 0x9c, script: 0x52, flags: 0x0}, - 183: {region: 0xd4, script: 0x52, flags: 0x0}, - 184: {region: 0x109, script: 0x52, flags: 0x0}, - 185: {region: 0xd7, script: 0x52, flags: 0x0}, - 186: {region: 0x94, script: 0x52, flags: 0x0}, - 187: {region: 0x7e, script: 0x52, flags: 0x0}, - 188: {region: 0xba, script: 0x52, flags: 0x0}, - 189: {region: 0x52, script: 0x34, flags: 0x0}, - 190: {region: 0x93, script: 0x52, flags: 0x0}, - 191: {region: 0x97, script: 0x20, flags: 0x0}, - 192: {region: 0x9a, script: 0x5, flags: 0x0}, - 193: {region: 0x7c, script: 0x52, flags: 0x0}, - 194: {region: 0x79, script: 0x52, flags: 0x0}, - 195: {region: 0x6e, script: 0x27, flags: 0x0}, - 196: {region: 0xd9, script: 0x20, flags: 0x0}, - 197: {region: 0xa5, script: 0x52, flags: 0x0}, - 198: {region: 0xe6, script: 0x5, flags: 0x0}, - 199: {region: 0xe6, script: 0x5, flags: 0x0}, - 200: {region: 0x6d, script: 0x52, flags: 0x0}, - 201: {region: 0x9a, script: 0x5, flags: 0x0}, - 202: {region: 0xef, script: 0x52, flags: 0x0}, - 203: {region: 0x97, script: 0x20, flags: 0x0}, - 204: {region: 0x97, script: 0xd0, flags: 0x0}, - 205: {region: 0x93, script: 0x52, flags: 0x0}, - 206: {region: 0xd7, script: 0x52, flags: 0x0}, - 207: {region: 0x12e, script: 0x2b, flags: 0x0}, - 208: {region: 0x10, script: 0x2, flags: 0x1}, - 209: {region: 0x97, script: 0xe, flags: 0x0}, - 210: {region: 0x4d, script: 0x52, flags: 0x0}, - 211: {region: 0x97, script: 0x2e, flags: 0x0}, - 212: {region: 0x40, script: 0x52, flags: 0x0}, - 213: {region: 0x53, script: 0x52, flags: 0x0}, - 214: {region: 0x7e, script: 0x52, flags: 0x0}, - 216: {region: 0xa2, script: 0x52, flags: 0x0}, - 217: {region: 0x96, script: 0x52, flags: 0x0}, - 218: {region: 0xd9, script: 0x20, flags: 0x0}, - 219: {region: 0x48, script: 0x52, flags: 0x0}, - 220: {region: 0x12, script: 0x3, flags: 0x1}, - 221: {region: 0x52, script: 0x34, flags: 0x0}, - 222: {region: 0x132, script: 0x52, flags: 0x0}, - 223: {region: 0x23, script: 0x5, flags: 0x0}, - 224: {region: 0x95, script: 0x37, flags: 0x0}, - 225: {region: 0x97, script: 0x20, flags: 0x0}, - 226: {region: 0x71, script: 0x52, flags: 0x0}, - 227: {region: 0xe5, script: 0x52, flags: 0x0}, - 228: {region: 0x129, script: 0x39, flags: 0x0}, - 229: {region: 0x52, script: 0x81, flags: 0x0}, - 230: {region: 0xe6, script: 0x5, flags: 0x0}, - 231: {region: 0x97, script: 0x20, flags: 0x0}, - 232: {region: 0xad, script: 0x3a, flags: 0x0}, - 233: {region: 0xe5, script: 0x52, flags: 0x0}, - 234: {region: 0xe6, script: 0x5, flags: 0x0}, - 235: {region: 0xe4, script: 0x52, flags: 0x0}, - 236: {region: 0x97, script: 0x20, flags: 0x0}, - 237: {region: 0x97, script: 0x20, flags: 0x0}, - 238: {region: 0x8e, script: 0x52, flags: 0x0}, - 239: {region: 0x5f, script: 0x52, flags: 0x0}, - 240: {region: 0x52, script: 0x34, flags: 0x0}, - 241: {region: 0x8f, script: 0x52, flags: 0x0}, - 242: {region: 0x90, script: 0x52, flags: 0x0}, - 243: {region: 0x27, script: 0x8, flags: 0x0}, - 244: {region: 0xd0, script: 0x52, flags: 0x0}, - 245: {region: 0x76, script: 0x52, flags: 0x0}, - 246: {region: 0xce, script: 0x52, flags: 0x0}, - 247: {region: 0xd4, script: 0x52, flags: 0x0}, - 248: {region: 0x93, script: 0x52, flags: 0x0}, - 250: {region: 0xd4, script: 0x52, flags: 0x0}, - 251: {region: 0x52, script: 0xdf, flags: 0x0}, - 252: {region: 0x132, script: 0x52, flags: 0x0}, - 253: {region: 0x48, script: 0x52, flags: 0x0}, - 254: {region: 0xe5, script: 0x52, flags: 0x0}, - 255: {region: 0x93, script: 0x52, flags: 0x0}, - 256: {region: 0x104, script: 0x1e, flags: 0x0}, - 258: {region: 0x9b, script: 0x52, flags: 0x0}, - 259: {region: 0x9c, script: 0x52, flags: 0x0}, - 260: {region: 0x48, script: 0x17, flags: 0x0}, - 261: {region: 0x95, script: 0x37, flags: 0x0}, - 262: {region: 0x104, script: 0x52, flags: 0x0}, - 263: {region: 0xa0, script: 0x41, flags: 0x0}, - 264: {region: 0x9e, script: 0x52, flags: 0x0}, - 266: {region: 0x51, script: 0x52, flags: 0x0}, - 267: {region: 0x12e, script: 0x37, flags: 0x0}, - 268: {region: 0x12d, script: 0x52, flags: 0x0}, - 269: {region: 0xd9, script: 0x20, flags: 0x0}, - 270: {region: 0x62, script: 0x52, flags: 0x0}, - 271: {region: 0x93, script: 0x52, flags: 0x0}, - 272: {region: 0x93, script: 0x52, flags: 0x0}, - 273: {region: 0x7b, script: 0x29, flags: 0x0}, - 274: {region: 0x134, script: 0x1e, flags: 0x0}, - 275: {region: 0x66, script: 0x52, flags: 0x0}, - 276: {region: 0xc2, script: 0x52, flags: 0x0}, - 277: {region: 0xd4, script: 0x52, flags: 0x0}, - 278: {region: 0xa2, script: 0x52, flags: 0x0}, - 279: {region: 0xc1, script: 0x52, flags: 0x0}, - 280: {region: 0x104, script: 0x1e, flags: 0x0}, - 281: {region: 0xd4, script: 0x52, flags: 0x0}, - 282: {region: 0x161, script: 0x52, flags: 0x0}, - 283: {region: 0x12d, script: 0x52, flags: 0x0}, - 284: {region: 0x121, script: 0xd5, flags: 0x0}, - 285: {region: 0x59, script: 0x52, flags: 0x0}, - 286: {region: 0x51, script: 0x52, flags: 0x0}, - 287: {region: 0x4e, script: 0x52, flags: 0x0}, - 288: {region: 0x97, script: 0x20, flags: 0x0}, - 289: {region: 0x97, script: 0x20, flags: 0x0}, - 290: {region: 0x4a, script: 0x52, flags: 0x0}, - 291: {region: 0x93, script: 0x52, flags: 0x0}, - 292: {region: 0x40, script: 0x52, flags: 0x0}, - 293: {region: 0x97, script: 0x52, flags: 0x0}, - 294: {region: 0x52, script: 0xcc, flags: 0x0}, - 295: {region: 0x97, script: 0x20, flags: 0x0}, - 296: {region: 0xc1, script: 0x52, flags: 0x0}, - 297: {region: 0x97, script: 0x6b, flags: 0x0}, - 298: {region: 0xe6, script: 0x5, flags: 0x0}, - 299: {region: 0xa2, script: 0x52, flags: 0x0}, - 300: {region: 0x129, script: 0x52, flags: 0x0}, - 301: {region: 0xd0, script: 0x52, flags: 0x0}, - 302: {region: 0xad, script: 0x4f, flags: 0x0}, - 303: {region: 0x15, script: 0x6, flags: 0x1}, - 304: {region: 0x51, script: 0x52, flags: 0x0}, - 305: {region: 0x80, script: 0x52, flags: 0x0}, - 306: {region: 0xa2, script: 0x52, flags: 0x0}, - 307: {region: 0xa4, script: 0x46, flags: 0x0}, - 308: {region: 0x29, script: 0x52, flags: 0x0}, - 309: {region: 0x97, script: 0x4a, flags: 0x0}, - 310: {region: 0xa9, script: 0x4b, flags: 0x0}, - 311: {region: 0x104, script: 0x1e, flags: 0x0}, - 312: {region: 0x97, script: 0x20, flags: 0x0}, - 313: {region: 0x73, script: 0x52, flags: 0x0}, - 314: {region: 0xb2, script: 0x52, flags: 0x0}, - 316: {region: 0x104, script: 0x1e, flags: 0x0}, - 317: {region: 0x110, script: 0x52, flags: 0x0}, - 318: {region: 0xe5, script: 0x52, flags: 0x0}, - 319: {region: 0x104, script: 0x52, flags: 0x0}, - 320: {region: 0x97, script: 0x20, flags: 0x0}, - 321: {region: 0x97, script: 0x5, flags: 0x0}, - 322: {region: 0x12d, script: 0x52, flags: 0x0}, - 323: {region: 0x51, script: 0x52, flags: 0x0}, - 324: {region: 0x5f, script: 0x52, flags: 0x0}, - 325: {region: 0x1b, script: 0x3, flags: 0x1}, - 326: {region: 0x104, script: 0x1e, flags: 0x0}, - 327: {region: 0x104, script: 0x1e, flags: 0x0}, - 328: {region: 0x93, script: 0x52, flags: 0x0}, - 329: {region: 0xe6, script: 0x5, flags: 0x0}, - 330: {region: 0x79, script: 0x52, flags: 0x0}, - 331: {region: 0x121, script: 0xd5, flags: 0x0}, - 332: {region: 0xe6, script: 0x5, flags: 0x0}, - 333: {region: 0x1e, script: 0x5, flags: 0x1}, - 334: {region: 0x135, script: 0x52, flags: 0x0}, - 335: {region: 0x85, script: 0x56, flags: 0x0}, - 336: {region: 0x95, script: 0x37, flags: 0x0}, - 337: {region: 0x12d, script: 0x52, flags: 0x0}, - 338: {region: 0xe6, script: 0x5, flags: 0x0}, - 339: {region: 0x12f, script: 0x52, flags: 0x0}, - 340: {region: 0xb5, script: 0x52, flags: 0x0}, - 341: {region: 0x104, script: 0x1e, flags: 0x0}, - 342: {region: 0x93, script: 0x52, flags: 0x0}, - 343: {region: 0x52, script: 0xd5, flags: 0x0}, - 344: {region: 0x97, script: 0x54, flags: 0x0}, - 345: {region: 0x104, script: 0x1e, flags: 0x0}, - 346: {region: 0x12f, script: 0x52, flags: 0x0}, - 347: {region: 0xd7, script: 0x52, flags: 0x0}, - 348: {region: 0x23, script: 0x2, flags: 0x1}, - 349: {region: 0x9c, script: 0x52, flags: 0x0}, - 350: {region: 0x52, script: 0x58, flags: 0x0}, - 351: {region: 0x93, script: 0x52, flags: 0x0}, - 352: {region: 0x9a, script: 0x5, flags: 0x0}, - 353: {region: 0x132, script: 0x52, flags: 0x0}, - 354: {region: 0x97, script: 0xd0, flags: 0x0}, - 355: {region: 0x9c, script: 0x52, flags: 0x0}, - 356: {region: 0x4a, script: 0x52, flags: 0x0}, - 357: {region: 0xad, script: 0x4f, flags: 0x0}, - 358: {region: 0x4a, script: 0x52, flags: 0x0}, - 359: {region: 0x15f, script: 0x52, flags: 0x0}, - 360: {region: 0x9a, script: 0x5, flags: 0x0}, - 361: {region: 0xb4, script: 0x52, flags: 0x0}, - 362: {region: 0xb6, script: 0x52, flags: 0x0}, - 363: {region: 0x4a, script: 0x52, flags: 0x0}, - 364: {region: 0x4a, script: 0x52, flags: 0x0}, - 365: {region: 0xa2, script: 0x52, flags: 0x0}, - 366: {region: 0xa2, script: 0x52, flags: 0x0}, - 367: {region: 0x9a, script: 0x5, flags: 0x0}, - 368: {region: 0xb6, script: 0x52, flags: 0x0}, - 369: {region: 0x121, script: 0xd5, flags: 0x0}, - 370: {region: 0x52, script: 0x34, flags: 0x0}, - 371: {region: 0x129, script: 0x52, flags: 0x0}, - 372: {region: 0x93, script: 0x52, flags: 0x0}, - 373: {region: 0x51, script: 0x52, flags: 0x0}, - 374: {region: 0x97, script: 0x20, flags: 0x0}, - 375: {region: 0x97, script: 0x20, flags: 0x0}, - 376: {region: 0x93, script: 0x52, flags: 0x0}, - 377: {region: 0x25, script: 0x3, flags: 0x1}, - 378: {region: 0xa2, script: 0x52, flags: 0x0}, - 379: {region: 0xcd, script: 0x52, flags: 0x0}, - 380: {region: 0x104, script: 0x1e, flags: 0x0}, - 381: {region: 0xe5, script: 0x52, flags: 0x0}, - 382: {region: 0x93, script: 0x52, flags: 0x0}, - 383: {region: 0x110, script: 0x52, flags: 0x0}, - 384: {region: 0xa2, script: 0x52, flags: 0x0}, - 385: {region: 0x121, script: 0x5, flags: 0x0}, - 386: {region: 0xca, script: 0x52, flags: 0x0}, - 387: {region: 0xbd, script: 0x52, flags: 0x0}, - 388: {region: 0xcf, script: 0x52, flags: 0x0}, - 389: {region: 0x51, script: 0x52, flags: 0x0}, - 390: {region: 0xd9, script: 0x20, flags: 0x0}, - 391: {region: 0x12d, script: 0x52, flags: 0x0}, - 392: {region: 0xbe, script: 0x52, flags: 0x0}, - 393: {region: 0xde, script: 0x52, flags: 0x0}, - 394: {region: 0x93, script: 0x52, flags: 0x0}, - 395: {region: 0x99, script: 0x36, flags: 0x0}, - 396: {region: 0xc0, script: 0x1e, flags: 0x0}, - 397: {region: 0x97, script: 0x64, flags: 0x0}, - 398: {region: 0x109, script: 0x52, flags: 0x0}, - 399: {region: 0x28, script: 0x3, flags: 0x1}, - 400: {region: 0x97, script: 0xe, flags: 0x0}, - 401: {region: 0xc2, script: 0x6b, flags: 0x0}, - 403: {region: 0x48, script: 0x52, flags: 0x0}, - 404: {region: 0x48, script: 0x52, flags: 0x0}, - 405: {region: 0x36, script: 0x52, flags: 0x0}, - 406: {region: 0x97, script: 0x20, flags: 0x0}, - 407: {region: 0xd9, script: 0x20, flags: 0x0}, - 408: {region: 0x104, script: 0x1e, flags: 0x0}, - 409: {region: 0x34, script: 0x68, flags: 0x0}, - 410: {region: 0x2b, script: 0x3, flags: 0x1}, - 411: {region: 0xc9, script: 0x52, flags: 0x0}, - 412: {region: 0x97, script: 0x20, flags: 0x0}, - 413: {region: 0x51, script: 0x52, flags: 0x0}, - 415: {region: 0x132, script: 0x52, flags: 0x0}, - 416: {region: 0xe6, script: 0x5, flags: 0x0}, - 417: {region: 0xc1, script: 0x52, flags: 0x0}, - 418: {region: 0x97, script: 0x20, flags: 0x0}, - 419: {region: 0x93, script: 0x52, flags: 0x0}, - 420: {region: 0x161, script: 0x52, flags: 0x0}, - 421: {region: 0xc2, script: 0x6b, flags: 0x0}, - 422: {region: 0x104, script: 0x1e, flags: 0x0}, - 423: {region: 0x12f, script: 0x52, flags: 0x0}, - 424: {region: 0x9a, script: 0x5d, flags: 0x0}, - 425: {region: 0x9a, script: 0x5, flags: 0x0}, - 426: {region: 0xdb, script: 0x52, flags: 0x0}, - 428: {region: 0x52, script: 0x34, flags: 0x0}, - 429: {region: 0x9c, script: 0x52, flags: 0x0}, - 430: {region: 0xd0, script: 0x52, flags: 0x0}, - 431: {region: 0xd8, script: 0x52, flags: 0x0}, - 432: {region: 0xcd, script: 0x52, flags: 0x0}, - 433: {region: 0x161, script: 0x52, flags: 0x0}, - 434: {region: 0xcf, script: 0x52, flags: 0x0}, - 435: {region: 0x5f, script: 0x52, flags: 0x0}, - 436: {region: 0xd9, script: 0x20, flags: 0x0}, - 437: {region: 0xd9, script: 0x20, flags: 0x0}, - 438: {region: 0xd0, script: 0x52, flags: 0x0}, - 439: {region: 0xcf, script: 0x52, flags: 0x0}, - 440: {region: 0xcd, script: 0x52, flags: 0x0}, - 441: {region: 0xcd, script: 0x52, flags: 0x0}, - 442: {region: 0x93, script: 0x52, flags: 0x0}, - 443: {region: 0xdd, script: 0x52, flags: 0x0}, - 444: {region: 0x97, script: 0x52, flags: 0x0}, - 445: {region: 0xd7, script: 0x52, flags: 0x0}, - 446: {region: 0x51, script: 0x52, flags: 0x0}, - 447: {region: 0xd8, script: 0x52, flags: 0x0}, - 448: {region: 0x51, script: 0x52, flags: 0x0}, - 449: {region: 0xd8, script: 0x52, flags: 0x0}, - 450: {region: 0x121, script: 0x4e, flags: 0x0}, - 451: {region: 0x97, script: 0x20, flags: 0x0}, - 452: {region: 0x10a, script: 0xb7, flags: 0x0}, - 453: {region: 0x82, script: 0x70, flags: 0x0}, - 454: {region: 0x15e, script: 0x52, flags: 0x0}, - 455: {region: 0x48, script: 0x17, flags: 0x0}, - 456: {region: 0x15e, script: 0x52, flags: 0x0}, - 457: {region: 0x115, script: 0x52, flags: 0x0}, - 458: {region: 0x132, script: 0x52, flags: 0x0}, - 459: {region: 0x52, script: 0x52, flags: 0x0}, - 460: {region: 0xcc, script: 0x52, flags: 0x0}, - 461: {region: 0x12d, script: 0x52, flags: 0x0}, - 462: {region: 0x12f, script: 0x52, flags: 0x0}, - 463: {region: 0x7e, script: 0x52, flags: 0x0}, - 464: {region: 0x76, script: 0x52, flags: 0x0}, - 466: {region: 0x6e, script: 0x52, flags: 0x0}, - 467: {region: 0x97, script: 0x75, flags: 0x0}, - 468: {region: 0x7b, script: 0x1e, flags: 0x0}, - 469: {region: 0x132, script: 0x76, flags: 0x0}, - 470: {region: 0xc3, script: 0x74, flags: 0x0}, - 471: {region: 0x2e, script: 0x3, flags: 0x1}, - 472: {region: 0xe5, script: 0x52, flags: 0x0}, - 473: {region: 0x31, script: 0x2, flags: 0x1}, - 474: {region: 0xe5, script: 0x52, flags: 0x0}, - 475: {region: 0x2f, script: 0x52, flags: 0x0}, - 476: {region: 0xee, script: 0x52, flags: 0x0}, - 477: {region: 0x76, script: 0x52, flags: 0x0}, - 478: {region: 0xd4, script: 0x52, flags: 0x0}, - 479: {region: 0x132, script: 0x52, flags: 0x0}, - 480: {region: 0x48, script: 0x52, flags: 0x0}, - 481: {region: 0x9a, script: 0xdd, flags: 0x0}, - 482: {region: 0x5f, script: 0x52, flags: 0x0}, - 483: {region: 0xae, script: 0x7f, flags: 0x0}, - 485: {region: 0x97, script: 0x12, flags: 0x0}, - 486: {region: 0xa2, script: 0x52, flags: 0x0}, - 487: {region: 0xe7, script: 0x52, flags: 0x0}, - 488: {region: 0x9c, script: 0x52, flags: 0x0}, - 489: {region: 0x85, script: 0x2d, flags: 0x0}, - 490: {region: 0x73, script: 0x52, flags: 0x0}, - 491: {region: 0xe6, script: 0x45, flags: 0x0}, - 492: {region: 0x9a, script: 0x5, flags: 0x0}, - 493: {region: 0x1, script: 0x52, flags: 0x0}, - 494: {region: 0x23, script: 0x5, flags: 0x0}, - 495: {region: 0x40, script: 0x52, flags: 0x0}, - 496: {region: 0x78, script: 0x52, flags: 0x0}, - 497: {region: 0xe2, script: 0x52, flags: 0x0}, - 498: {region: 0x87, script: 0x52, flags: 0x0}, - 499: {region: 0x68, script: 0x52, flags: 0x0}, - 500: {region: 0x97, script: 0x20, flags: 0x0}, - 501: {region: 0x100, script: 0x52, flags: 0x0}, - 502: {region: 0x93, script: 0x52, flags: 0x0}, - 503: {region: 0x9c, script: 0x52, flags: 0x0}, - 504: {region: 0x97, script: 0x52, flags: 0x0}, - 505: {region: 0x33, script: 0x2, flags: 0x1}, - 506: {region: 0xd9, script: 0x20, flags: 0x0}, - 507: {region: 0x34, script: 0xe, flags: 0x0}, - 508: {region: 0x4d, script: 0x52, flags: 0x0}, - 509: {region: 0x70, script: 0x52, flags: 0x0}, - 510: {region: 0x4d, script: 0x52, flags: 0x0}, - 511: {region: 0x9a, script: 0x5, flags: 0x0}, - 512: {region: 0x10a, script: 0x52, flags: 0x0}, - 513: {region: 0x39, script: 0x52, flags: 0x0}, - 514: {region: 0xcf, script: 0x52, flags: 0x0}, - 515: {region: 0x102, script: 0x52, flags: 0x0}, - 516: {region: 0x93, script: 0x52, flags: 0x0}, - 517: {region: 0x12d, script: 0x52, flags: 0x0}, - 518: {region: 0x71, script: 0x52, flags: 0x0}, - 519: {region: 0x104, script: 0x1e, flags: 0x0}, - 520: {region: 0x12e, script: 0x1e, flags: 0x0}, - 521: {region: 0x107, script: 0x52, flags: 0x0}, - 522: {region: 0x105, script: 0x52, flags: 0x0}, - 523: {region: 0x12d, script: 0x52, flags: 0x0}, - 524: {region: 0xa0, script: 0x44, flags: 0x0}, - 525: {region: 0x97, script: 0x20, flags: 0x0}, - 526: {region: 0x7e, script: 0x52, flags: 0x0}, - 527: {region: 0x104, script: 0x1e, flags: 0x0}, - 528: {region: 0xa2, script: 0x52, flags: 0x0}, - 529: {region: 0x93, script: 0x52, flags: 0x0}, - 530: {region: 0x97, script: 0x52, flags: 0x0}, - 531: {region: 0x97, script: 0xbb, flags: 0x0}, - 532: {region: 0x12d, script: 0x52, flags: 0x0}, - 533: {region: 0x9c, script: 0x52, flags: 0x0}, - 534: {region: 0x97, script: 0x20, flags: 0x0}, - 535: {region: 0x9c, script: 0x52, flags: 0x0}, - 536: {region: 0x79, script: 0x52, flags: 0x0}, - 537: {region: 0x48, script: 0x52, flags: 0x0}, - 538: {region: 0x35, script: 0x4, flags: 0x1}, - 539: {region: 0x9c, script: 0x52, flags: 0x0}, - 540: {region: 0x9a, script: 0x5, flags: 0x0}, - 541: {region: 0xd8, script: 0x52, flags: 0x0}, - 542: {region: 0x4e, script: 0x52, flags: 0x0}, - 543: {region: 0xcf, script: 0x52, flags: 0x0}, - 544: {region: 0xcd, script: 0x52, flags: 0x0}, - 545: {region: 0xc1, script: 0x52, flags: 0x0}, - 546: {region: 0x4b, script: 0x52, flags: 0x0}, - 547: {region: 0x94, script: 0x72, flags: 0x0}, - 548: {region: 0xb4, script: 0x52, flags: 0x0}, - 550: {region: 0xb8, script: 0xd2, flags: 0x0}, - 551: {region: 0xc2, script: 0x6b, flags: 0x0}, - 552: {region: 0xb1, script: 0xc1, flags: 0x0}, - 553: {region: 0x6e, script: 0x52, flags: 0x0}, - 554: {region: 0x10f, script: 0x52, flags: 0x0}, - 555: {region: 0xe6, script: 0x5, flags: 0x0}, - 556: {region: 0x10d, script: 0x52, flags: 0x0}, - 557: {region: 0xe7, script: 0x52, flags: 0x0}, - 558: {region: 0x93, script: 0x52, flags: 0x0}, - 559: {region: 0x13f, script: 0x52, flags: 0x0}, - 560: {region: 0x10a, script: 0x52, flags: 0x0}, - 562: {region: 0x10a, script: 0x52, flags: 0x0}, - 563: {region: 0x70, script: 0x52, flags: 0x0}, - 564: {region: 0x95, script: 0xb8, flags: 0x0}, - 565: {region: 0x70, script: 0x52, flags: 0x0}, - 566: {region: 0x161, script: 0x52, flags: 0x0}, - 567: {region: 0xc1, script: 0x52, flags: 0x0}, - 568: {region: 0x113, script: 0x52, flags: 0x0}, - 569: {region: 0x121, script: 0xd5, flags: 0x0}, - 570: {region: 0x26, script: 0x52, flags: 0x0}, - 571: {region: 0x39, script: 0x5, flags: 0x1}, - 572: {region: 0x97, script: 0xc2, flags: 0x0}, - 573: {region: 0x114, script: 0x52, flags: 0x0}, - 574: {region: 0x112, script: 0x52, flags: 0x0}, - 575: {region: 0x97, script: 0x20, flags: 0x0}, - 576: {region: 0x15e, script: 0x52, flags: 0x0}, - 577: {region: 0x6c, script: 0x52, flags: 0x0}, - 578: {region: 0x15e, script: 0x52, flags: 0x0}, - 579: {region: 0x5f, script: 0x52, flags: 0x0}, - 580: {region: 0x93, script: 0x52, flags: 0x0}, - 581: {region: 0x12d, script: 0x52, flags: 0x0}, - 582: {region: 0x82, script: 0x52, flags: 0x0}, - 583: {region: 0x10a, script: 0x52, flags: 0x0}, - 584: {region: 0x12d, script: 0x52, flags: 0x0}, - 585: {region: 0x15c, script: 0x5, flags: 0x0}, - 586: {region: 0x4a, script: 0x52, flags: 0x0}, - 587: {region: 0x5f, script: 0x52, flags: 0x0}, - 588: {region: 0x97, script: 0x20, flags: 0x0}, - 589: {region: 0x93, script: 0x52, flags: 0x0}, - 590: {region: 0x34, script: 0xe, flags: 0x0}, - 591: {region: 0x99, script: 0xc5, flags: 0x0}, - 592: {region: 0xe7, script: 0x52, flags: 0x0}, - 593: {region: 0x97, script: 0xcd, flags: 0x0}, - 594: {region: 0xd9, script: 0x20, flags: 0x0}, - 595: {region: 0xe5, script: 0x52, flags: 0x0}, - 596: {region: 0x97, script: 0x4a, flags: 0x0}, - 597: {region: 0x52, script: 0xcb, flags: 0x0}, - 598: {region: 0xd9, script: 0x20, flags: 0x0}, - 599: {region: 0xd9, script: 0x20, flags: 0x0}, - 600: {region: 0x97, script: 0xd0, flags: 0x0}, - 601: {region: 0x110, script: 0x52, flags: 0x0}, - 602: {region: 0x12f, script: 0x52, flags: 0x0}, - 603: {region: 0x124, script: 0x52, flags: 0x0}, - 604: {region: 0x3e, script: 0x3, flags: 0x1}, - 605: {region: 0x121, script: 0xd5, flags: 0x0}, - 606: {region: 0xd9, script: 0x20, flags: 0x0}, - 607: {region: 0xd9, script: 0x20, flags: 0x0}, - 608: {region: 0xd9, script: 0x20, flags: 0x0}, - 609: {region: 0x6e, script: 0x27, flags: 0x0}, - 610: {region: 0x6c, script: 0x27, flags: 0x0}, - 611: {region: 0xd4, script: 0x52, flags: 0x0}, - 612: {region: 0x125, script: 0x52, flags: 0x0}, - 613: {region: 0x123, script: 0x52, flags: 0x0}, - 614: {region: 0x31, script: 0x52, flags: 0x0}, - 615: {region: 0xd9, script: 0x20, flags: 0x0}, - 616: {region: 0xe5, script: 0x52, flags: 0x0}, - 617: {region: 0x31, script: 0x52, flags: 0x0}, - 618: {region: 0xd2, script: 0x52, flags: 0x0}, - 619: {region: 0x15e, script: 0x52, flags: 0x0}, - 620: {region: 0x127, script: 0x52, flags: 0x0}, - 621: {region: 0xcc, script: 0x52, flags: 0x0}, - 622: {region: 0xe4, script: 0x52, flags: 0x0}, - 623: {region: 0x129, script: 0x52, flags: 0x0}, - 624: {region: 0x129, script: 0x52, flags: 0x0}, - 625: {region: 0x12c, script: 0x52, flags: 0x0}, - 626: {region: 0x15e, script: 0x52, flags: 0x0}, - 627: {region: 0x85, script: 0x2d, flags: 0x0}, - 628: {region: 0xd9, script: 0x20, flags: 0x0}, - 629: {region: 0xe5, script: 0x52, flags: 0x0}, - 630: {region: 0x42, script: 0xd6, flags: 0x0}, - 631: {region: 0x104, script: 0x1e, flags: 0x0}, - 632: {region: 0x12f, script: 0x52, flags: 0x0}, - 633: {region: 0x121, script: 0xd5, flags: 0x0}, - 634: {region: 0x31, script: 0x52, flags: 0x0}, - 635: {region: 0xcc, script: 0x52, flags: 0x0}, - 636: {region: 0x12b, script: 0x52, flags: 0x0}, - 638: {region: 0xd2, script: 0x52, flags: 0x0}, - 639: {region: 0x52, script: 0xce, flags: 0x0}, - 640: {region: 0xe3, script: 0x52, flags: 0x0}, - 641: {region: 0x104, script: 0x1e, flags: 0x0}, - 642: {region: 0xb8, script: 0x52, flags: 0x0}, - 643: {region: 0x104, script: 0x1e, flags: 0x0}, - 644: {region: 0x41, script: 0x4, flags: 0x1}, - 645: {region: 0x11a, script: 0xd8, flags: 0x0}, - 646: {region: 0x12e, script: 0x1e, flags: 0x0}, - 647: {region: 0x73, script: 0x52, flags: 0x0}, - 648: {region: 0x29, script: 0x52, flags: 0x0}, - 650: {region: 0x45, script: 0x3, flags: 0x1}, - 651: {region: 0x97, script: 0xe, flags: 0x0}, - 652: {region: 0xe6, script: 0x5, flags: 0x0}, - 653: {region: 0x48, script: 0x4, flags: 0x1}, - 654: {region: 0xb2, script: 0xd9, flags: 0x0}, - 655: {region: 0x15e, script: 0x52, flags: 0x0}, - 656: {region: 0x9c, script: 0x52, flags: 0x0}, - 657: {region: 0x104, script: 0x52, flags: 0x0}, - 658: {region: 0x13b, script: 0x52, flags: 0x0}, - 659: {region: 0x119, script: 0x52, flags: 0x0}, - 660: {region: 0x35, script: 0x52, flags: 0x0}, - 661: {region: 0x5f, script: 0x52, flags: 0x0}, - 662: {region: 0xcf, script: 0x52, flags: 0x0}, - 663: {region: 0x1, script: 0x52, flags: 0x0}, - 664: {region: 0x104, script: 0x52, flags: 0x0}, - 665: {region: 0x69, script: 0x52, flags: 0x0}, - 666: {region: 0x12d, script: 0x52, flags: 0x0}, - 667: {region: 0x35, script: 0x52, flags: 0x0}, - 668: {region: 0x4d, script: 0x52, flags: 0x0}, - 669: {region: 0x6e, script: 0x27, flags: 0x0}, - 670: {region: 0xe5, script: 0x52, flags: 0x0}, - 671: {region: 0x2e, script: 0x52, flags: 0x0}, - 672: {region: 0x97, script: 0xd0, flags: 0x0}, - 673: {region: 0x97, script: 0x20, flags: 0x0}, - 674: {region: 0x13d, script: 0x52, flags: 0x0}, - 675: {region: 0xa6, script: 0x5, flags: 0x0}, - 676: {region: 0x112, script: 0x52, flags: 0x0}, - 677: {region: 0x97, script: 0x20, flags: 0x0}, - 678: {region: 0x52, script: 0x34, flags: 0x0}, - 679: {region: 0x40, script: 0x52, flags: 0x0}, - 680: {region: 0x129, script: 0x18, flags: 0x0}, - 681: {region: 0x15e, script: 0x52, flags: 0x0}, - 682: {region: 0x129, script: 0x5a, flags: 0x0}, - 683: {region: 0x129, script: 0x5b, flags: 0x0}, - 684: {region: 0x7b, script: 0x29, flags: 0x0}, - 685: {region: 0x52, script: 0x5e, flags: 0x0}, - 686: {region: 0x109, script: 0x62, flags: 0x0}, - 687: {region: 0x106, script: 0x6c, flags: 0x0}, - 688: {region: 0x97, script: 0x20, flags: 0x0}, - 689: {region: 0x12f, script: 0x52, flags: 0x0}, - 690: {region: 0x9a, script: 0x82, flags: 0x0}, - 691: {region: 0x15b, script: 0xba, flags: 0x0}, - 692: {region: 0xd9, script: 0x20, flags: 0x0}, - 693: {region: 0xcf, script: 0x52, flags: 0x0}, - 694: {region: 0x73, script: 0x52, flags: 0x0}, - 695: {region: 0x51, script: 0x52, flags: 0x0}, - 696: {region: 0x51, script: 0x52, flags: 0x0}, - 697: {region: 0x1, script: 0x37, flags: 0x0}, - 698: {region: 0xd4, script: 0x52, flags: 0x0}, - 699: {region: 0x40, script: 0x52, flags: 0x0}, - 700: {region: 0xcd, script: 0x52, flags: 0x0}, - 701: {region: 0x4c, script: 0x3, flags: 0x1}, - 702: {region: 0x52, script: 0x52, flags: 0x0}, - 703: {region: 0x109, script: 0x52, flags: 0x0}, - 705: {region: 0xa6, script: 0x5, flags: 0x0}, - 706: {region: 0xd7, script: 0x52, flags: 0x0}, - 707: {region: 0xb8, script: 0xd2, flags: 0x0}, - 708: {region: 0x4f, script: 0x14, flags: 0x1}, - 709: {region: 0xce, script: 0x52, flags: 0x0}, - 710: {region: 0x15e, script: 0x52, flags: 0x0}, - 712: {region: 0x129, script: 0x52, flags: 0x0}, +// Size: 5308 bytes, 1327 elements +var likelyLang = [1327]likelyScriptRegion{ + 0: {region: 0x134, script: 0x52, flags: 0x0}, + 1: {region: 0x6e, script: 0x52, flags: 0x0}, + 2: {region: 0x164, script: 0x52, flags: 0x0}, + 3: {region: 0x164, script: 0x52, flags: 0x0}, + 4: {region: 0x164, script: 0x52, flags: 0x0}, + 5: {region: 0x7c, script: 0x1e, flags: 0x0}, + 6: {region: 0x164, script: 0x52, flags: 0x0}, + 7: {region: 0x164, script: 0x1e, flags: 0x0}, + 8: {region: 0x7f, script: 0x52, flags: 0x0}, + 9: {region: 0x164, script: 0x52, flags: 0x0}, + 10: {region: 0x164, script: 0x52, flags: 0x0}, + 11: {region: 0x164, script: 0x52, flags: 0x0}, + 12: {region: 0x94, script: 0x52, flags: 0x0}, + 13: {region: 0x130, script: 0x52, flags: 0x0}, + 14: {region: 0x7f, script: 0x52, flags: 0x0}, + 15: {region: 0x164, script: 0x52, flags: 0x0}, + 16: {region: 0x164, script: 0x52, flags: 0x0}, + 17: {region: 0x105, script: 0x1e, flags: 0x0}, + 18: {region: 0x164, script: 0x52, flags: 0x0}, + 19: {region: 0x9b, script: 0x9, flags: 0x0}, + 20: {region: 0x127, script: 0x5, flags: 0x0}, + 21: {region: 0x164, script: 0x52, flags: 0x0}, + 22: {region: 0x160, script: 0x52, flags: 0x0}, + 23: {region: 0x164, script: 0x52, flags: 0x0}, + 24: {region: 0x164, script: 0x52, flags: 0x0}, + 25: {region: 0x164, script: 0x52, flags: 0x0}, + 26: {region: 0x164, script: 0x52, flags: 0x0}, + 27: {region: 0x164, script: 0x52, flags: 0x0}, + 28: {region: 0x51, script: 0x52, flags: 0x0}, + 29: {region: 0x164, script: 0x52, flags: 0x0}, + 30: {region: 0x164, script: 0x52, flags: 0x0}, + 31: {region: 0x98, script: 0x4, flags: 0x0}, + 32: {region: 0x164, script: 0x52, flags: 0x0}, + 33: {region: 0x7f, script: 0x52, flags: 0x0}, + 34: {region: 0x9a, script: 0xde, flags: 0x0}, + 35: {region: 0x164, script: 0x52, flags: 0x0}, + 36: {region: 0x164, script: 0x52, flags: 0x0}, + 37: {region: 0x14c, script: 0x52, flags: 0x0}, + 38: {region: 0x105, script: 0x1e, flags: 0x0}, + 39: {region: 0x6e, script: 0x27, flags: 0x0}, + 40: {region: 0x164, script: 0x52, flags: 0x0}, + 41: {region: 0x164, script: 0x52, flags: 0x0}, + 42: {region: 0xd5, script: 0x52, flags: 0x0}, + 43: {region: 0x164, script: 0x52, flags: 0x0}, + 45: {region: 0x164, script: 0x52, flags: 0x0}, + 46: {region: 0x164, script: 0x52, flags: 0x0}, + 47: {region: 0x164, script: 0x52, flags: 0x0}, + 48: {region: 0x164, script: 0x52, flags: 0x0}, + 49: {region: 0x164, script: 0x52, flags: 0x0}, + 50: {region: 0x164, script: 0x52, flags: 0x0}, + 51: {region: 0x94, script: 0x52, flags: 0x0}, + 52: {region: 0x164, script: 0x5, flags: 0x0}, + 53: {region: 0x121, script: 0x5, flags: 0x0}, + 54: {region: 0x164, script: 0x52, flags: 0x0}, + 55: {region: 0x164, script: 0x52, flags: 0x0}, + 56: {region: 0x164, script: 0x52, flags: 0x0}, + 57: {region: 0x164, script: 0x52, flags: 0x0}, + 58: {region: 0x6a, script: 0x5, flags: 0x0}, + 59: {region: 0x0, script: 0x3, flags: 0x1}, + 60: {region: 0x164, script: 0x52, flags: 0x0}, + 61: {region: 0x50, script: 0x52, flags: 0x0}, + 62: {region: 0x3e, script: 0x52, flags: 0x0}, + 63: {region: 0x66, script: 0x5, flags: 0x0}, + 65: {region: 0xb9, script: 0x5, flags: 0x0}, + 66: {region: 0x6a, script: 0x5, flags: 0x0}, + 67: {region: 0x98, script: 0xe, flags: 0x0}, + 68: {region: 0x12e, script: 0x52, flags: 0x0}, + 69: {region: 0x134, script: 0xbc, flags: 0x0}, + 70: {region: 0x164, script: 0x52, flags: 0x0}, + 71: {region: 0x164, script: 0x52, flags: 0x0}, + 72: {region: 0x6d, script: 0x52, flags: 0x0}, + 73: {region: 0x164, script: 0x52, flags: 0x0}, + 74: {region: 0x164, script: 0x52, flags: 0x0}, + 75: {region: 0x48, script: 0x52, flags: 0x0}, + 76: {region: 0x164, script: 0x52, flags: 0x0}, + 77: {region: 0x105, script: 0x1e, flags: 0x0}, + 78: {region: 0x164, script: 0x5, flags: 0x0}, + 79: {region: 0x164, script: 0x52, flags: 0x0}, + 80: {region: 0x164, script: 0x52, flags: 0x0}, + 81: {region: 0x164, script: 0x52, flags: 0x0}, + 82: {region: 0x98, script: 0x20, flags: 0x0}, + 83: {region: 0x164, script: 0x52, flags: 0x0}, + 84: {region: 0x164, script: 0x52, flags: 0x0}, + 85: {region: 0x164, script: 0x52, flags: 0x0}, + 86: {region: 0x3e, script: 0x52, flags: 0x0}, + 87: {region: 0x164, script: 0x52, flags: 0x0}, + 88: {region: 0x3, script: 0x5, flags: 0x1}, + 89: {region: 0x105, script: 0x1e, flags: 0x0}, + 90: {region: 0xe7, script: 0x5, flags: 0x0}, + 91: {region: 0x94, script: 0x52, flags: 0x0}, + 92: {region: 0xda, script: 0x20, flags: 0x0}, + 93: {region: 0x2d, script: 0x52, flags: 0x0}, + 94: {region: 0x51, script: 0x52, flags: 0x0}, + 95: {region: 0x164, script: 0x52, flags: 0x0}, + 96: {region: 0x51, script: 0xb, flags: 0x0}, + 97: {region: 0x164, script: 0x52, flags: 0x0}, + 98: {region: 0x164, script: 0x52, flags: 0x0}, + 99: {region: 0x94, script: 0x52, flags: 0x0}, + 100: {region: 0x164, script: 0x52, flags: 0x0}, + 101: {region: 0x51, script: 0x52, flags: 0x0}, + 102: {region: 0x164, script: 0x52, flags: 0x0}, + 103: {region: 0x164, script: 0x52, flags: 0x0}, + 104: {region: 0x164, script: 0x52, flags: 0x0}, + 105: {region: 0x164, script: 0x52, flags: 0x0}, + 106: {region: 0x4e, script: 0x52, flags: 0x0}, + 107: {region: 0x164, script: 0x52, flags: 0x0}, + 108: {region: 0x164, script: 0x52, flags: 0x0}, + 109: {region: 0x164, script: 0x52, flags: 0x0}, + 110: {region: 0x164, script: 0x27, flags: 0x0}, + 111: {region: 0x164, script: 0x52, flags: 0x0}, + 112: {region: 0x164, script: 0x52, flags: 0x0}, + 113: {region: 0x46, script: 0x1e, flags: 0x0}, + 114: {region: 0x164, script: 0x52, flags: 0x0}, + 115: {region: 0x164, script: 0x52, flags: 0x0}, + 116: {region: 0x10a, script: 0x5, flags: 0x0}, + 117: {region: 0x161, script: 0x52, flags: 0x0}, + 118: {region: 0x164, script: 0x52, flags: 0x0}, + 119: {region: 0x94, script: 0x52, flags: 0x0}, + 120: {region: 0x164, script: 0x52, flags: 0x0}, + 121: {region: 0x12e, script: 0x52, flags: 0x0}, + 122: {region: 0x51, script: 0x52, flags: 0x0}, + 123: {region: 0x98, script: 0xcd, flags: 0x0}, + 124: {region: 0xe7, script: 0x5, flags: 0x0}, + 125: {region: 0x98, script: 0x20, flags: 0x0}, + 126: {region: 0x37, script: 0x1e, flags: 0x0}, + 127: {region: 0x98, script: 0x20, flags: 0x0}, + 128: {region: 0xe7, script: 0x5, flags: 0x0}, + 129: {region: 0x12a, script: 0x2d, flags: 0x0}, + 131: {region: 0x98, script: 0x20, flags: 0x0}, + 132: {region: 0x164, script: 0x52, flags: 0x0}, + 133: {region: 0x98, script: 0x20, flags: 0x0}, + 134: {region: 0xe6, script: 0x52, flags: 0x0}, + 135: {region: 0x164, script: 0x52, flags: 0x0}, + 136: {region: 0x98, script: 0x20, flags: 0x0}, + 137: {region: 0x164, script: 0x52, flags: 0x0}, + 138: {region: 0x13e, script: 0x52, flags: 0x0}, + 139: {region: 0x164, script: 0x52, flags: 0x0}, + 140: {region: 0x164, script: 0x52, flags: 0x0}, + 141: {region: 0xe6, script: 0x52, flags: 0x0}, + 142: {region: 0x164, script: 0x52, flags: 0x0}, + 143: {region: 0xd5, script: 0x52, flags: 0x0}, + 144: {region: 0x164, script: 0x52, flags: 0x0}, + 145: {region: 0x164, script: 0x52, flags: 0x0}, + 146: {region: 0x164, script: 0x52, flags: 0x0}, + 147: {region: 0x164, script: 0x27, flags: 0x0}, + 148: {region: 0x98, script: 0x20, flags: 0x0}, + 149: {region: 0x94, script: 0x52, flags: 0x0}, + 150: {region: 0x164, script: 0x52, flags: 0x0}, + 151: {region: 0x164, script: 0x52, flags: 0x0}, + 152: {region: 0x113, script: 0x52, flags: 0x0}, + 153: {region: 0x164, script: 0x52, flags: 0x0}, + 154: {region: 0x164, script: 0x52, flags: 0x0}, + 155: {region: 0x51, script: 0x52, flags: 0x0}, + 156: {region: 0x164, script: 0x52, flags: 0x0}, + 157: {region: 0xe6, script: 0x52, flags: 0x0}, + 158: {region: 0x164, script: 0x52, flags: 0x0}, + 159: {region: 0x13d, script: 0xcf, flags: 0x0}, + 160: {region: 0xc2, script: 0x52, flags: 0x0}, + 161: {region: 0x164, script: 0x52, flags: 0x0}, + 162: {region: 0x164, script: 0x52, flags: 0x0}, + 163: {region: 0xc2, script: 0x52, flags: 0x0}, + 164: {region: 0x164, script: 0x52, flags: 0x0}, + 165: {region: 0x34, script: 0xe, flags: 0x0}, + 166: {region: 0x164, script: 0x52, flags: 0x0}, + 167: {region: 0x164, script: 0x52, flags: 0x0}, + 168: {region: 0x164, script: 0x52, flags: 0x0}, + 169: {region: 0x52, script: 0xd6, flags: 0x0}, + 170: {region: 0x164, script: 0x52, flags: 0x0}, + 171: {region: 0x164, script: 0x52, flags: 0x0}, + 172: {region: 0x164, script: 0x52, flags: 0x0}, + 173: {region: 0x98, script: 0xe, flags: 0x0}, + 174: {region: 0x164, script: 0x52, flags: 0x0}, + 175: {region: 0x9b, script: 0x5, flags: 0x0}, + 176: {region: 0x164, script: 0x52, flags: 0x0}, + 177: {region: 0x4e, script: 0x52, flags: 0x0}, + 178: {region: 0x77, script: 0x52, flags: 0x0}, + 179: {region: 0x98, script: 0x20, flags: 0x0}, + 180: {region: 0xe7, script: 0x5, flags: 0x0}, + 181: {region: 0x98, script: 0x20, flags: 0x0}, + 182: {region: 0x164, script: 0x52, flags: 0x0}, + 183: {region: 0x32, script: 0x52, flags: 0x0}, + 184: {region: 0x164, script: 0x52, flags: 0x0}, + 185: {region: 0xb3, script: 0xc, flags: 0x0}, + 186: {region: 0x51, script: 0x52, flags: 0x0}, + 187: {region: 0x164, script: 0x27, flags: 0x0}, + 188: {region: 0xe6, script: 0x52, flags: 0x0}, + 189: {region: 0x164, script: 0x52, flags: 0x0}, + 190: {region: 0xe7, script: 0x20, flags: 0x0}, + 191: {region: 0x105, script: 0x1e, flags: 0x0}, + 192: {region: 0x15e, script: 0x52, flags: 0x0}, + 193: {region: 0x164, script: 0x52, flags: 0x0}, + 194: {region: 0x94, script: 0x52, flags: 0x0}, + 195: {region: 0x164, script: 0x52, flags: 0x0}, + 196: {region: 0x51, script: 0x52, flags: 0x0}, + 197: {region: 0x164, script: 0x52, flags: 0x0}, + 198: {region: 0x164, script: 0x52, flags: 0x0}, + 199: {region: 0x164, script: 0x52, flags: 0x0}, + 200: {region: 0x85, script: 0x52, flags: 0x0}, + 201: {region: 0x164, script: 0x52, flags: 0x0}, + 202: {region: 0x164, script: 0x52, flags: 0x0}, + 203: {region: 0x164, script: 0x52, flags: 0x0}, + 204: {region: 0x164, script: 0x52, flags: 0x0}, + 205: {region: 0x6c, script: 0x27, flags: 0x0}, + 206: {region: 0x164, script: 0x52, flags: 0x0}, + 207: {region: 0x164, script: 0x52, flags: 0x0}, + 208: {region: 0x51, script: 0x52, flags: 0x0}, + 209: {region: 0x164, script: 0x52, flags: 0x0}, + 210: {region: 0x164, script: 0x52, flags: 0x0}, + 211: {region: 0xc2, script: 0x52, flags: 0x0}, + 212: {region: 0x164, script: 0x52, flags: 0x0}, + 213: {region: 0x164, script: 0x52, flags: 0x0}, + 214: {region: 0x164, script: 0x52, flags: 0x0}, + 215: {region: 0x6d, script: 0x52, flags: 0x0}, + 216: {region: 0x164, script: 0x52, flags: 0x0}, + 217: {region: 0x164, script: 0x52, flags: 0x0}, + 218: {region: 0xd5, script: 0x52, flags: 0x0}, + 219: {region: 0x34, script: 0x16, flags: 0x0}, + 220: {region: 0x105, script: 0x1e, flags: 0x0}, + 221: {region: 0xe6, script: 0x52, flags: 0x0}, + 222: {region: 0x164, script: 0x52, flags: 0x0}, + 223: {region: 0x130, script: 0x52, flags: 0x0}, + 224: {region: 0x89, script: 0x52, flags: 0x0}, + 225: {region: 0x74, script: 0x52, flags: 0x0}, + 226: {region: 0x105, script: 0x1e, flags: 0x0}, + 227: {region: 0x134, script: 0x52, flags: 0x0}, + 228: {region: 0x48, script: 0x52, flags: 0x0}, + 229: {region: 0x134, script: 0x1a, flags: 0x0}, + 230: {region: 0xa5, script: 0x5, flags: 0x0}, + 231: {region: 0x13d, script: 0x19, flags: 0x0}, + 232: {region: 0x164, script: 0x52, flags: 0x0}, + 233: {region: 0x9a, script: 0x5, flags: 0x0}, + 234: {region: 0x164, script: 0x52, flags: 0x0}, + 235: {region: 0x164, script: 0x52, flags: 0x0}, + 236: {region: 0x164, script: 0x52, flags: 0x0}, + 237: {region: 0x164, script: 0x52, flags: 0x0}, + 238: {region: 0x164, script: 0x52, flags: 0x0}, + 239: {region: 0x77, script: 0x52, flags: 0x0}, + 240: {region: 0x6a, script: 0x1c, flags: 0x0}, + 241: {region: 0xe6, script: 0x52, flags: 0x0}, + 242: {region: 0x48, script: 0x17, flags: 0x0}, + 243: {region: 0x12f, script: 0x1e, flags: 0x0}, + 244: {region: 0x48, script: 0x17, flags: 0x0}, + 245: {region: 0x48, script: 0x17, flags: 0x0}, + 246: {region: 0x48, script: 0x17, flags: 0x0}, + 247: {region: 0x48, script: 0x17, flags: 0x0}, + 248: {region: 0x109, script: 0x52, flags: 0x0}, + 249: {region: 0x5d, script: 0x52, flags: 0x0}, + 250: {region: 0xe8, script: 0x52, flags: 0x0}, + 251: {region: 0x48, script: 0x17, flags: 0x0}, + 252: {region: 0xc3, script: 0x79, flags: 0x0}, + 253: {region: 0x8, script: 0x2, flags: 0x1}, + 254: {region: 0x105, script: 0x1e, flags: 0x0}, + 255: {region: 0x7a, script: 0x52, flags: 0x0}, + 256: {region: 0x62, script: 0x52, flags: 0x0}, + 257: {region: 0x164, script: 0x52, flags: 0x0}, + 258: {region: 0x164, script: 0x52, flags: 0x0}, + 259: {region: 0x164, script: 0x52, flags: 0x0}, + 260: {region: 0x164, script: 0x52, flags: 0x0}, + 261: {region: 0x134, script: 0x52, flags: 0x0}, + 262: {region: 0x105, script: 0x1e, flags: 0x0}, + 263: {region: 0xa3, script: 0x52, flags: 0x0}, + 264: {region: 0x164, script: 0x52, flags: 0x0}, + 265: {region: 0x164, script: 0x52, flags: 0x0}, + 266: {region: 0x98, script: 0x5, flags: 0x0}, + 267: {region: 0x164, script: 0x52, flags: 0x0}, + 268: {region: 0x5f, script: 0x52, flags: 0x0}, + 269: {region: 0x164, script: 0x52, flags: 0x0}, + 270: {region: 0x48, script: 0x52, flags: 0x0}, + 271: {region: 0x164, script: 0x52, flags: 0x0}, + 272: {region: 0x164, script: 0x52, flags: 0x0}, + 273: {region: 0x164, script: 0x52, flags: 0x0}, + 274: {region: 0x164, script: 0x5, flags: 0x0}, + 275: {region: 0x48, script: 0x52, flags: 0x0}, + 276: {region: 0x164, script: 0x52, flags: 0x0}, + 277: {region: 0x164, script: 0x52, flags: 0x0}, + 278: {region: 0xd3, script: 0x52, flags: 0x0}, + 279: {region: 0x4e, script: 0x52, flags: 0x0}, + 280: {region: 0x164, script: 0x52, flags: 0x0}, + 281: {region: 0x98, script: 0x5, flags: 0x0}, + 282: {region: 0x164, script: 0x52, flags: 0x0}, + 283: {region: 0x164, script: 0x52, flags: 0x0}, + 284: {region: 0x164, script: 0x52, flags: 0x0}, + 285: {region: 0x164, script: 0x27, flags: 0x0}, + 286: {region: 0x5f, script: 0x52, flags: 0x0}, + 287: {region: 0xc2, script: 0x52, flags: 0x0}, + 288: {region: 0xcf, script: 0x52, flags: 0x0}, + 289: {region: 0x164, script: 0x52, flags: 0x0}, + 290: {region: 0xda, script: 0x20, flags: 0x0}, + 291: {region: 0x51, script: 0x52, flags: 0x0}, + 292: {region: 0x164, script: 0x52, flags: 0x0}, + 293: {region: 0x164, script: 0x52, flags: 0x0}, + 294: {region: 0x164, script: 0x52, flags: 0x0}, + 295: {region: 0xcc, script: 0xd4, flags: 0x0}, + 296: {region: 0x164, script: 0x52, flags: 0x0}, + 297: {region: 0x164, script: 0x52, flags: 0x0}, + 298: {region: 0x113, script: 0x52, flags: 0x0}, + 299: {region: 0x36, script: 0x52, flags: 0x0}, + 300: {region: 0x42, script: 0xd6, flags: 0x0}, + 301: {region: 0x164, script: 0x52, flags: 0x0}, + 302: {region: 0xa3, script: 0x52, flags: 0x0}, + 303: {region: 0x7f, script: 0x52, flags: 0x0}, + 304: {region: 0xd5, script: 0x52, flags: 0x0}, + 305: {region: 0x9d, script: 0x52, flags: 0x0}, + 306: {region: 0x6a, script: 0x25, flags: 0x0}, + 307: {region: 0x164, script: 0x52, flags: 0x0}, + 308: {region: 0xc3, script: 0x43, flags: 0x0}, + 309: {region: 0x86, script: 0x2d, flags: 0x0}, + 310: {region: 0x164, script: 0x52, flags: 0x0}, + 311: {region: 0x164, script: 0x52, flags: 0x0}, + 312: {region: 0xa, script: 0x2, flags: 0x1}, + 313: {region: 0x164, script: 0x52, flags: 0x0}, + 314: {region: 0x164, script: 0x52, flags: 0x0}, + 315: {region: 0x1, script: 0x52, flags: 0x0}, + 316: {region: 0x164, script: 0x52, flags: 0x0}, + 317: {region: 0x6d, script: 0x52, flags: 0x0}, + 318: {region: 0x134, script: 0x52, flags: 0x0}, + 319: {region: 0x69, script: 0x52, flags: 0x0}, + 320: {region: 0x164, script: 0x52, flags: 0x0}, + 321: {region: 0x9d, script: 0x3e, flags: 0x0}, + 322: {region: 0x164, script: 0x52, flags: 0x0}, + 323: {region: 0x164, script: 0x52, flags: 0x0}, + 324: {region: 0x6d, script: 0x52, flags: 0x0}, + 325: {region: 0x51, script: 0x52, flags: 0x0}, + 326: {region: 0x6d, script: 0x52, flags: 0x0}, + 327: {region: 0x9b, script: 0x5, flags: 0x0}, + 328: {region: 0x164, script: 0x52, flags: 0x0}, + 329: {region: 0x164, script: 0x52, flags: 0x0}, + 330: {region: 0x164, script: 0x52, flags: 0x0}, + 331: {region: 0x164, script: 0x52, flags: 0x0}, + 332: {region: 0x85, script: 0x52, flags: 0x0}, + 333: {region: 0xc, script: 0x2, flags: 0x1}, + 334: {region: 0x164, script: 0x52, flags: 0x0}, + 335: {region: 0xc2, script: 0x52, flags: 0x0}, + 336: {region: 0x71, script: 0x52, flags: 0x0}, + 337: {region: 0x10a, script: 0x5, flags: 0x0}, + 338: {region: 0xe6, script: 0x52, flags: 0x0}, + 339: {region: 0x10b, script: 0x52, flags: 0x0}, + 340: {region: 0x72, script: 0x52, flags: 0x0}, + 341: {region: 0x164, script: 0x52, flags: 0x0}, + 342: {region: 0x164, script: 0x52, flags: 0x0}, + 343: {region: 0x75, script: 0x52, flags: 0x0}, + 344: {region: 0x164, script: 0x52, flags: 0x0}, + 345: {region: 0x3a, script: 0x52, flags: 0x0}, + 346: {region: 0x164, script: 0x52, flags: 0x0}, + 347: {region: 0x164, script: 0x52, flags: 0x0}, + 348: {region: 0x164, script: 0x52, flags: 0x0}, + 349: {region: 0x77, script: 0x52, flags: 0x0}, + 350: {region: 0x134, script: 0x52, flags: 0x0}, + 351: {region: 0x77, script: 0x52, flags: 0x0}, + 352: {region: 0x5f, script: 0x52, flags: 0x0}, + 353: {region: 0x5f, script: 0x52, flags: 0x0}, + 354: {region: 0x51, script: 0x5, flags: 0x0}, + 355: {region: 0x13f, script: 0x52, flags: 0x0}, + 356: {region: 0x164, script: 0x52, flags: 0x0}, + 357: {region: 0x83, script: 0x52, flags: 0x0}, + 358: {region: 0x164, script: 0x52, flags: 0x0}, + 359: {region: 0xd3, script: 0x52, flags: 0x0}, + 360: {region: 0x9d, script: 0x52, flags: 0x0}, + 361: {region: 0xd5, script: 0x52, flags: 0x0}, + 362: {region: 0x164, script: 0x52, flags: 0x0}, + 363: {region: 0x10a, script: 0x52, flags: 0x0}, + 364: {region: 0xd8, script: 0x52, flags: 0x0}, + 365: {region: 0x95, script: 0x52, flags: 0x0}, + 366: {region: 0x7f, script: 0x52, flags: 0x0}, + 367: {region: 0x164, script: 0x52, flags: 0x0}, + 368: {region: 0xbb, script: 0x52, flags: 0x0}, + 369: {region: 0x164, script: 0x52, flags: 0x0}, + 370: {region: 0x164, script: 0x52, flags: 0x0}, + 371: {region: 0x164, script: 0x52, flags: 0x0}, + 372: {region: 0x52, script: 0x34, flags: 0x0}, + 373: {region: 0x164, script: 0x52, flags: 0x0}, + 374: {region: 0x94, script: 0x52, flags: 0x0}, + 375: {region: 0x164, script: 0x52, flags: 0x0}, + 376: {region: 0x98, script: 0x20, flags: 0x0}, + 377: {region: 0x164, script: 0x52, flags: 0x0}, + 378: {region: 0x9b, script: 0x5, flags: 0x0}, + 379: {region: 0x7d, script: 0x52, flags: 0x0}, + 380: {region: 0x7a, script: 0x52, flags: 0x0}, + 381: {region: 0x164, script: 0x52, flags: 0x0}, + 382: {region: 0x164, script: 0x52, flags: 0x0}, + 383: {region: 0x164, script: 0x52, flags: 0x0}, + 384: {region: 0x164, script: 0x52, flags: 0x0}, + 385: {region: 0x164, script: 0x52, flags: 0x0}, + 386: {region: 0x164, script: 0x52, flags: 0x0}, + 387: {region: 0x6e, script: 0x27, flags: 0x0}, + 388: {region: 0x164, script: 0x52, flags: 0x0}, + 389: {region: 0xda, script: 0x20, flags: 0x0}, + 390: {region: 0x164, script: 0x52, flags: 0x0}, + 391: {region: 0xa6, script: 0x52, flags: 0x0}, + 392: {region: 0x164, script: 0x52, flags: 0x0}, + 393: {region: 0xe7, script: 0x5, flags: 0x0}, + 394: {region: 0x164, script: 0x52, flags: 0x0}, + 395: {region: 0xe7, script: 0x5, flags: 0x0}, + 396: {region: 0x164, script: 0x52, flags: 0x0}, + 397: {region: 0x164, script: 0x52, flags: 0x0}, + 398: {region: 0x6d, script: 0x52, flags: 0x0}, + 399: {region: 0x9b, script: 0x5, flags: 0x0}, + 400: {region: 0x164, script: 0x52, flags: 0x0}, + 401: {region: 0x164, script: 0x27, flags: 0x0}, + 402: {region: 0xf0, script: 0x52, flags: 0x0}, + 403: {region: 0x164, script: 0x52, flags: 0x0}, + 404: {region: 0x164, script: 0x52, flags: 0x0}, + 405: {region: 0x164, script: 0x52, flags: 0x0}, + 406: {region: 0x164, script: 0x27, flags: 0x0}, + 407: {region: 0x164, script: 0x52, flags: 0x0}, + 408: {region: 0x98, script: 0x20, flags: 0x0}, + 409: {region: 0x98, script: 0xd0, flags: 0x0}, + 410: {region: 0x94, script: 0x52, flags: 0x0}, + 411: {region: 0xd8, script: 0x52, flags: 0x0}, + 412: {region: 0x12f, script: 0x2b, flags: 0x0}, + 413: {region: 0x164, script: 0x52, flags: 0x0}, + 414: {region: 0xe, script: 0x2, flags: 0x1}, + 415: {region: 0x98, script: 0xe, flags: 0x0}, + 416: {region: 0x164, script: 0x52, flags: 0x0}, + 417: {region: 0x4d, script: 0x52, flags: 0x0}, + 418: {region: 0x98, script: 0x2e, flags: 0x0}, + 419: {region: 0x40, script: 0x52, flags: 0x0}, + 420: {region: 0x53, script: 0x52, flags: 0x0}, + 421: {region: 0x164, script: 0x52, flags: 0x0}, + 422: {region: 0x7f, script: 0x52, flags: 0x0}, + 423: {region: 0x164, script: 0x52, flags: 0x0}, + 424: {region: 0x164, script: 0x52, flags: 0x0}, + 425: {region: 0xa3, script: 0x52, flags: 0x0}, + 426: {region: 0x97, script: 0x52, flags: 0x0}, + 427: {region: 0x164, script: 0x52, flags: 0x0}, + 428: {region: 0xda, script: 0x20, flags: 0x0}, + 429: {region: 0x164, script: 0x52, flags: 0x0}, + 430: {region: 0x164, script: 0x5, flags: 0x0}, + 431: {region: 0x48, script: 0x52, flags: 0x0}, + 432: {region: 0x164, script: 0x5, flags: 0x0}, + 433: {region: 0x164, script: 0x52, flags: 0x0}, + 434: {region: 0x10, script: 0x3, flags: 0x1}, + 435: {region: 0x164, script: 0x52, flags: 0x0}, + 436: {region: 0x52, script: 0x34, flags: 0x0}, + 437: {region: 0x164, script: 0x52, flags: 0x0}, + 438: {region: 0x134, script: 0x52, flags: 0x0}, + 439: {region: 0x23, script: 0x5, flags: 0x0}, + 440: {region: 0x164, script: 0x52, flags: 0x0}, + 441: {region: 0x164, script: 0x27, flags: 0x0}, + 442: {region: 0x96, script: 0x37, flags: 0x0}, + 443: {region: 0x164, script: 0x52, flags: 0x0}, + 444: {region: 0x98, script: 0x20, flags: 0x0}, + 445: {region: 0x164, script: 0x52, flags: 0x0}, + 446: {region: 0x72, script: 0x52, flags: 0x0}, + 447: {region: 0x164, script: 0x52, flags: 0x0}, + 448: {region: 0x164, script: 0x52, flags: 0x0}, + 449: {region: 0xe6, script: 0x52, flags: 0x0}, + 450: {region: 0x164, script: 0x52, flags: 0x0}, + 451: {region: 0x12a, script: 0x39, flags: 0x0}, + 452: {region: 0x52, script: 0x81, flags: 0x0}, + 453: {region: 0x164, script: 0x52, flags: 0x0}, + 454: {region: 0xe7, script: 0x5, flags: 0x0}, + 455: {region: 0x98, script: 0x20, flags: 0x0}, + 456: {region: 0xae, script: 0x3a, flags: 0x0}, + 457: {region: 0xe6, script: 0x52, flags: 0x0}, + 458: {region: 0xe7, script: 0x5, flags: 0x0}, + 459: {region: 0xe5, script: 0x52, flags: 0x0}, + 460: {region: 0x98, script: 0x20, flags: 0x0}, + 461: {region: 0x98, script: 0x20, flags: 0x0}, + 462: {region: 0x164, script: 0x52, flags: 0x0}, + 463: {region: 0x8f, script: 0x52, flags: 0x0}, + 464: {region: 0x5f, script: 0x52, flags: 0x0}, + 465: {region: 0x52, script: 0x34, flags: 0x0}, + 466: {region: 0x90, script: 0x52, flags: 0x0}, + 467: {region: 0x91, script: 0x52, flags: 0x0}, + 468: {region: 0x164, script: 0x52, flags: 0x0}, + 469: {region: 0x27, script: 0x8, flags: 0x0}, + 470: {region: 0xd1, script: 0x52, flags: 0x0}, + 471: {region: 0x77, script: 0x52, flags: 0x0}, + 472: {region: 0x164, script: 0x52, flags: 0x0}, + 473: {region: 0x164, script: 0x52, flags: 0x0}, + 474: {region: 0xcf, script: 0x52, flags: 0x0}, + 475: {region: 0xd5, script: 0x52, flags: 0x0}, + 476: {region: 0x164, script: 0x52, flags: 0x0}, + 477: {region: 0x164, script: 0x52, flags: 0x0}, + 478: {region: 0x164, script: 0x52, flags: 0x0}, + 479: {region: 0x94, script: 0x52, flags: 0x0}, + 480: {region: 0x164, script: 0x52, flags: 0x0}, + 481: {region: 0x164, script: 0x52, flags: 0x0}, + 482: {region: 0x164, script: 0x52, flags: 0x0}, + 484: {region: 0x121, script: 0x52, flags: 0x0}, + 485: {region: 0xd5, script: 0x52, flags: 0x0}, + 486: {region: 0x164, script: 0x52, flags: 0x0}, + 487: {region: 0x164, script: 0x52, flags: 0x0}, + 488: {region: 0x52, script: 0xdf, flags: 0x0}, + 489: {region: 0x164, script: 0x52, flags: 0x0}, + 490: {region: 0x134, script: 0x52, flags: 0x0}, + 491: {region: 0x164, script: 0x52, flags: 0x0}, + 492: {region: 0x48, script: 0x52, flags: 0x0}, + 493: {region: 0x164, script: 0x52, flags: 0x0}, + 494: {region: 0x164, script: 0x52, flags: 0x0}, + 495: {region: 0xe6, script: 0x52, flags: 0x0}, + 496: {region: 0x164, script: 0x52, flags: 0x0}, + 497: {region: 0x94, script: 0x52, flags: 0x0}, + 498: {region: 0x105, script: 0x1e, flags: 0x0}, + 500: {region: 0x164, script: 0x52, flags: 0x0}, + 501: {region: 0x164, script: 0x52, flags: 0x0}, + 502: {region: 0x9c, script: 0x52, flags: 0x0}, + 503: {region: 0x9d, script: 0x52, flags: 0x0}, + 504: {region: 0x48, script: 0x17, flags: 0x0}, + 505: {region: 0x96, script: 0x37, flags: 0x0}, + 506: {region: 0x164, script: 0x52, flags: 0x0}, + 507: {region: 0x164, script: 0x52, flags: 0x0}, + 508: {region: 0x105, script: 0x52, flags: 0x0}, + 509: {region: 0x164, script: 0x52, flags: 0x0}, + 510: {region: 0xa1, script: 0x41, flags: 0x0}, + 511: {region: 0x164, script: 0x52, flags: 0x0}, + 512: {region: 0x9f, script: 0x52, flags: 0x0}, + 514: {region: 0x164, script: 0x52, flags: 0x0}, + 515: {region: 0x164, script: 0x52, flags: 0x0}, + 516: {region: 0x164, script: 0x52, flags: 0x0}, + 517: {region: 0x51, script: 0x52, flags: 0x0}, + 518: {region: 0x12f, script: 0x37, flags: 0x0}, + 519: {region: 0x164, script: 0x52, flags: 0x0}, + 520: {region: 0x12e, script: 0x52, flags: 0x0}, + 521: {region: 0xda, script: 0x20, flags: 0x0}, + 522: {region: 0x164, script: 0x52, flags: 0x0}, + 523: {region: 0x62, script: 0x52, flags: 0x0}, + 524: {region: 0x94, script: 0x52, flags: 0x0}, + 525: {region: 0x94, script: 0x52, flags: 0x0}, + 526: {region: 0x7c, script: 0x29, flags: 0x0}, + 527: {region: 0x136, script: 0x1e, flags: 0x0}, + 528: {region: 0x66, script: 0x52, flags: 0x0}, + 529: {region: 0xc3, script: 0x52, flags: 0x0}, + 530: {region: 0x164, script: 0x52, flags: 0x0}, + 531: {region: 0x164, script: 0x52, flags: 0x0}, + 532: {region: 0xd5, script: 0x52, flags: 0x0}, + 533: {region: 0xa3, script: 0x52, flags: 0x0}, + 534: {region: 0xc2, script: 0x52, flags: 0x0}, + 535: {region: 0x105, script: 0x1e, flags: 0x0}, + 536: {region: 0x164, script: 0x52, flags: 0x0}, + 537: {region: 0x164, script: 0x52, flags: 0x0}, + 538: {region: 0x164, script: 0x52, flags: 0x0}, + 539: {region: 0x164, script: 0x52, flags: 0x0}, + 540: {region: 0xd3, script: 0x5, flags: 0x0}, + 541: {region: 0xd5, script: 0x52, flags: 0x0}, + 542: {region: 0x163, script: 0x52, flags: 0x0}, + 543: {region: 0x164, script: 0x52, flags: 0x0}, + 544: {region: 0x164, script: 0x52, flags: 0x0}, + 545: {region: 0x12e, script: 0x52, flags: 0x0}, + 546: {region: 0x121, script: 0x5, flags: 0x0}, + 547: {region: 0x164, script: 0x52, flags: 0x0}, + 548: {region: 0x122, script: 0xd5, flags: 0x0}, + 549: {region: 0x59, script: 0x52, flags: 0x0}, + 550: {region: 0x51, script: 0x52, flags: 0x0}, + 551: {region: 0x164, script: 0x52, flags: 0x0}, + 552: {region: 0x4e, script: 0x52, flags: 0x0}, + 553: {region: 0x98, script: 0x20, flags: 0x0}, + 554: {region: 0x98, script: 0x20, flags: 0x0}, + 555: {region: 0x4a, script: 0x52, flags: 0x0}, + 556: {region: 0x94, script: 0x52, flags: 0x0}, + 557: {region: 0x164, script: 0x52, flags: 0x0}, + 558: {region: 0x40, script: 0x52, flags: 0x0}, + 559: {region: 0x98, script: 0x52, flags: 0x0}, + 560: {region: 0x52, script: 0xcc, flags: 0x0}, + 561: {region: 0x98, script: 0x20, flags: 0x0}, + 562: {region: 0xc2, script: 0x52, flags: 0x0}, + 563: {region: 0x164, script: 0x52, flags: 0x0}, + 564: {region: 0x98, script: 0x6b, flags: 0x0}, + 565: {region: 0xe7, script: 0x5, flags: 0x0}, + 566: {region: 0x164, script: 0x52, flags: 0x0}, + 567: {region: 0xa3, script: 0x52, flags: 0x0}, + 568: {region: 0x164, script: 0x52, flags: 0x0}, + 569: {region: 0x12a, script: 0x52, flags: 0x0}, + 570: {region: 0x164, script: 0x52, flags: 0x0}, + 571: {region: 0xd1, script: 0x52, flags: 0x0}, + 572: {region: 0x164, script: 0x52, flags: 0x0}, + 573: {region: 0xae, script: 0x4f, flags: 0x0}, + 574: {region: 0x164, script: 0x52, flags: 0x0}, + 575: {region: 0x164, script: 0x52, flags: 0x0}, + 576: {region: 0x13, script: 0x6, flags: 0x1}, + 577: {region: 0x164, script: 0x52, flags: 0x0}, + 578: {region: 0x51, script: 0x52, flags: 0x0}, + 579: {region: 0x81, script: 0x52, flags: 0x0}, + 580: {region: 0xa3, script: 0x52, flags: 0x0}, + 581: {region: 0x164, script: 0x52, flags: 0x0}, + 582: {region: 0x164, script: 0x52, flags: 0x0}, + 583: {region: 0x164, script: 0x52, flags: 0x0}, + 584: {region: 0xa5, script: 0x46, flags: 0x0}, + 585: {region: 0x29, script: 0x52, flags: 0x0}, + 586: {region: 0x164, script: 0x52, flags: 0x0}, + 587: {region: 0x164, script: 0x52, flags: 0x0}, + 588: {region: 0x164, script: 0x52, flags: 0x0}, + 589: {region: 0x164, script: 0x52, flags: 0x0}, + 590: {region: 0x164, script: 0x52, flags: 0x0}, + 591: {region: 0x98, script: 0x4a, flags: 0x0}, + 592: {region: 0x113, script: 0x52, flags: 0x0}, + 593: {region: 0x164, script: 0x52, flags: 0x0}, + 594: {region: 0xaa, script: 0x4b, flags: 0x0}, + 595: {region: 0x105, script: 0x1e, flags: 0x0}, + 596: {region: 0x98, script: 0x20, flags: 0x0}, + 597: {region: 0x164, script: 0x52, flags: 0x0}, + 598: {region: 0x74, script: 0x52, flags: 0x0}, + 599: {region: 0x164, script: 0x52, flags: 0x0}, + 600: {region: 0xb3, script: 0x52, flags: 0x0}, + 601: {region: 0x164, script: 0x52, flags: 0x0}, + 602: {region: 0x164, script: 0x52, flags: 0x0}, + 603: {region: 0x164, script: 0x52, flags: 0x0}, + 604: {region: 0x164, script: 0x52, flags: 0x0}, + 605: {region: 0x164, script: 0x52, flags: 0x0}, + 606: {region: 0x164, script: 0x52, flags: 0x0}, + 607: {region: 0x164, script: 0x52, flags: 0x0}, + 608: {region: 0x164, script: 0x27, flags: 0x0}, + 610: {region: 0x105, script: 0x1e, flags: 0x0}, + 611: {region: 0x111, script: 0x52, flags: 0x0}, + 612: {region: 0xe6, script: 0x52, flags: 0x0}, + 613: {region: 0x105, script: 0x52, flags: 0x0}, + 614: {region: 0x164, script: 0x52, flags: 0x0}, + 615: {region: 0x98, script: 0x20, flags: 0x0}, + 616: {region: 0x98, script: 0x5, flags: 0x0}, + 617: {region: 0x12e, script: 0x52, flags: 0x0}, + 618: {region: 0x164, script: 0x52, flags: 0x0}, + 619: {region: 0x51, script: 0x52, flags: 0x0}, + 620: {region: 0x5f, script: 0x52, flags: 0x0}, + 621: {region: 0x164, script: 0x52, flags: 0x0}, + 622: {region: 0x164, script: 0x52, flags: 0x0}, + 623: {region: 0x164, script: 0x27, flags: 0x0}, + 624: {region: 0x164, script: 0x52, flags: 0x0}, + 625: {region: 0x164, script: 0x52, flags: 0x0}, + 626: {region: 0x19, script: 0x3, flags: 0x1}, + 627: {region: 0x164, script: 0x52, flags: 0x0}, + 628: {region: 0x164, script: 0x52, flags: 0x0}, + 629: {region: 0x164, script: 0x52, flags: 0x0}, + 630: {region: 0x164, script: 0x52, flags: 0x0}, + 631: {region: 0x105, script: 0x1e, flags: 0x0}, + 632: {region: 0x164, script: 0x52, flags: 0x0}, + 633: {region: 0x164, script: 0x52, flags: 0x0}, + 634: {region: 0x164, script: 0x52, flags: 0x0}, + 635: {region: 0x105, script: 0x1e, flags: 0x0}, + 636: {region: 0x164, script: 0x52, flags: 0x0}, + 637: {region: 0x94, script: 0x52, flags: 0x0}, + 638: {region: 0xe7, script: 0x5, flags: 0x0}, + 639: {region: 0x7a, script: 0x52, flags: 0x0}, + 640: {region: 0x164, script: 0x52, flags: 0x0}, + 641: {region: 0x164, script: 0x52, flags: 0x0}, + 642: {region: 0x164, script: 0x52, flags: 0x0}, + 643: {region: 0x164, script: 0x27, flags: 0x0}, + 644: {region: 0x122, script: 0xd5, flags: 0x0}, + 645: {region: 0xe7, script: 0x5, flags: 0x0}, + 646: {region: 0x164, script: 0x52, flags: 0x0}, + 647: {region: 0x164, script: 0x52, flags: 0x0}, + 648: {region: 0x1c, script: 0x5, flags: 0x1}, + 649: {region: 0x164, script: 0x52, flags: 0x0}, + 650: {region: 0x164, script: 0x52, flags: 0x0}, + 651: {region: 0x164, script: 0x52, flags: 0x0}, + 652: {region: 0x137, script: 0x52, flags: 0x0}, + 653: {region: 0x86, script: 0x56, flags: 0x0}, + 654: {region: 0x96, script: 0x37, flags: 0x0}, + 655: {region: 0x12e, script: 0x52, flags: 0x0}, + 656: {region: 0xe7, script: 0x5, flags: 0x0}, + 657: {region: 0x130, script: 0x52, flags: 0x0}, + 658: {region: 0x164, script: 0x52, flags: 0x0}, + 659: {region: 0xb6, script: 0x52, flags: 0x0}, + 660: {region: 0x105, script: 0x1e, flags: 0x0}, + 661: {region: 0x164, script: 0x52, flags: 0x0}, + 662: {region: 0x94, script: 0x52, flags: 0x0}, + 663: {region: 0x164, script: 0x52, flags: 0x0}, + 664: {region: 0x52, script: 0xd5, flags: 0x0}, + 665: {region: 0x164, script: 0x52, flags: 0x0}, + 666: {region: 0x164, script: 0x52, flags: 0x0}, + 667: {region: 0x164, script: 0x52, flags: 0x0}, + 668: {region: 0x164, script: 0x52, flags: 0x0}, + 669: {region: 0x98, script: 0x54, flags: 0x0}, + 670: {region: 0x164, script: 0x52, flags: 0x0}, + 671: {region: 0x164, script: 0x52, flags: 0x0}, + 672: {region: 0x105, script: 0x1e, flags: 0x0}, + 673: {region: 0x130, script: 0x52, flags: 0x0}, + 674: {region: 0x164, script: 0x52, flags: 0x0}, + 675: {region: 0xd8, script: 0x52, flags: 0x0}, + 676: {region: 0x164, script: 0x52, flags: 0x0}, + 677: {region: 0x164, script: 0x52, flags: 0x0}, + 678: {region: 0x21, script: 0x2, flags: 0x1}, + 679: {region: 0x164, script: 0x52, flags: 0x0}, + 680: {region: 0x164, script: 0x52, flags: 0x0}, + 681: {region: 0x9d, script: 0x52, flags: 0x0}, + 682: {region: 0x52, script: 0x58, flags: 0x0}, + 683: {region: 0x94, script: 0x52, flags: 0x0}, + 684: {region: 0x9b, script: 0x5, flags: 0x0}, + 685: {region: 0x134, script: 0x52, flags: 0x0}, + 686: {region: 0x164, script: 0x52, flags: 0x0}, + 687: {region: 0x164, script: 0x52, flags: 0x0}, + 688: {region: 0x98, script: 0xd0, flags: 0x0}, + 689: {region: 0x9d, script: 0x52, flags: 0x0}, + 690: {region: 0x164, script: 0x52, flags: 0x0}, + 691: {region: 0x4a, script: 0x52, flags: 0x0}, + 692: {region: 0x164, script: 0x52, flags: 0x0}, + 693: {region: 0x164, script: 0x52, flags: 0x0}, + 694: {region: 0xae, script: 0x4f, flags: 0x0}, + 695: {region: 0x164, script: 0x52, flags: 0x0}, + 696: {region: 0x164, script: 0x52, flags: 0x0}, + 697: {region: 0x4a, script: 0x52, flags: 0x0}, + 698: {region: 0x164, script: 0x52, flags: 0x0}, + 699: {region: 0x164, script: 0x52, flags: 0x0}, + 700: {region: 0x161, script: 0x52, flags: 0x0}, + 701: {region: 0x9b, script: 0x5, flags: 0x0}, + 702: {region: 0xb5, script: 0x52, flags: 0x0}, + 703: {region: 0xb7, script: 0x52, flags: 0x0}, + 704: {region: 0x4a, script: 0x52, flags: 0x0}, + 705: {region: 0x4a, script: 0x52, flags: 0x0}, + 706: {region: 0xa3, script: 0x52, flags: 0x0}, + 707: {region: 0xa3, script: 0x52, flags: 0x0}, + 708: {region: 0x9b, script: 0x5, flags: 0x0}, + 709: {region: 0xb7, script: 0x52, flags: 0x0}, + 710: {region: 0x122, script: 0xd5, flags: 0x0}, + 711: {region: 0x52, script: 0x34, flags: 0x0}, + 712: {region: 0x12a, script: 0x52, flags: 0x0}, + 713: {region: 0x94, script: 0x52, flags: 0x0}, + 714: {region: 0x51, script: 0x52, flags: 0x0}, + 715: {region: 0x98, script: 0x20, flags: 0x0}, + 716: {region: 0x98, script: 0x20, flags: 0x0}, + 717: {region: 0x94, script: 0x52, flags: 0x0}, + 718: {region: 0x23, script: 0x3, flags: 0x1}, + 719: {region: 0xa3, script: 0x52, flags: 0x0}, + 720: {region: 0x164, script: 0x52, flags: 0x0}, + 721: {region: 0xce, script: 0x52, flags: 0x0}, + 722: {region: 0x164, script: 0x52, flags: 0x0}, + 723: {region: 0x164, script: 0x52, flags: 0x0}, + 724: {region: 0x164, script: 0x52, flags: 0x0}, + 725: {region: 0x164, script: 0x52, flags: 0x0}, + 726: {region: 0x164, script: 0x52, flags: 0x0}, + 727: {region: 0x164, script: 0x52, flags: 0x0}, + 728: {region: 0x164, script: 0x52, flags: 0x0}, + 729: {region: 0x164, script: 0x52, flags: 0x0}, + 730: {region: 0x164, script: 0x52, flags: 0x0}, + 731: {region: 0x164, script: 0x52, flags: 0x0}, + 732: {region: 0x164, script: 0x52, flags: 0x0}, + 733: {region: 0x164, script: 0x5, flags: 0x0}, + 734: {region: 0x105, script: 0x1e, flags: 0x0}, + 735: {region: 0xe6, script: 0x52, flags: 0x0}, + 736: {region: 0x164, script: 0x52, flags: 0x0}, + 737: {region: 0x94, script: 0x52, flags: 0x0}, + 738: {region: 0x164, script: 0x27, flags: 0x0}, + 739: {region: 0x164, script: 0x52, flags: 0x0}, + 740: {region: 0x164, script: 0x52, flags: 0x0}, + 741: {region: 0x164, script: 0x52, flags: 0x0}, + 742: {region: 0x111, script: 0x52, flags: 0x0}, + 743: {region: 0xa3, script: 0x52, flags: 0x0}, + 744: {region: 0x164, script: 0x52, flags: 0x0}, + 745: {region: 0x164, script: 0x52, flags: 0x0}, + 746: {region: 0x122, script: 0x5, flags: 0x0}, + 747: {region: 0xcb, script: 0x52, flags: 0x0}, + 748: {region: 0x164, script: 0x52, flags: 0x0}, + 749: {region: 0x164, script: 0x52, flags: 0x0}, + 750: {region: 0x164, script: 0x52, flags: 0x0}, + 751: {region: 0xbe, script: 0x52, flags: 0x0}, + 752: {region: 0xd0, script: 0x52, flags: 0x0}, + 753: {region: 0x164, script: 0x52, flags: 0x0}, + 754: {region: 0x51, script: 0x52, flags: 0x0}, + 755: {region: 0xda, script: 0x20, flags: 0x0}, + 756: {region: 0x12e, script: 0x52, flags: 0x0}, + 757: {region: 0xbf, script: 0x52, flags: 0x0}, + 758: {region: 0x164, script: 0x52, flags: 0x0}, + 759: {region: 0x164, script: 0x52, flags: 0x0}, + 760: {region: 0xdf, script: 0x52, flags: 0x0}, + 761: {region: 0x164, script: 0x52, flags: 0x0}, + 762: {region: 0x94, script: 0x52, flags: 0x0}, + 763: {region: 0x9a, script: 0x36, flags: 0x0}, + 764: {region: 0x164, script: 0x52, flags: 0x0}, + 765: {region: 0xc1, script: 0x1e, flags: 0x0}, + 766: {region: 0x164, script: 0x5, flags: 0x0}, + 767: {region: 0x164, script: 0x52, flags: 0x0}, + 768: {region: 0x164, script: 0x52, flags: 0x0}, + 769: {region: 0x164, script: 0x52, flags: 0x0}, + 770: {region: 0x98, script: 0x64, flags: 0x0}, + 771: {region: 0x164, script: 0x52, flags: 0x0}, + 772: {region: 0x164, script: 0x52, flags: 0x0}, + 773: {region: 0x10a, script: 0x52, flags: 0x0}, + 774: {region: 0x164, script: 0x52, flags: 0x0}, + 775: {region: 0x164, script: 0x52, flags: 0x0}, + 776: {region: 0x164, script: 0x52, flags: 0x0}, + 777: {region: 0x26, script: 0x3, flags: 0x1}, + 778: {region: 0x164, script: 0x52, flags: 0x0}, + 779: {region: 0x164, script: 0x52, flags: 0x0}, + 780: {region: 0x98, script: 0xe, flags: 0x0}, + 781: {region: 0xc3, script: 0x6b, flags: 0x0}, + 783: {region: 0x164, script: 0x52, flags: 0x0}, + 784: {region: 0x48, script: 0x52, flags: 0x0}, + 785: {region: 0x48, script: 0x52, flags: 0x0}, + 786: {region: 0x36, script: 0x52, flags: 0x0}, + 787: {region: 0x164, script: 0x52, flags: 0x0}, + 788: {region: 0x164, script: 0x52, flags: 0x0}, + 789: {region: 0x164, script: 0x52, flags: 0x0}, + 790: {region: 0x164, script: 0x52, flags: 0x0}, + 791: {region: 0x164, script: 0x52, flags: 0x0}, + 792: {region: 0x164, script: 0x52, flags: 0x0}, + 793: {region: 0x98, script: 0x20, flags: 0x0}, + 794: {region: 0xda, script: 0x20, flags: 0x0}, + 795: {region: 0x105, script: 0x1e, flags: 0x0}, + 796: {region: 0x34, script: 0x68, flags: 0x0}, + 797: {region: 0x29, script: 0x3, flags: 0x1}, + 798: {region: 0xca, script: 0x52, flags: 0x0}, + 799: {region: 0x164, script: 0x52, flags: 0x0}, + 800: {region: 0x164, script: 0x52, flags: 0x0}, + 801: {region: 0x164, script: 0x52, flags: 0x0}, + 802: {region: 0x98, script: 0x20, flags: 0x0}, + 803: {region: 0x51, script: 0x52, flags: 0x0}, + 805: {region: 0x164, script: 0x52, flags: 0x0}, + 806: {region: 0x134, script: 0x52, flags: 0x0}, + 807: {region: 0x164, script: 0x52, flags: 0x0}, + 808: {region: 0x164, script: 0x52, flags: 0x0}, + 809: {region: 0xe7, script: 0x5, flags: 0x0}, + 810: {region: 0xc2, script: 0x52, flags: 0x0}, + 811: {region: 0x98, script: 0x20, flags: 0x0}, + 812: {region: 0x94, script: 0x52, flags: 0x0}, + 813: {region: 0x163, script: 0x52, flags: 0x0}, + 814: {region: 0x164, script: 0x52, flags: 0x0}, + 815: {region: 0xc3, script: 0x6b, flags: 0x0}, + 816: {region: 0x164, script: 0x52, flags: 0x0}, + 817: {region: 0x164, script: 0x27, flags: 0x0}, + 818: {region: 0x105, script: 0x1e, flags: 0x0}, + 819: {region: 0x164, script: 0x52, flags: 0x0}, + 820: {region: 0x130, script: 0x52, flags: 0x0}, + 821: {region: 0x9b, script: 0x5d, flags: 0x0}, + 822: {region: 0x164, script: 0x52, flags: 0x0}, + 823: {region: 0x164, script: 0x52, flags: 0x0}, + 824: {region: 0x9b, script: 0x5, flags: 0x0}, + 825: {region: 0x164, script: 0x52, flags: 0x0}, + 826: {region: 0x164, script: 0x52, flags: 0x0}, + 827: {region: 0x164, script: 0x52, flags: 0x0}, + 828: {region: 0xdc, script: 0x52, flags: 0x0}, + 829: {region: 0x164, script: 0x52, flags: 0x0}, + 830: {region: 0x164, script: 0x52, flags: 0x0}, + 832: {region: 0x164, script: 0x52, flags: 0x0}, + 833: {region: 0x52, script: 0x34, flags: 0x0}, + 834: {region: 0x9d, script: 0x52, flags: 0x0}, + 835: {region: 0xd1, script: 0x52, flags: 0x0}, + 836: {region: 0x164, script: 0x52, flags: 0x0}, + 837: {region: 0xd9, script: 0x52, flags: 0x0}, + 838: {region: 0x164, script: 0x52, flags: 0x0}, + 839: {region: 0x164, script: 0x52, flags: 0x0}, + 840: {region: 0x164, script: 0x52, flags: 0x0}, + 841: {region: 0xce, script: 0x52, flags: 0x0}, + 842: {region: 0x164, script: 0x52, flags: 0x0}, + 843: {region: 0x164, script: 0x52, flags: 0x0}, + 844: {region: 0x163, script: 0x52, flags: 0x0}, + 845: {region: 0xd0, script: 0x52, flags: 0x0}, + 846: {region: 0x5f, script: 0x52, flags: 0x0}, + 847: {region: 0xda, script: 0x20, flags: 0x0}, + 848: {region: 0x164, script: 0x52, flags: 0x0}, + 849: {region: 0xda, script: 0x20, flags: 0x0}, + 850: {region: 0x164, script: 0x52, flags: 0x0}, + 851: {region: 0x164, script: 0x52, flags: 0x0}, + 852: {region: 0xd1, script: 0x52, flags: 0x0}, + 853: {region: 0x164, script: 0x52, flags: 0x0}, + 854: {region: 0x164, script: 0x52, flags: 0x0}, + 855: {region: 0xd0, script: 0x52, flags: 0x0}, + 856: {region: 0x164, script: 0x52, flags: 0x0}, + 857: {region: 0xce, script: 0x52, flags: 0x0}, + 858: {region: 0xce, script: 0x52, flags: 0x0}, + 859: {region: 0x164, script: 0x52, flags: 0x0}, + 860: {region: 0x164, script: 0x52, flags: 0x0}, + 861: {region: 0x94, script: 0x52, flags: 0x0}, + 862: {region: 0x164, script: 0x52, flags: 0x0}, + 863: {region: 0xde, script: 0x52, flags: 0x0}, + 864: {region: 0x164, script: 0x52, flags: 0x0}, + 865: {region: 0x164, script: 0x52, flags: 0x0}, + 866: {region: 0x98, script: 0x52, flags: 0x0}, + 867: {region: 0x164, script: 0x52, flags: 0x0}, + 868: {region: 0x164, script: 0x52, flags: 0x0}, + 869: {region: 0xd8, script: 0x52, flags: 0x0}, + 870: {region: 0x51, script: 0x52, flags: 0x0}, + 871: {region: 0x164, script: 0x52, flags: 0x0}, + 872: {region: 0xd9, script: 0x52, flags: 0x0}, + 873: {region: 0x164, script: 0x52, flags: 0x0}, + 874: {region: 0x51, script: 0x52, flags: 0x0}, + 875: {region: 0x164, script: 0x52, flags: 0x0}, + 876: {region: 0x164, script: 0x52, flags: 0x0}, + 877: {region: 0xd9, script: 0x52, flags: 0x0}, + 878: {region: 0x122, script: 0x4e, flags: 0x0}, + 879: {region: 0x98, script: 0x20, flags: 0x0}, + 880: {region: 0x10b, script: 0xb7, flags: 0x0}, + 881: {region: 0x164, script: 0x52, flags: 0x0}, + 882: {region: 0x164, script: 0x52, flags: 0x0}, + 883: {region: 0x83, script: 0x70, flags: 0x0}, + 884: {region: 0x160, script: 0x52, flags: 0x0}, + 885: {region: 0x164, script: 0x52, flags: 0x0}, + 886: {region: 0x48, script: 0x17, flags: 0x0}, + 887: {region: 0x164, script: 0x52, flags: 0x0}, + 888: {region: 0x160, script: 0x52, flags: 0x0}, + 889: {region: 0x164, script: 0x52, flags: 0x0}, + 890: {region: 0x164, script: 0x52, flags: 0x0}, + 891: {region: 0x164, script: 0x52, flags: 0x0}, + 892: {region: 0x164, script: 0x52, flags: 0x0}, + 893: {region: 0x164, script: 0x52, flags: 0x0}, + 894: {region: 0x116, script: 0x52, flags: 0x0}, + 895: {region: 0x164, script: 0x52, flags: 0x0}, + 896: {region: 0x164, script: 0x52, flags: 0x0}, + 897: {region: 0x134, script: 0x52, flags: 0x0}, + 898: {region: 0x164, script: 0x52, flags: 0x0}, + 899: {region: 0x52, script: 0x52, flags: 0x0}, + 900: {region: 0x164, script: 0x52, flags: 0x0}, + 901: {region: 0xcd, script: 0x52, flags: 0x0}, + 902: {region: 0x12e, script: 0x52, flags: 0x0}, + 903: {region: 0x130, script: 0x52, flags: 0x0}, + 904: {region: 0x7f, script: 0x52, flags: 0x0}, + 905: {region: 0x77, script: 0x52, flags: 0x0}, + 906: {region: 0x164, script: 0x52, flags: 0x0}, + 908: {region: 0x164, script: 0x52, flags: 0x0}, + 909: {region: 0x164, script: 0x52, flags: 0x0}, + 910: {region: 0x6e, script: 0x52, flags: 0x0}, + 911: {region: 0x164, script: 0x52, flags: 0x0}, + 912: {region: 0x164, script: 0x52, flags: 0x0}, + 913: {region: 0x164, script: 0x52, flags: 0x0}, + 914: {region: 0x164, script: 0x52, flags: 0x0}, + 915: {region: 0x98, script: 0x75, flags: 0x0}, + 916: {region: 0x164, script: 0x52, flags: 0x0}, + 917: {region: 0x164, script: 0x5, flags: 0x0}, + 918: {region: 0x7c, script: 0x1e, flags: 0x0}, + 919: {region: 0x134, script: 0x76, flags: 0x0}, + 920: {region: 0x164, script: 0x5, flags: 0x0}, + 921: {region: 0xc4, script: 0x74, flags: 0x0}, + 922: {region: 0x164, script: 0x52, flags: 0x0}, + 923: {region: 0x2c, script: 0x3, flags: 0x1}, + 924: {region: 0xe6, script: 0x52, flags: 0x0}, + 925: {region: 0x2f, script: 0x2, flags: 0x1}, + 926: {region: 0xe6, script: 0x52, flags: 0x0}, + 927: {region: 0x2f, script: 0x52, flags: 0x0}, + 928: {region: 0xef, script: 0x52, flags: 0x0}, + 929: {region: 0x164, script: 0x52, flags: 0x0}, + 930: {region: 0x77, script: 0x52, flags: 0x0}, + 931: {region: 0xd5, script: 0x52, flags: 0x0}, + 932: {region: 0x134, script: 0x52, flags: 0x0}, + 933: {region: 0x48, script: 0x52, flags: 0x0}, + 934: {region: 0x164, script: 0x52, flags: 0x0}, + 935: {region: 0x9b, script: 0xdd, flags: 0x0}, + 936: {region: 0x164, script: 0x52, flags: 0x0}, + 937: {region: 0x5f, script: 0x52, flags: 0x0}, + 938: {region: 0x164, script: 0x5, flags: 0x0}, + 939: {region: 0xaf, script: 0x7f, flags: 0x0}, + 941: {region: 0x164, script: 0x52, flags: 0x0}, + 942: {region: 0x164, script: 0x52, flags: 0x0}, + 943: {region: 0x98, script: 0x12, flags: 0x0}, + 944: {region: 0xa3, script: 0x52, flags: 0x0}, + 945: {region: 0xe8, script: 0x52, flags: 0x0}, + 946: {region: 0x164, script: 0x52, flags: 0x0}, + 947: {region: 0x9d, script: 0x52, flags: 0x0}, + 948: {region: 0x164, script: 0x52, flags: 0x0}, + 949: {region: 0x164, script: 0x52, flags: 0x0}, + 950: {region: 0x86, script: 0x2d, flags: 0x0}, + 951: {region: 0x74, script: 0x52, flags: 0x0}, + 952: {region: 0x164, script: 0x52, flags: 0x0}, + 953: {region: 0xe7, script: 0x45, flags: 0x0}, + 954: {region: 0x9b, script: 0x5, flags: 0x0}, + 955: {region: 0x1, script: 0x52, flags: 0x0}, + 956: {region: 0x23, script: 0x5, flags: 0x0}, + 957: {region: 0x164, script: 0x52, flags: 0x0}, + 958: {region: 0x40, script: 0x52, flags: 0x0}, + 959: {region: 0x164, script: 0x52, flags: 0x0}, + 960: {region: 0x79, script: 0x52, flags: 0x0}, + 961: {region: 0x164, script: 0x52, flags: 0x0}, + 962: {region: 0xe3, script: 0x52, flags: 0x0}, + 963: {region: 0x88, script: 0x52, flags: 0x0}, + 964: {region: 0x68, script: 0x52, flags: 0x0}, + 965: {region: 0x164, script: 0x52, flags: 0x0}, + 966: {region: 0x98, script: 0x20, flags: 0x0}, + 967: {region: 0x164, script: 0x52, flags: 0x0}, + 968: {region: 0x101, script: 0x52, flags: 0x0}, + 969: {region: 0x94, script: 0x52, flags: 0x0}, + 970: {region: 0x164, script: 0x52, flags: 0x0}, + 971: {region: 0x164, script: 0x52, flags: 0x0}, + 972: {region: 0x9d, script: 0x52, flags: 0x0}, + 973: {region: 0x164, script: 0x5, flags: 0x0}, + 974: {region: 0x98, script: 0x52, flags: 0x0}, + 975: {region: 0x31, script: 0x2, flags: 0x1}, + 976: {region: 0xda, script: 0x20, flags: 0x0}, + 977: {region: 0x34, script: 0xe, flags: 0x0}, + 978: {region: 0x4d, script: 0x52, flags: 0x0}, + 979: {region: 0x71, script: 0x52, flags: 0x0}, + 980: {region: 0x4d, script: 0x52, flags: 0x0}, + 981: {region: 0x9b, script: 0x5, flags: 0x0}, + 982: {region: 0x10b, script: 0x52, flags: 0x0}, + 983: {region: 0x39, script: 0x52, flags: 0x0}, + 984: {region: 0x164, script: 0x52, flags: 0x0}, + 985: {region: 0xd0, script: 0x52, flags: 0x0}, + 986: {region: 0x103, script: 0x52, flags: 0x0}, + 987: {region: 0x94, script: 0x52, flags: 0x0}, + 988: {region: 0x12e, script: 0x52, flags: 0x0}, + 989: {region: 0x164, script: 0x52, flags: 0x0}, + 990: {region: 0x164, script: 0x52, flags: 0x0}, + 991: {region: 0x72, script: 0x52, flags: 0x0}, + 992: {region: 0x105, script: 0x1e, flags: 0x0}, + 993: {region: 0x12f, script: 0x1e, flags: 0x0}, + 994: {region: 0x108, script: 0x52, flags: 0x0}, + 995: {region: 0x106, script: 0x52, flags: 0x0}, + 996: {region: 0x12e, script: 0x52, flags: 0x0}, + 997: {region: 0x164, script: 0x52, flags: 0x0}, + 998: {region: 0xa1, script: 0x44, flags: 0x0}, + 999: {region: 0x98, script: 0x20, flags: 0x0}, + 1000: {region: 0x7f, script: 0x52, flags: 0x0}, + 1001: {region: 0x105, script: 0x1e, flags: 0x0}, + 1002: {region: 0xa3, script: 0x52, flags: 0x0}, + 1003: {region: 0x94, script: 0x52, flags: 0x0}, + 1004: {region: 0x98, script: 0x52, flags: 0x0}, + 1005: {region: 0x113, script: 0x52, flags: 0x0}, + 1006: {region: 0x98, script: 0xbb, flags: 0x0}, + 1007: {region: 0x164, script: 0x52, flags: 0x0}, + 1008: {region: 0x164, script: 0x52, flags: 0x0}, + 1009: {region: 0x12e, script: 0x52, flags: 0x0}, + 1010: {region: 0x9d, script: 0x52, flags: 0x0}, + 1011: {region: 0x98, script: 0x20, flags: 0x0}, + 1012: {region: 0x164, script: 0x5, flags: 0x0}, + 1013: {region: 0x9d, script: 0x52, flags: 0x0}, + 1014: {region: 0x7a, script: 0x52, flags: 0x0}, + 1015: {region: 0x48, script: 0x52, flags: 0x0}, + 1016: {region: 0x33, script: 0x4, flags: 0x1}, + 1017: {region: 0x9d, script: 0x52, flags: 0x0}, + 1018: {region: 0x9b, script: 0x5, flags: 0x0}, + 1019: {region: 0xd9, script: 0x52, flags: 0x0}, + 1020: {region: 0x4e, script: 0x52, flags: 0x0}, + 1021: {region: 0xd0, script: 0x52, flags: 0x0}, + 1022: {region: 0xce, script: 0x52, flags: 0x0}, + 1023: {region: 0xc2, script: 0x52, flags: 0x0}, + 1024: {region: 0x4b, script: 0x52, flags: 0x0}, + 1025: {region: 0x95, script: 0x72, flags: 0x0}, + 1026: {region: 0xb5, script: 0x52, flags: 0x0}, + 1027: {region: 0x164, script: 0x27, flags: 0x0}, + 1028: {region: 0x164, script: 0x52, flags: 0x0}, + 1030: {region: 0xb9, script: 0xd2, flags: 0x0}, + 1031: {region: 0x164, script: 0x52, flags: 0x0}, + 1032: {region: 0xc3, script: 0x6b, flags: 0x0}, + 1033: {region: 0x164, script: 0x5, flags: 0x0}, + 1034: {region: 0xb2, script: 0xc1, flags: 0x0}, + 1035: {region: 0x6e, script: 0x52, flags: 0x0}, + 1036: {region: 0x164, script: 0x52, flags: 0x0}, + 1037: {region: 0x164, script: 0x52, flags: 0x0}, + 1038: {region: 0x164, script: 0x52, flags: 0x0}, + 1039: {region: 0x164, script: 0x52, flags: 0x0}, + 1040: {region: 0x110, script: 0x52, flags: 0x0}, + 1041: {region: 0x164, script: 0x52, flags: 0x0}, + 1042: {region: 0xe7, script: 0x5, flags: 0x0}, + 1043: {region: 0x164, script: 0x52, flags: 0x0}, + 1044: {region: 0x10e, script: 0x52, flags: 0x0}, + 1045: {region: 0x164, script: 0x52, flags: 0x0}, + 1046: {region: 0xe8, script: 0x52, flags: 0x0}, + 1047: {region: 0x164, script: 0x52, flags: 0x0}, + 1048: {region: 0x94, script: 0x52, flags: 0x0}, + 1049: {region: 0x141, script: 0x52, flags: 0x0}, + 1050: {region: 0x10b, script: 0x52, flags: 0x0}, + 1052: {region: 0x10b, script: 0x52, flags: 0x0}, + 1053: {region: 0x71, script: 0x52, flags: 0x0}, + 1054: {region: 0x96, script: 0xb8, flags: 0x0}, + 1055: {region: 0x164, script: 0x52, flags: 0x0}, + 1056: {region: 0x71, script: 0x52, flags: 0x0}, + 1057: {region: 0x163, script: 0x52, flags: 0x0}, + 1058: {region: 0x164, script: 0x52, flags: 0x0}, + 1059: {region: 0xc2, script: 0x52, flags: 0x0}, + 1060: {region: 0x164, script: 0x52, flags: 0x0}, + 1061: {region: 0x164, script: 0x52, flags: 0x0}, + 1062: {region: 0x164, script: 0x52, flags: 0x0}, + 1063: {region: 0x114, script: 0x52, flags: 0x0}, + 1064: {region: 0x164, script: 0x52, flags: 0x0}, + 1065: {region: 0x164, script: 0x52, flags: 0x0}, + 1066: {region: 0x122, script: 0xd5, flags: 0x0}, + 1067: {region: 0x164, script: 0x52, flags: 0x0}, + 1068: {region: 0x164, script: 0x52, flags: 0x0}, + 1069: {region: 0x164, script: 0x52, flags: 0x0}, + 1070: {region: 0x164, script: 0x52, flags: 0x0}, + 1071: {region: 0x26, script: 0x52, flags: 0x0}, + 1072: {region: 0x37, script: 0x5, flags: 0x1}, + 1073: {region: 0x98, script: 0xc2, flags: 0x0}, + 1074: {region: 0x115, script: 0x52, flags: 0x0}, + 1075: {region: 0x113, script: 0x52, flags: 0x0}, + 1076: {region: 0x98, script: 0x20, flags: 0x0}, + 1077: {region: 0x160, script: 0x52, flags: 0x0}, + 1078: {region: 0x164, script: 0x52, flags: 0x0}, + 1079: {region: 0x164, script: 0x52, flags: 0x0}, + 1080: {region: 0x6c, script: 0x52, flags: 0x0}, + 1081: {region: 0x160, script: 0x52, flags: 0x0}, + 1082: {region: 0x164, script: 0x52, flags: 0x0}, + 1083: {region: 0x5f, script: 0x52, flags: 0x0}, + 1084: {region: 0x94, script: 0x52, flags: 0x0}, + 1085: {region: 0x164, script: 0x52, flags: 0x0}, + 1086: {region: 0x164, script: 0x52, flags: 0x0}, + 1087: {region: 0x12e, script: 0x52, flags: 0x0}, + 1088: {region: 0x164, script: 0x52, flags: 0x0}, + 1089: {region: 0x83, script: 0x52, flags: 0x0}, + 1090: {region: 0x10b, script: 0x52, flags: 0x0}, + 1091: {region: 0x12e, script: 0x52, flags: 0x0}, + 1092: {region: 0x15e, script: 0x5, flags: 0x0}, + 1093: {region: 0x4a, script: 0x52, flags: 0x0}, + 1094: {region: 0x5f, script: 0x52, flags: 0x0}, + 1095: {region: 0x164, script: 0x52, flags: 0x0}, + 1096: {region: 0x98, script: 0x20, flags: 0x0}, + 1097: {region: 0x94, script: 0x52, flags: 0x0}, + 1098: {region: 0x164, script: 0x52, flags: 0x0}, + 1099: {region: 0x34, script: 0xe, flags: 0x0}, + 1100: {region: 0x9a, script: 0xc5, flags: 0x0}, + 1101: {region: 0xe8, script: 0x52, flags: 0x0}, + 1102: {region: 0x98, script: 0xcd, flags: 0x0}, + 1103: {region: 0xda, script: 0x20, flags: 0x0}, + 1104: {region: 0x164, script: 0x52, flags: 0x0}, + 1105: {region: 0x164, script: 0x52, flags: 0x0}, + 1106: {region: 0x164, script: 0x52, flags: 0x0}, + 1107: {region: 0x164, script: 0x52, flags: 0x0}, + 1108: {region: 0x164, script: 0x52, flags: 0x0}, + 1109: {region: 0x164, script: 0x52, flags: 0x0}, + 1110: {region: 0x164, script: 0x52, flags: 0x0}, + 1111: {region: 0x164, script: 0x52, flags: 0x0}, + 1112: {region: 0xe6, script: 0x52, flags: 0x0}, + 1113: {region: 0x164, script: 0x52, flags: 0x0}, + 1114: {region: 0x164, script: 0x52, flags: 0x0}, + 1115: {region: 0x98, script: 0x4a, flags: 0x0}, + 1116: {region: 0x52, script: 0xcb, flags: 0x0}, + 1117: {region: 0xda, script: 0x20, flags: 0x0}, + 1118: {region: 0xda, script: 0x20, flags: 0x0}, + 1119: {region: 0x98, script: 0xd0, flags: 0x0}, + 1120: {region: 0x164, script: 0x52, flags: 0x0}, + 1121: {region: 0x111, script: 0x52, flags: 0x0}, + 1122: {region: 0x130, script: 0x52, flags: 0x0}, + 1123: {region: 0x125, script: 0x52, flags: 0x0}, + 1124: {region: 0x164, script: 0x52, flags: 0x0}, + 1125: {region: 0x3c, script: 0x3, flags: 0x1}, + 1126: {region: 0x164, script: 0x52, flags: 0x0}, + 1127: {region: 0x164, script: 0x52, flags: 0x0}, + 1128: {region: 0x164, script: 0x52, flags: 0x0}, + 1129: {region: 0x122, script: 0xd5, flags: 0x0}, + 1130: {region: 0xda, script: 0x20, flags: 0x0}, + 1131: {region: 0xda, script: 0x20, flags: 0x0}, + 1132: {region: 0xda, script: 0x20, flags: 0x0}, + 1133: {region: 0x6e, script: 0x27, flags: 0x0}, + 1134: {region: 0x164, script: 0x52, flags: 0x0}, + 1135: {region: 0x6c, script: 0x27, flags: 0x0}, + 1136: {region: 0x164, script: 0x52, flags: 0x0}, + 1137: {region: 0x164, script: 0x52, flags: 0x0}, + 1138: {region: 0x164, script: 0x52, flags: 0x0}, + 1139: {region: 0xd5, script: 0x52, flags: 0x0}, + 1140: {region: 0x126, script: 0x52, flags: 0x0}, + 1141: {region: 0x124, script: 0x52, flags: 0x0}, + 1142: {region: 0x31, script: 0x52, flags: 0x0}, + 1143: {region: 0xda, script: 0x20, flags: 0x0}, + 1144: {region: 0xe6, script: 0x52, flags: 0x0}, + 1145: {region: 0x164, script: 0x52, flags: 0x0}, + 1146: {region: 0x164, script: 0x52, flags: 0x0}, + 1147: {region: 0x31, script: 0x52, flags: 0x0}, + 1148: {region: 0xd3, script: 0x52, flags: 0x0}, + 1149: {region: 0x164, script: 0x52, flags: 0x0}, + 1150: {region: 0x160, script: 0x52, flags: 0x0}, + 1151: {region: 0x164, script: 0x52, flags: 0x0}, + 1152: {region: 0x128, script: 0x52, flags: 0x0}, + 1153: {region: 0x164, script: 0x52, flags: 0x0}, + 1154: {region: 0xcd, script: 0x52, flags: 0x0}, + 1155: {region: 0x164, script: 0x52, flags: 0x0}, + 1156: {region: 0xe5, script: 0x52, flags: 0x0}, + 1157: {region: 0x164, script: 0x52, flags: 0x0}, + 1158: {region: 0x164, script: 0x52, flags: 0x0}, + 1159: {region: 0x164, script: 0x52, flags: 0x0}, + 1160: {region: 0x12a, script: 0x52, flags: 0x0}, + 1161: {region: 0x12a, script: 0x52, flags: 0x0}, + 1162: {region: 0x12d, script: 0x52, flags: 0x0}, + 1163: {region: 0x164, script: 0x5, flags: 0x0}, + 1164: {region: 0x160, script: 0x52, flags: 0x0}, + 1165: {region: 0x86, script: 0x2d, flags: 0x0}, + 1166: {region: 0xda, script: 0x20, flags: 0x0}, + 1167: {region: 0xe6, script: 0x52, flags: 0x0}, + 1168: {region: 0x42, script: 0xd6, flags: 0x0}, + 1169: {region: 0x164, script: 0x52, flags: 0x0}, + 1170: {region: 0x105, script: 0x1e, flags: 0x0}, + 1171: {region: 0x164, script: 0x52, flags: 0x0}, + 1172: {region: 0x164, script: 0x52, flags: 0x0}, + 1173: {region: 0x130, script: 0x52, flags: 0x0}, + 1174: {region: 0x164, script: 0x52, flags: 0x0}, + 1175: {region: 0x122, script: 0xd5, flags: 0x0}, + 1176: {region: 0x31, script: 0x52, flags: 0x0}, + 1177: {region: 0x164, script: 0x52, flags: 0x0}, + 1178: {region: 0x164, script: 0x52, flags: 0x0}, + 1179: {region: 0xcd, script: 0x52, flags: 0x0}, + 1180: {region: 0x164, script: 0x52, flags: 0x0}, + 1181: {region: 0x164, script: 0x52, flags: 0x0}, + 1182: {region: 0x12c, script: 0x52, flags: 0x0}, + 1183: {region: 0x164, script: 0x52, flags: 0x0}, + 1185: {region: 0x164, script: 0x52, flags: 0x0}, + 1186: {region: 0xd3, script: 0x52, flags: 0x0}, + 1187: {region: 0x52, script: 0xce, flags: 0x0}, + 1188: {region: 0xe4, script: 0x52, flags: 0x0}, + 1189: {region: 0x164, script: 0x52, flags: 0x0}, + 1190: {region: 0x105, script: 0x1e, flags: 0x0}, + 1191: {region: 0xb9, script: 0x52, flags: 0x0}, + 1192: {region: 0x164, script: 0x52, flags: 0x0}, + 1193: {region: 0x105, script: 0x1e, flags: 0x0}, + 1194: {region: 0x3f, script: 0x4, flags: 0x1}, + 1195: {region: 0x11b, script: 0xd8, flags: 0x0}, + 1196: {region: 0x12f, script: 0x1e, flags: 0x0}, + 1197: {region: 0x74, script: 0x52, flags: 0x0}, + 1198: {region: 0x29, script: 0x52, flags: 0x0}, + 1200: {region: 0x43, script: 0x3, flags: 0x1}, + 1201: {region: 0x98, script: 0xe, flags: 0x0}, + 1202: {region: 0xe7, script: 0x5, flags: 0x0}, + 1203: {region: 0x164, script: 0x52, flags: 0x0}, + 1204: {region: 0x164, script: 0x52, flags: 0x0}, + 1205: {region: 0x164, script: 0x52, flags: 0x0}, + 1206: {region: 0x164, script: 0x52, flags: 0x0}, + 1207: {region: 0x164, script: 0x52, flags: 0x0}, + 1208: {region: 0x164, script: 0x52, flags: 0x0}, + 1209: {region: 0x164, script: 0x52, flags: 0x0}, + 1210: {region: 0x46, script: 0x4, flags: 0x1}, + 1211: {region: 0x164, script: 0x52, flags: 0x0}, + 1212: {region: 0xb3, script: 0xd9, flags: 0x0}, + 1213: {region: 0x164, script: 0x52, flags: 0x0}, + 1214: {region: 0x160, script: 0x52, flags: 0x0}, + 1215: {region: 0x9d, script: 0x52, flags: 0x0}, + 1216: {region: 0x105, script: 0x52, flags: 0x0}, + 1217: {region: 0x13d, script: 0x52, flags: 0x0}, + 1218: {region: 0x11a, script: 0x52, flags: 0x0}, + 1219: {region: 0x164, script: 0x52, flags: 0x0}, + 1220: {region: 0x35, script: 0x52, flags: 0x0}, + 1221: {region: 0x5f, script: 0x52, flags: 0x0}, + 1222: {region: 0xd0, script: 0x52, flags: 0x0}, + 1223: {region: 0x1, script: 0x52, flags: 0x0}, + 1224: {region: 0x105, script: 0x52, flags: 0x0}, + 1225: {region: 0x69, script: 0x52, flags: 0x0}, + 1226: {region: 0x12e, script: 0x52, flags: 0x0}, + 1227: {region: 0x164, script: 0x52, flags: 0x0}, + 1228: {region: 0x35, script: 0x52, flags: 0x0}, + 1229: {region: 0x4d, script: 0x52, flags: 0x0}, + 1230: {region: 0x164, script: 0x52, flags: 0x0}, + 1231: {region: 0x6e, script: 0x27, flags: 0x0}, + 1232: {region: 0x164, script: 0x52, flags: 0x0}, + 1233: {region: 0xe6, script: 0x52, flags: 0x0}, + 1234: {region: 0x2e, script: 0x52, flags: 0x0}, + 1235: {region: 0x98, script: 0xd0, flags: 0x0}, + 1236: {region: 0x98, script: 0x20, flags: 0x0}, + 1237: {region: 0x164, script: 0x52, flags: 0x0}, + 1238: {region: 0x164, script: 0x52, flags: 0x0}, + 1239: {region: 0x164, script: 0x52, flags: 0x0}, + 1240: {region: 0x164, script: 0x52, flags: 0x0}, + 1241: {region: 0x164, script: 0x52, flags: 0x0}, + 1242: {region: 0x164, script: 0x52, flags: 0x0}, + 1243: {region: 0x164, script: 0x52, flags: 0x0}, + 1244: {region: 0x164, script: 0x52, flags: 0x0}, + 1245: {region: 0x164, script: 0x52, flags: 0x0}, + 1246: {region: 0x13f, script: 0x52, flags: 0x0}, + 1247: {region: 0x164, script: 0x52, flags: 0x0}, + 1248: {region: 0x164, script: 0x52, flags: 0x0}, + 1249: {region: 0xa7, script: 0x5, flags: 0x0}, + 1250: {region: 0x164, script: 0x52, flags: 0x0}, + 1251: {region: 0x113, script: 0x52, flags: 0x0}, + 1252: {region: 0x164, script: 0x52, flags: 0x0}, + 1253: {region: 0x164, script: 0x52, flags: 0x0}, + 1254: {region: 0x164, script: 0x52, flags: 0x0}, + 1255: {region: 0x164, script: 0x52, flags: 0x0}, + 1256: {region: 0x98, script: 0x20, flags: 0x0}, + 1257: {region: 0x52, script: 0x34, flags: 0x0}, + 1258: {region: 0x164, script: 0x52, flags: 0x0}, + 1259: {region: 0x164, script: 0x52, flags: 0x0}, + 1260: {region: 0x40, script: 0x52, flags: 0x0}, + 1261: {region: 0x164, script: 0x52, flags: 0x0}, + 1262: {region: 0x12a, script: 0x18, flags: 0x0}, + 1263: {region: 0x164, script: 0x52, flags: 0x0}, + 1264: {region: 0x160, script: 0x52, flags: 0x0}, + 1265: {region: 0x164, script: 0x52, flags: 0x0}, + 1266: {region: 0x12a, script: 0x5a, flags: 0x0}, + 1267: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1268: {region: 0x7c, script: 0x29, flags: 0x0}, + 1269: {region: 0x52, script: 0x5e, flags: 0x0}, + 1270: {region: 0x10a, script: 0x62, flags: 0x0}, + 1271: {region: 0x107, script: 0x6c, flags: 0x0}, + 1272: {region: 0x98, script: 0x20, flags: 0x0}, + 1273: {region: 0x130, script: 0x52, flags: 0x0}, + 1274: {region: 0x164, script: 0x52, flags: 0x0}, + 1275: {region: 0x9b, script: 0x82, flags: 0x0}, + 1276: {region: 0x164, script: 0x52, flags: 0x0}, + 1277: {region: 0x15d, script: 0xba, flags: 0x0}, + 1278: {region: 0x164, script: 0x52, flags: 0x0}, + 1279: {region: 0x164, script: 0x52, flags: 0x0}, + 1280: {region: 0xda, script: 0x20, flags: 0x0}, + 1281: {region: 0x164, script: 0x52, flags: 0x0}, + 1282: {region: 0x164, script: 0x52, flags: 0x0}, + 1283: {region: 0xd0, script: 0x52, flags: 0x0}, + 1284: {region: 0x74, script: 0x52, flags: 0x0}, + 1285: {region: 0x164, script: 0x52, flags: 0x0}, + 1286: {region: 0x164, script: 0x52, flags: 0x0}, + 1287: {region: 0x51, script: 0x52, flags: 0x0}, + 1288: {region: 0x164, script: 0x52, flags: 0x0}, + 1289: {region: 0x164, script: 0x52, flags: 0x0}, + 1290: {region: 0x164, script: 0x52, flags: 0x0}, + 1291: {region: 0x51, script: 0x52, flags: 0x0}, + 1292: {region: 0x164, script: 0x52, flags: 0x0}, + 1293: {region: 0x164, script: 0x52, flags: 0x0}, + 1294: {region: 0x164, script: 0x52, flags: 0x0}, + 1295: {region: 0x164, script: 0x52, flags: 0x0}, + 1296: {region: 0x1, script: 0x37, flags: 0x0}, + 1297: {region: 0x164, script: 0x52, flags: 0x0}, + 1298: {region: 0x164, script: 0x52, flags: 0x0}, + 1299: {region: 0x164, script: 0x52, flags: 0x0}, + 1300: {region: 0x164, script: 0x52, flags: 0x0}, + 1301: {region: 0x164, script: 0x52, flags: 0x0}, + 1302: {region: 0xd5, script: 0x52, flags: 0x0}, + 1303: {region: 0x164, script: 0x52, flags: 0x0}, + 1304: {region: 0x164, script: 0x52, flags: 0x0}, + 1305: {region: 0x164, script: 0x52, flags: 0x0}, + 1306: {region: 0x40, script: 0x52, flags: 0x0}, + 1307: {region: 0x164, script: 0x52, flags: 0x0}, + 1308: {region: 0xce, script: 0x52, flags: 0x0}, + 1309: {region: 0x4a, script: 0x3, flags: 0x1}, + 1310: {region: 0x164, script: 0x52, flags: 0x0}, + 1311: {region: 0x164, script: 0x52, flags: 0x0}, + 1312: {region: 0x164, script: 0x52, flags: 0x0}, + 1313: {region: 0x52, script: 0x52, flags: 0x0}, + 1314: {region: 0x10a, script: 0x52, flags: 0x0}, + 1316: {region: 0xa7, script: 0x5, flags: 0x0}, + 1317: {region: 0xd8, script: 0x52, flags: 0x0}, + 1318: {region: 0xb9, script: 0xd2, flags: 0x0}, + 1319: {region: 0x4d, script: 0x14, flags: 0x1}, + 1320: {region: 0x164, script: 0x52, flags: 0x0}, + 1321: {region: 0x121, script: 0x52, flags: 0x0}, + 1322: {region: 0xcf, script: 0x52, flags: 0x0}, + 1323: {region: 0x164, script: 0x52, flags: 0x0}, + 1324: {region: 0x160, script: 0x52, flags: 0x0}, + 1326: {region: 0x12a, script: 0x52, flags: 0x0}, } // likelyLangList holds lists info associated with likelyLang. -// Size: 396 bytes, 99 elements -var likelyLangList = [99]likelyScriptRegion{ - 0: {region: 0x9a, script: 0x7, flags: 0x0}, - 1: {region: 0x9f, script: 0x6d, flags: 0x2}, - 2: {region: 0x11a, script: 0x78, flags: 0x2}, +// Size: 388 bytes, 97 elements +var likelyLangList = [97]likelyScriptRegion{ + 0: {region: 0x9b, script: 0x7, flags: 0x0}, + 1: {region: 0xa0, script: 0x6d, flags: 0x2}, + 2: {region: 0x11b, script: 0x78, flags: 0x2}, 3: {region: 0x31, script: 0x52, flags: 0x0}, - 4: {region: 0x99, script: 0x5, flags: 0x4}, - 5: {region: 0x9a, script: 0x5, flags: 0x4}, - 6: {region: 0x104, script: 0x1e, flags: 0x4}, - 7: {region: 0x9a, script: 0x5, flags: 0x2}, - 8: {region: 0x97, script: 0xe, flags: 0x0}, - 9: {region: 0x34, script: 0x16, flags: 0x2}, - 10: {region: 0x104, script: 0x1e, flags: 0x0}, - 11: {region: 0x37, script: 0x2a, flags: 0x2}, - 12: {region: 0x132, script: 0x52, flags: 0x0}, - 13: {region: 0x79, script: 0xbd, flags: 0x2}, - 14: {region: 0x112, script: 0x52, flags: 0x0}, - 15: {region: 0x82, script: 0x1, flags: 0x2}, - 16: {region: 0x5c, script: 0x1d, flags: 0x0}, - 17: {region: 0x85, script: 0x57, flags: 0x2}, - 18: {region: 0xd4, script: 0x52, flags: 0x0}, - 19: {region: 0x51, script: 0x5, flags: 0x4}, - 20: {region: 0x109, script: 0x5, flags: 0x4}, - 21: {region: 0xac, script: 0x1e, flags: 0x0}, - 22: {region: 0x23, script: 0x5, flags: 0x4}, - 23: {region: 0x52, script: 0x5, flags: 0x4}, - 24: {region: 0x9a, script: 0x5, flags: 0x4}, - 25: {region: 0xc3, script: 0x5, flags: 0x4}, - 26: {region: 0x52, script: 0x5, flags: 0x2}, - 27: {region: 0x129, script: 0x52, flags: 0x0}, - 28: {region: 0xae, script: 0x5, flags: 0x4}, - 29: {region: 0x99, script: 0x5, flags: 0x2}, - 30: {region: 0xa3, script: 0x1e, flags: 0x0}, - 31: {region: 0x52, script: 0x5, flags: 0x4}, - 32: {region: 0x129, script: 0x52, flags: 0x4}, - 33: {region: 0x52, script: 0x5, flags: 0x2}, - 34: {region: 0x129, script: 0x52, flags: 0x2}, - 35: {region: 0xd9, script: 0x20, flags: 0x0}, - 36: {region: 0x97, script: 0x55, flags: 0x2}, - 37: {region: 0x81, script: 0x52, flags: 0x0}, - 38: {region: 0x82, script: 0x70, flags: 0x4}, - 39: {region: 0x82, script: 0x70, flags: 0x2}, - 40: {region: 0xc3, script: 0x1e, flags: 0x0}, - 41: {region: 0x52, script: 0x66, flags: 0x4}, - 42: {region: 0x52, script: 0x66, flags: 0x2}, - 43: {region: 0xce, script: 0x52, flags: 0x0}, - 44: {region: 0x49, script: 0x5, flags: 0x4}, - 45: {region: 0x93, script: 0x5, flags: 0x4}, - 46: {region: 0x97, script: 0x2f, flags: 0x0}, - 47: {region: 0xe6, script: 0x5, flags: 0x4}, - 48: {region: 0xe6, script: 0x5, flags: 0x2}, - 49: {region: 0x9a, script: 0x7c, flags: 0x0}, - 50: {region: 0x52, script: 0x7d, flags: 0x2}, - 51: {region: 0xb8, script: 0xd2, flags: 0x0}, - 52: {region: 0xd7, script: 0x52, flags: 0x4}, - 53: {region: 0xe6, script: 0x5, flags: 0x0}, - 54: {region: 0x97, script: 0x20, flags: 0x2}, - 55: {region: 0x97, script: 0x47, flags: 0x2}, - 56: {region: 0x97, script: 0xc0, flags: 0x2}, - 57: {region: 0x103, script: 0x1e, flags: 0x0}, - 58: {region: 0xbb, script: 0x52, flags: 0x4}, - 59: {region: 0x102, script: 0x52, flags: 0x4}, - 60: {region: 0x104, script: 0x52, flags: 0x4}, - 61: {region: 0x129, script: 0x52, flags: 0x4}, - 62: {region: 0x122, script: 0x1e, flags: 0x0}, - 63: {region: 0xe6, script: 0x5, flags: 0x4}, - 64: {region: 0xe6, script: 0x5, flags: 0x2}, - 65: {region: 0x52, script: 0x5, flags: 0x0}, - 66: {region: 0xac, script: 0x1e, flags: 0x4}, - 67: {region: 0xc3, script: 0x1e, flags: 0x4}, - 68: {region: 0xac, script: 0x1e, flags: 0x2}, - 69: {region: 0x97, script: 0xe, flags: 0x0}, - 70: {region: 0xd9, script: 0x20, flags: 0x4}, - 71: {region: 0xd9, script: 0x20, flags: 0x2}, - 72: {region: 0x134, script: 0x52, flags: 0x0}, - 73: {region: 0x23, script: 0x5, flags: 0x4}, - 74: {region: 0x52, script: 0x1e, flags: 0x4}, - 75: {region: 0x23, script: 0x5, flags: 0x2}, - 76: {region: 0x8b, script: 0x35, flags: 0x0}, - 77: {region: 0x52, script: 0x34, flags: 0x4}, - 78: {region: 0x52, script: 0x34, flags: 0x2}, - 79: {region: 0x52, script: 0x34, flags: 0x0}, - 80: {region: 0x2e, script: 0x35, flags: 0x4}, - 81: {region: 0x3d, script: 0x35, flags: 0x4}, - 82: {region: 0x79, script: 0x35, flags: 0x4}, - 83: {region: 0x7c, script: 0x35, flags: 0x4}, - 84: {region: 0x8b, script: 0x35, flags: 0x4}, - 85: {region: 0x93, script: 0x35, flags: 0x4}, - 86: {region: 0xc4, script: 0x35, flags: 0x4}, - 87: {region: 0xce, script: 0x35, flags: 0x4}, - 88: {region: 0xe0, script: 0x35, flags: 0x4}, - 89: {region: 0xe3, script: 0x35, flags: 0x4}, - 90: {region: 0xe5, script: 0x35, flags: 0x4}, - 91: {region: 0x114, script: 0x35, flags: 0x4}, - 92: {region: 0x121, script: 0x35, flags: 0x4}, - 93: {region: 0x12c, script: 0x35, flags: 0x4}, - 94: {region: 0x132, script: 0x35, flags: 0x4}, - 95: {region: 0x13b, script: 0x35, flags: 0x4}, - 96: {region: 0x12c, script: 0x11, flags: 0x2}, - 97: {region: 0x12c, script: 0x30, flags: 0x2}, - 98: {region: 0x12c, script: 0x35, flags: 0x2}, + 4: {region: 0x9a, script: 0x5, flags: 0x4}, + 5: {region: 0x9b, script: 0x5, flags: 0x4}, + 6: {region: 0x105, script: 0x1e, flags: 0x4}, + 7: {region: 0x9b, script: 0x5, flags: 0x2}, + 8: {region: 0x105, script: 0x1e, flags: 0x0}, + 9: {region: 0x37, script: 0x2a, flags: 0x2}, + 10: {region: 0x134, script: 0x52, flags: 0x0}, + 11: {region: 0x7a, script: 0xbd, flags: 0x2}, + 12: {region: 0x113, script: 0x52, flags: 0x0}, + 13: {region: 0x83, script: 0x1, flags: 0x2}, + 14: {region: 0x5c, script: 0x1d, flags: 0x0}, + 15: {region: 0x86, script: 0x57, flags: 0x2}, + 16: {region: 0xd5, script: 0x52, flags: 0x0}, + 17: {region: 0x51, script: 0x5, flags: 0x4}, + 18: {region: 0x10a, script: 0x5, flags: 0x4}, + 19: {region: 0xad, script: 0x1e, flags: 0x0}, + 20: {region: 0x23, script: 0x5, flags: 0x4}, + 21: {region: 0x52, script: 0x5, flags: 0x4}, + 22: {region: 0x9b, script: 0x5, flags: 0x4}, + 23: {region: 0xc4, script: 0x5, flags: 0x4}, + 24: {region: 0x52, script: 0x5, flags: 0x2}, + 25: {region: 0x12a, script: 0x52, flags: 0x0}, + 26: {region: 0xaf, script: 0x5, flags: 0x4}, + 27: {region: 0x9a, script: 0x5, flags: 0x2}, + 28: {region: 0xa4, script: 0x1e, flags: 0x0}, + 29: {region: 0x52, script: 0x5, flags: 0x4}, + 30: {region: 0x12a, script: 0x52, flags: 0x4}, + 31: {region: 0x52, script: 0x5, flags: 0x2}, + 32: {region: 0x12a, script: 0x52, flags: 0x2}, + 33: {region: 0xda, script: 0x20, flags: 0x0}, + 34: {region: 0x98, script: 0x55, flags: 0x2}, + 35: {region: 0x82, script: 0x52, flags: 0x0}, + 36: {region: 0x83, script: 0x70, flags: 0x4}, + 37: {region: 0x83, script: 0x70, flags: 0x2}, + 38: {region: 0xc4, script: 0x1e, flags: 0x0}, + 39: {region: 0x52, script: 0x66, flags: 0x4}, + 40: {region: 0x52, script: 0x66, flags: 0x2}, + 41: {region: 0xcf, script: 0x52, flags: 0x0}, + 42: {region: 0x49, script: 0x5, flags: 0x4}, + 43: {region: 0x94, script: 0x5, flags: 0x4}, + 44: {region: 0x98, script: 0x2f, flags: 0x0}, + 45: {region: 0xe7, script: 0x5, flags: 0x4}, + 46: {region: 0xe7, script: 0x5, flags: 0x2}, + 47: {region: 0x9b, script: 0x7c, flags: 0x0}, + 48: {region: 0x52, script: 0x7d, flags: 0x2}, + 49: {region: 0xb9, script: 0xd2, flags: 0x0}, + 50: {region: 0xd8, script: 0x52, flags: 0x4}, + 51: {region: 0xe7, script: 0x5, flags: 0x0}, + 52: {region: 0x98, script: 0x20, flags: 0x2}, + 53: {region: 0x98, script: 0x47, flags: 0x2}, + 54: {region: 0x98, script: 0xc0, flags: 0x2}, + 55: {region: 0x104, script: 0x1e, flags: 0x0}, + 56: {region: 0xbc, script: 0x52, flags: 0x4}, + 57: {region: 0x103, script: 0x52, flags: 0x4}, + 58: {region: 0x105, script: 0x52, flags: 0x4}, + 59: {region: 0x12a, script: 0x52, flags: 0x4}, + 60: {region: 0x123, script: 0x1e, flags: 0x0}, + 61: {region: 0xe7, script: 0x5, flags: 0x4}, + 62: {region: 0xe7, script: 0x5, flags: 0x2}, + 63: {region: 0x52, script: 0x5, flags: 0x0}, + 64: {region: 0xad, script: 0x1e, flags: 0x4}, + 65: {region: 0xc4, script: 0x1e, flags: 0x4}, + 66: {region: 0xad, script: 0x1e, flags: 0x2}, + 67: {region: 0x98, script: 0xe, flags: 0x0}, + 68: {region: 0xda, script: 0x20, flags: 0x4}, + 69: {region: 0xda, script: 0x20, flags: 0x2}, + 70: {region: 0x136, script: 0x52, flags: 0x0}, + 71: {region: 0x23, script: 0x5, flags: 0x4}, + 72: {region: 0x52, script: 0x1e, flags: 0x4}, + 73: {region: 0x23, script: 0x5, flags: 0x2}, + 74: {region: 0x8c, script: 0x35, flags: 0x0}, + 75: {region: 0x52, script: 0x34, flags: 0x4}, + 76: {region: 0x52, script: 0x34, flags: 0x2}, + 77: {region: 0x52, script: 0x34, flags: 0x0}, + 78: {region: 0x2e, script: 0x35, flags: 0x4}, + 79: {region: 0x3d, script: 0x35, flags: 0x4}, + 80: {region: 0x7a, script: 0x35, flags: 0x4}, + 81: {region: 0x7d, script: 0x35, flags: 0x4}, + 82: {region: 0x8c, script: 0x35, flags: 0x4}, + 83: {region: 0x94, script: 0x35, flags: 0x4}, + 84: {region: 0xc5, script: 0x35, flags: 0x4}, + 85: {region: 0xcf, script: 0x35, flags: 0x4}, + 86: {region: 0xe1, script: 0x35, flags: 0x4}, + 87: {region: 0xe4, script: 0x35, flags: 0x4}, + 88: {region: 0xe6, script: 0x35, flags: 0x4}, + 89: {region: 0x115, script: 0x35, flags: 0x4}, + 90: {region: 0x122, script: 0x35, flags: 0x4}, + 91: {region: 0x12d, script: 0x35, flags: 0x4}, + 92: {region: 0x134, script: 0x35, flags: 0x4}, + 93: {region: 0x13d, script: 0x35, flags: 0x4}, + 94: {region: 0x12d, script: 0x11, flags: 0x2}, + 95: {region: 0x12d, script: 0x30, flags: 0x2}, + 96: {region: 0x12d, script: 0x35, flags: 0x2}, } type likelyLangScript struct { @@ -2163,307 +2924,308 @@ type likelyLangScript struct { // for a given regionID, lang and script are the index and size respectively // of the list in likelyRegionList. // TODO: exclude containers and user-definable regions from the list. -// Size: 1420 bytes, 355 elements -var likelyRegion = [355]likelyLangScript{ - 33: {lang: 0x61, script: 0x52, flags: 0x0}, - 34: {lang: 0x15, script: 0x5, flags: 0x0}, +// Size: 1428 bytes, 357 elements +var likelyRegion = [357]likelyLangScript{ + 33: {lang: 0xd7, script: 0x52, flags: 0x0}, + 34: {lang: 0x3a, script: 0x5, flags: 0x0}, 35: {lang: 0x0, script: 0x2, flags: 0x1}, 38: {lang: 0x2, script: 0x2, flags: 0x1}, 39: {lang: 0x4, script: 0x2, flags: 0x1}, - 41: {lang: 0x1ef, script: 0x52, flags: 0x0}, + 41: {lang: 0x3be, script: 0x52, flags: 0x0}, 42: {lang: 0x0, script: 0x52, flags: 0x0}, - 43: {lang: 0x9d, script: 0x52, flags: 0x0}, - 44: {lang: 0x22f, script: 0x52, flags: 0x0}, - 45: {lang: 0x85, script: 0x52, flags: 0x0}, - 47: {lang: 0x1bd, script: 0x52, flags: 0x0}, - 48: {lang: 0x247, script: 0x52, flags: 0x0}, - 49: {lang: 0x24, script: 0x52, flags: 0x0}, + 43: {lang: 0x13d, script: 0x52, flags: 0x0}, + 44: {lang: 0x419, script: 0x52, flags: 0x0}, + 45: {lang: 0x10c, script: 0x52, flags: 0x0}, + 47: {lang: 0x365, script: 0x52, flags: 0x0}, + 48: {lang: 0x442, script: 0x52, flags: 0x0}, + 49: {lang: 0x58, script: 0x52, flags: 0x0}, 50: {lang: 0x6, script: 0x2, flags: 0x1}, - 52: {lang: 0x4b, script: 0xe, flags: 0x0}, - 53: {lang: 0x1bd, script: 0x52, flags: 0x0}, - 54: {lang: 0xaf, script: 0x52, flags: 0x0}, - 55: {lang: 0x38, script: 0x1e, flags: 0x0}, - 56: {lang: 0x15, script: 0x5, flags: 0x0}, - 57: {lang: 0x201, script: 0x52, flags: 0x0}, - 58: {lang: 0xaf, script: 0x52, flags: 0x0}, - 59: {lang: 0xaf, script: 0x52, flags: 0x0}, - 61: {lang: 0x19a, script: 0x52, flags: 0x0}, - 62: {lang: 0x9d, script: 0x52, flags: 0x0}, - 63: {lang: 0x1db, script: 0x52, flags: 0x0}, - 64: {lang: 0x1ef, script: 0x52, flags: 0x0}, + 52: {lang: 0xa5, script: 0xe, flags: 0x0}, + 53: {lang: 0x365, script: 0x52, flags: 0x0}, + 54: {lang: 0x15d, script: 0x52, flags: 0x0}, + 55: {lang: 0x7e, script: 0x1e, flags: 0x0}, + 56: {lang: 0x3a, script: 0x5, flags: 0x0}, + 57: {lang: 0x3d7, script: 0x52, flags: 0x0}, + 58: {lang: 0x15d, script: 0x52, flags: 0x0}, + 59: {lang: 0x15d, script: 0x52, flags: 0x0}, + 61: {lang: 0x31d, script: 0x52, flags: 0x0}, + 62: {lang: 0x13d, script: 0x52, flags: 0x0}, + 63: {lang: 0x39f, script: 0x52, flags: 0x0}, + 64: {lang: 0x3be, script: 0x52, flags: 0x0}, 66: {lang: 0x8, script: 0x2, flags: 0x1}, 68: {lang: 0x0, script: 0x52, flags: 0x0}, - 70: {lang: 0x2f, script: 0x1e, flags: 0x0}, - 72: {lang: 0x2b9, script: 0x37, flags: 0x2}, - 73: {lang: 0x19a, script: 0x5, flags: 0x2}, - 74: {lang: 0x248, script: 0x52, flags: 0x0}, - 75: {lang: 0xaf, script: 0x52, flags: 0x0}, - 76: {lang: 0xaf, script: 0x52, flags: 0x0}, - 77: {lang: 0x85, script: 0x52, flags: 0x0}, - 78: {lang: 0xaf, script: 0x52, flags: 0x0}, - 80: {lang: 0x9d, script: 0x52, flags: 0x0}, - 81: {lang: 0xaf, script: 0x52, flags: 0x0}, + 70: {lang: 0x71, script: 0x1e, flags: 0x0}, + 72: {lang: 0x510, script: 0x37, flags: 0x2}, + 73: {lang: 0x31d, script: 0x5, flags: 0x2}, + 74: {lang: 0x443, script: 0x52, flags: 0x0}, + 75: {lang: 0x15d, script: 0x52, flags: 0x0}, + 76: {lang: 0x15d, script: 0x52, flags: 0x0}, + 77: {lang: 0x10c, script: 0x52, flags: 0x0}, + 78: {lang: 0x15d, script: 0x52, flags: 0x0}, + 80: {lang: 0x13d, script: 0x52, flags: 0x0}, + 81: {lang: 0x15d, script: 0x52, flags: 0x0}, 82: {lang: 0xa, script: 0x5, flags: 0x1}, - 83: {lang: 0x9d, script: 0x52, flags: 0x0}, + 83: {lang: 0x13d, script: 0x52, flags: 0x0}, 84: {lang: 0x0, script: 0x52, flags: 0x0}, - 85: {lang: 0x9d, script: 0x52, flags: 0x0}, - 88: {lang: 0x9d, script: 0x52, flags: 0x0}, - 89: {lang: 0x1ef, script: 0x52, flags: 0x0}, - 90: {lang: 0x1db, script: 0x52, flags: 0x0}, + 85: {lang: 0x13d, script: 0x52, flags: 0x0}, + 88: {lang: 0x13d, script: 0x52, flags: 0x0}, + 89: {lang: 0x3be, script: 0x52, flags: 0x0}, + 90: {lang: 0x39f, script: 0x52, flags: 0x0}, 92: {lang: 0xf, script: 0x2, flags: 0x1}, - 93: {lang: 0x79, script: 0x52, flags: 0x0}, - 95: {lang: 0x85, script: 0x52, flags: 0x0}, + 93: {lang: 0xf9, script: 0x52, flags: 0x0}, + 95: {lang: 0x10c, script: 0x52, flags: 0x0}, 97: {lang: 0x1, script: 0x52, flags: 0x0}, - 98: {lang: 0x80, script: 0x52, flags: 0x0}, - 100: {lang: 0x9d, script: 0x52, flags: 0x0}, + 98: {lang: 0x100, script: 0x52, flags: 0x0}, + 100: {lang: 0x13d, script: 0x52, flags: 0x0}, 102: {lang: 0x11, script: 0x2, flags: 0x1}, - 103: {lang: 0x9d, script: 0x52, flags: 0x0}, - 104: {lang: 0x9d, script: 0x52, flags: 0x0}, - 105: {lang: 0x9f, script: 0x52, flags: 0x0}, - 106: {lang: 0x15, script: 0x5, flags: 0x0}, - 107: {lang: 0x15, script: 0x5, flags: 0x0}, - 108: {lang: 0x261, script: 0x27, flags: 0x0}, - 109: {lang: 0x9d, script: 0x52, flags: 0x0}, + 103: {lang: 0x13d, script: 0x52, flags: 0x0}, + 104: {lang: 0x13d, script: 0x52, flags: 0x0}, + 105: {lang: 0x13f, script: 0x52, flags: 0x0}, + 106: {lang: 0x3a, script: 0x5, flags: 0x0}, + 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 108: {lang: 0x46d, script: 0x27, flags: 0x0}, + 109: {lang: 0x13d, script: 0x52, flags: 0x0}, 110: {lang: 0x13, script: 0x2, flags: 0x1}, - 112: {lang: 0xa8, script: 0x52, flags: 0x0}, - 113: {lang: 0xe2, script: 0x20, flags: 0x2}, - 116: {lang: 0xad, script: 0x52, flags: 0x0}, - 118: {lang: 0xaf, script: 0x52, flags: 0x0}, - 120: {lang: 0xaf, script: 0x52, flags: 0x0}, - 121: {lang: 0x15, script: 0x2, flags: 0x1}, - 123: {lang: 0x17, script: 0x3, flags: 0x1}, - 124: {lang: 0xaf, script: 0x52, flags: 0x0}, - 126: {lang: 0xd, script: 0x52, flags: 0x0}, - 128: {lang: 0x131, script: 0x52, flags: 0x0}, - 130: {lang: 0xaf, script: 0x52, flags: 0x0}, - 131: {lang: 0xaf, script: 0x52, flags: 0x0}, - 132: {lang: 0x9d, script: 0x52, flags: 0x0}, - 133: {lang: 0x1a, script: 0x2, flags: 0x1}, - 134: {lang: 0x0, script: 0x52, flags: 0x0}, - 135: {lang: 0x9d, script: 0x52, flags: 0x0}, - 137: {lang: 0x1ef, script: 0x52, flags: 0x0}, - 139: {lang: 0x2c4, script: 0x35, flags: 0x0}, - 140: {lang: 0x0, script: 0x52, flags: 0x0}, - 141: {lang: 0x9d, script: 0x52, flags: 0x0}, - 142: {lang: 0xee, script: 0x52, flags: 0x0}, - 143: {lang: 0xf1, script: 0x52, flags: 0x0}, - 144: {lang: 0xf2, script: 0x52, flags: 0x0}, - 146: {lang: 0x9d, script: 0x52, flags: 0x0}, - 147: {lang: 0x1c, script: 0x2, flags: 0x1}, - 149: {lang: 0xe0, script: 0x37, flags: 0x0}, - 151: {lang: 0x1e, script: 0x3, flags: 0x1}, - 153: {lang: 0x15, script: 0x5, flags: 0x0}, - 154: {lang: 0x21, script: 0x2, flags: 0x1}, - 155: {lang: 0x102, script: 0x52, flags: 0x0}, - 156: {lang: 0x103, script: 0x52, flags: 0x0}, - 159: {lang: 0x15, script: 0x5, flags: 0x0}, - 160: {lang: 0x107, script: 0x41, flags: 0x0}, - 162: {lang: 0x248, script: 0x52, flags: 0x0}, - 163: {lang: 0x14d, script: 0x1e, flags: 0x0}, - 164: {lang: 0x23, script: 0x3, flags: 0x1}, - 166: {lang: 0x26, script: 0x2, flags: 0x1}, - 168: {lang: 0x136, script: 0x4b, flags: 0x0}, - 169: {lang: 0x136, script: 0x4b, flags: 0x0}, - 170: {lang: 0x15, script: 0x5, flags: 0x0}, - 172: {lang: 0x207, script: 0x1e, flags: 0x0}, - 173: {lang: 0x28, script: 0x2, flags: 0x1}, - 174: {lang: 0x15, script: 0x5, flags: 0x0}, - 176: {lang: 0x85, script: 0x52, flags: 0x0}, - 177: {lang: 0x228, script: 0xc1, flags: 0x0}, - 179: {lang: 0x242, script: 0x52, flags: 0x0}, - 180: {lang: 0x169, script: 0x52, flags: 0x0}, - 181: {lang: 0xaf, script: 0x52, flags: 0x0}, - 182: {lang: 0x170, script: 0x52, flags: 0x0}, - 183: {lang: 0x15, script: 0x5, flags: 0x0}, - 184: {lang: 0x2a, script: 0x2, flags: 0x1}, - 185: {lang: 0xaf, script: 0x52, flags: 0x0}, - 186: {lang: 0x2c, script: 0x2, flags: 0x1}, - 187: {lang: 0x23b, script: 0x52, flags: 0x0}, - 188: {lang: 0xaf, script: 0x52, flags: 0x0}, - 189: {lang: 0x183, script: 0x52, flags: 0x0}, - 192: {lang: 0x2e, script: 0x2, flags: 0x1}, - 193: {lang: 0x49, script: 0x52, flags: 0x0}, - 194: {lang: 0x30, script: 0x2, flags: 0x1}, - 195: {lang: 0x32, script: 0x2, flags: 0x1}, - 196: {lang: 0x34, script: 0x2, flags: 0x1}, - 198: {lang: 0xaf, script: 0x52, flags: 0x0}, - 199: {lang: 0x36, script: 0x2, flags: 0x1}, - 201: {lang: 0x19b, script: 0x52, flags: 0x0}, - 202: {lang: 0x38, script: 0x3, flags: 0x1}, - 203: {lang: 0x90, script: 0xd4, flags: 0x0}, - 205: {lang: 0x9d, script: 0x52, flags: 0x0}, - 206: {lang: 0x19a, script: 0x52, flags: 0x0}, - 207: {lang: 0x1ef, script: 0x52, flags: 0x0}, - 208: {lang: 0xa, script: 0x52, flags: 0x0}, - 209: {lang: 0xaf, script: 0x52, flags: 0x0}, - 210: {lang: 0xdc, script: 0x52, flags: 0x0}, - 212: {lang: 0xdc, script: 0x5, flags: 0x2}, - 214: {lang: 0x9d, script: 0x52, flags: 0x0}, - 215: {lang: 0x1bd, script: 0x52, flags: 0x0}, - 216: {lang: 0x1af, script: 0x52, flags: 0x0}, - 217: {lang: 0x1b4, script: 0x20, flags: 0x0}, - 223: {lang: 0x15, script: 0x5, flags: 0x0}, - 224: {lang: 0x9d, script: 0x52, flags: 0x0}, - 226: {lang: 0x9d, script: 0x52, flags: 0x0}, - 227: {lang: 0xaf, script: 0x52, flags: 0x0}, - 228: {lang: 0x26e, script: 0x52, flags: 0x0}, - 229: {lang: 0xaa, script: 0x52, flags: 0x0}, - 230: {lang: 0x3b, script: 0x3, flags: 0x1}, - 231: {lang: 0x3e, script: 0x2, flags: 0x1}, - 232: {lang: 0xaf, script: 0x52, flags: 0x0}, - 234: {lang: 0x9d, script: 0x52, flags: 0x0}, - 235: {lang: 0x15, script: 0x5, flags: 0x0}, - 236: {lang: 0x1ef, script: 0x52, flags: 0x0}, - 238: {lang: 0x1dc, script: 0x52, flags: 0x0}, - 239: {lang: 0xca, script: 0x52, flags: 0x0}, - 241: {lang: 0x15, script: 0x5, flags: 0x0}, - 256: {lang: 0xaf, script: 0x52, flags: 0x0}, - 258: {lang: 0x40, script: 0x2, flags: 0x1}, - 259: {lang: 0x23b, script: 0x1e, flags: 0x0}, - 260: {lang: 0x42, script: 0x2, flags: 0x1}, - 261: {lang: 0x20a, script: 0x52, flags: 0x0}, - 262: {lang: 0x15, script: 0x5, flags: 0x0}, - 264: {lang: 0xaf, script: 0x52, flags: 0x0}, - 265: {lang: 0x15, script: 0x5, flags: 0x0}, - 266: {lang: 0x44, script: 0x2, flags: 0x1}, - 269: {lang: 0x22c, script: 0x52, flags: 0x0}, - 270: {lang: 0x1af, script: 0x52, flags: 0x0}, - 271: {lang: 0x46, script: 0x2, flags: 0x1}, - 273: {lang: 0x103, script: 0x52, flags: 0x0}, - 274: {lang: 0xaf, script: 0x52, flags: 0x0}, - 275: {lang: 0x238, script: 0x52, flags: 0x0}, - 276: {lang: 0x1bd, script: 0x52, flags: 0x0}, - 278: {lang: 0x1ef, script: 0x52, flags: 0x0}, - 280: {lang: 0x9d, script: 0x52, flags: 0x0}, - 282: {lang: 0x48, script: 0x2, flags: 0x1}, - 286: {lang: 0xaf, script: 0x52, flags: 0x0}, - 287: {lang: 0xaf, script: 0x52, flags: 0x0}, - 288: {lang: 0xaf, script: 0x52, flags: 0x0}, - 289: {lang: 0x4a, script: 0x3, flags: 0x1}, - 290: {lang: 0x4d, script: 0x2, flags: 0x1}, - 291: {lang: 0x265, script: 0x52, flags: 0x0}, - 292: {lang: 0x1ef, script: 0x52, flags: 0x0}, - 293: {lang: 0x264, script: 0x52, flags: 0x0}, - 294: {lang: 0x4f, script: 0x2, flags: 0x1}, - 295: {lang: 0x26c, script: 0x52, flags: 0x0}, - 297: {lang: 0x51, script: 0x4, flags: 0x1}, - 299: {lang: 0x27c, script: 0x52, flags: 0x0}, - 300: {lang: 0x55, script: 0x2, flags: 0x1}, - 301: {lang: 0x248, script: 0x52, flags: 0x0}, - 302: {lang: 0x57, script: 0x3, flags: 0x1}, - 303: {lang: 0x248, script: 0x52, flags: 0x0}, - 306: {lang: 0x2b9, script: 0x37, flags: 0x2}, - 307: {lang: 0x9d, script: 0x52, flags: 0x0}, - 308: {lang: 0x28d, script: 0x52, flags: 0x0}, - 309: {lang: 0x103, script: 0x52, flags: 0x0}, - 312: {lang: 0x9d, script: 0x52, flags: 0x0}, - 315: {lang: 0x292, script: 0x52, flags: 0x0}, - 316: {lang: 0x41, script: 0x52, flags: 0x0}, - 317: {lang: 0xaf, script: 0x52, flags: 0x0}, - 319: {lang: 0x22f, script: 0x52, flags: 0x0}, - 330: {lang: 0x5a, script: 0x2, flags: 0x1}, - 347: {lang: 0x15, script: 0x5, flags: 0x0}, - 348: {lang: 0x5c, script: 0x2, flags: 0x1}, - 353: {lang: 0x236, script: 0x52, flags: 0x0}, + 112: {lang: 0x10c, script: 0x52, flags: 0x0}, + 113: {lang: 0x150, script: 0x52, flags: 0x0}, + 114: {lang: 0x1be, script: 0x20, flags: 0x2}, + 117: {lang: 0x157, script: 0x52, flags: 0x0}, + 119: {lang: 0x15d, script: 0x52, flags: 0x0}, + 121: {lang: 0x15d, script: 0x52, flags: 0x0}, + 122: {lang: 0x15, script: 0x2, flags: 0x1}, + 124: {lang: 0x17, script: 0x3, flags: 0x1}, + 125: {lang: 0x15d, script: 0x52, flags: 0x0}, + 127: {lang: 0x21, script: 0x52, flags: 0x0}, + 129: {lang: 0x243, script: 0x52, flags: 0x0}, + 131: {lang: 0x15d, script: 0x52, flags: 0x0}, + 132: {lang: 0x15d, script: 0x52, flags: 0x0}, + 133: {lang: 0x13d, script: 0x52, flags: 0x0}, + 134: {lang: 0x1a, script: 0x2, flags: 0x1}, + 135: {lang: 0x0, script: 0x52, flags: 0x0}, + 136: {lang: 0x13d, script: 0x52, flags: 0x0}, + 138: {lang: 0x3be, script: 0x52, flags: 0x0}, + 140: {lang: 0x527, script: 0x35, flags: 0x0}, + 141: {lang: 0x0, script: 0x52, flags: 0x0}, + 142: {lang: 0x13d, script: 0x52, flags: 0x0}, + 143: {lang: 0x1cf, script: 0x52, flags: 0x0}, + 144: {lang: 0x1d2, script: 0x52, flags: 0x0}, + 145: {lang: 0x1d3, script: 0x52, flags: 0x0}, + 147: {lang: 0x13d, script: 0x52, flags: 0x0}, + 148: {lang: 0x1c, script: 0x2, flags: 0x1}, + 150: {lang: 0x1ba, script: 0x37, flags: 0x0}, + 152: {lang: 0x1e, script: 0x3, flags: 0x1}, + 154: {lang: 0x3a, script: 0x5, flags: 0x0}, + 155: {lang: 0x21, script: 0x2, flags: 0x1}, + 156: {lang: 0x1f6, script: 0x52, flags: 0x0}, + 157: {lang: 0x1f7, script: 0x52, flags: 0x0}, + 160: {lang: 0x3a, script: 0x5, flags: 0x0}, + 161: {lang: 0x1fe, script: 0x41, flags: 0x0}, + 163: {lang: 0x443, script: 0x52, flags: 0x0}, + 164: {lang: 0x288, script: 0x1e, flags: 0x0}, + 165: {lang: 0x23, script: 0x3, flags: 0x1}, + 167: {lang: 0x26, script: 0x2, flags: 0x1}, + 169: {lang: 0x252, script: 0x4b, flags: 0x0}, + 170: {lang: 0x252, script: 0x4b, flags: 0x0}, + 171: {lang: 0x3a, script: 0x5, flags: 0x0}, + 173: {lang: 0x3e0, script: 0x1e, flags: 0x0}, + 174: {lang: 0x28, script: 0x2, flags: 0x1}, + 175: {lang: 0x3a, script: 0x5, flags: 0x0}, + 177: {lang: 0x10c, script: 0x52, flags: 0x0}, + 178: {lang: 0x40a, script: 0xc1, flags: 0x0}, + 180: {lang: 0x439, script: 0x52, flags: 0x0}, + 181: {lang: 0x2be, script: 0x52, flags: 0x0}, + 182: {lang: 0x15d, script: 0x52, flags: 0x0}, + 183: {lang: 0x2c5, script: 0x52, flags: 0x0}, + 184: {lang: 0x3a, script: 0x5, flags: 0x0}, + 185: {lang: 0x2a, script: 0x2, flags: 0x1}, + 186: {lang: 0x15d, script: 0x52, flags: 0x0}, + 187: {lang: 0x2c, script: 0x2, flags: 0x1}, + 188: {lang: 0x430, script: 0x52, flags: 0x0}, + 189: {lang: 0x15d, script: 0x52, flags: 0x0}, + 190: {lang: 0x2ef, script: 0x52, flags: 0x0}, + 193: {lang: 0x2e, script: 0x2, flags: 0x1}, + 194: {lang: 0xa0, script: 0x52, flags: 0x0}, + 195: {lang: 0x30, script: 0x2, flags: 0x1}, + 196: {lang: 0x32, script: 0x2, flags: 0x1}, + 197: {lang: 0x34, script: 0x2, flags: 0x1}, + 199: {lang: 0x15d, script: 0x52, flags: 0x0}, + 200: {lang: 0x36, script: 0x2, flags: 0x1}, + 202: {lang: 0x31e, script: 0x52, flags: 0x0}, + 203: {lang: 0x38, script: 0x3, flags: 0x1}, + 204: {lang: 0x127, script: 0xd4, flags: 0x0}, + 206: {lang: 0x13d, script: 0x52, flags: 0x0}, + 207: {lang: 0x31d, script: 0x52, flags: 0x0}, + 208: {lang: 0x3be, script: 0x52, flags: 0x0}, + 209: {lang: 0x16, script: 0x52, flags: 0x0}, + 210: {lang: 0x15d, script: 0x52, flags: 0x0}, + 211: {lang: 0x1b2, script: 0x52, flags: 0x0}, + 213: {lang: 0x1b2, script: 0x5, flags: 0x2}, + 215: {lang: 0x13d, script: 0x52, flags: 0x0}, + 216: {lang: 0x365, script: 0x52, flags: 0x0}, + 217: {lang: 0x345, script: 0x52, flags: 0x0}, + 218: {lang: 0x34f, script: 0x20, flags: 0x0}, + 224: {lang: 0x3a, script: 0x5, flags: 0x0}, + 225: {lang: 0x13d, script: 0x52, flags: 0x0}, + 227: {lang: 0x13d, script: 0x52, flags: 0x0}, + 228: {lang: 0x15d, script: 0x52, flags: 0x0}, + 229: {lang: 0x484, script: 0x52, flags: 0x0}, + 230: {lang: 0x152, script: 0x52, flags: 0x0}, + 231: {lang: 0x3b, script: 0x3, flags: 0x1}, + 232: {lang: 0x3b1, script: 0x52, flags: 0x0}, + 233: {lang: 0x15d, script: 0x52, flags: 0x0}, + 235: {lang: 0x13d, script: 0x52, flags: 0x0}, + 236: {lang: 0x3a, script: 0x5, flags: 0x0}, + 237: {lang: 0x3be, script: 0x52, flags: 0x0}, + 239: {lang: 0x3a0, script: 0x52, flags: 0x0}, + 240: {lang: 0x192, script: 0x52, flags: 0x0}, + 242: {lang: 0x3a, script: 0x5, flags: 0x0}, + 257: {lang: 0x15d, script: 0x52, flags: 0x0}, + 259: {lang: 0x3e, script: 0x2, flags: 0x1}, + 260: {lang: 0x430, script: 0x1e, flags: 0x0}, + 261: {lang: 0x40, script: 0x2, flags: 0x1}, + 262: {lang: 0x3e3, script: 0x52, flags: 0x0}, + 263: {lang: 0x3a, script: 0x5, flags: 0x0}, + 265: {lang: 0x15d, script: 0x52, flags: 0x0}, + 266: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x42, script: 0x2, flags: 0x1}, + 270: {lang: 0x414, script: 0x52, flags: 0x0}, + 271: {lang: 0x345, script: 0x52, flags: 0x0}, + 272: {lang: 0x44, script: 0x2, flags: 0x1}, + 274: {lang: 0x1f7, script: 0x52, flags: 0x0}, + 275: {lang: 0x15d, script: 0x52, flags: 0x0}, + 276: {lang: 0x427, script: 0x52, flags: 0x0}, + 277: {lang: 0x365, script: 0x52, flags: 0x0}, + 279: {lang: 0x3be, script: 0x52, flags: 0x0}, + 281: {lang: 0x13d, script: 0x52, flags: 0x0}, + 283: {lang: 0x46, script: 0x2, flags: 0x1}, + 287: {lang: 0x15d, script: 0x52, flags: 0x0}, + 288: {lang: 0x15d, script: 0x52, flags: 0x0}, + 289: {lang: 0x48, script: 0x2, flags: 0x1}, + 290: {lang: 0x4a, script: 0x3, flags: 0x1}, + 291: {lang: 0x4d, script: 0x2, flags: 0x1}, + 292: {lang: 0x475, script: 0x52, flags: 0x0}, + 293: {lang: 0x3be, script: 0x52, flags: 0x0}, + 294: {lang: 0x474, script: 0x52, flags: 0x0}, + 295: {lang: 0x4f, script: 0x2, flags: 0x1}, + 296: {lang: 0x480, script: 0x52, flags: 0x0}, + 298: {lang: 0x51, script: 0x4, flags: 0x1}, + 300: {lang: 0x49e, script: 0x52, flags: 0x0}, + 301: {lang: 0x55, script: 0x2, flags: 0x1}, + 302: {lang: 0x443, script: 0x52, flags: 0x0}, + 303: {lang: 0x57, script: 0x3, flags: 0x1}, + 304: {lang: 0x443, script: 0x52, flags: 0x0}, + 308: {lang: 0x510, script: 0x37, flags: 0x2}, + 309: {lang: 0x13d, script: 0x52, flags: 0x0}, + 310: {lang: 0x4ba, script: 0x52, flags: 0x0}, + 311: {lang: 0x1f7, script: 0x52, flags: 0x0}, + 314: {lang: 0x13d, script: 0x52, flags: 0x0}, + 317: {lang: 0x4c1, script: 0x52, flags: 0x0}, + 318: {lang: 0x8a, script: 0x52, flags: 0x0}, + 319: {lang: 0x15d, script: 0x52, flags: 0x0}, + 321: {lang: 0x419, script: 0x52, flags: 0x0}, + 332: {lang: 0x5a, script: 0x2, flags: 0x1}, + 349: {lang: 0x3a, script: 0x5, flags: 0x0}, + 350: {lang: 0x5c, script: 0x2, flags: 0x1}, + 355: {lang: 0x421, script: 0x52, flags: 0x0}, } // likelyRegionList holds lists info associated with likelyRegion. // Size: 376 bytes, 94 elements var likelyRegionList = [94]likelyLangScript{ - 0: {lang: 0xa4, script: 0x5, flags: 0x0}, - 1: {lang: 0x264, script: 0x52, flags: 0x0}, - 2: {lang: 0x23a, script: 0x52, flags: 0x0}, - 3: {lang: 0x18c, script: 0x1e, flags: 0x0}, - 4: {lang: 0xf3, script: 0x8, flags: 0x0}, - 5: {lang: 0x145, script: 0x52, flags: 0x0}, - 6: {lang: 0x54, script: 0x52, flags: 0x0}, - 7: {lang: 0x23b, script: 0x1e, flags: 0x0}, - 8: {lang: 0x93, script: 0xd6, flags: 0x0}, - 9: {lang: 0x1b4, script: 0x20, flags: 0x0}, - 10: {lang: 0x2c4, script: 0x34, flags: 0x0}, - 11: {lang: 0x284, script: 0x5, flags: 0x0}, - 12: {lang: 0x2bd, script: 0x35, flags: 0x0}, - 13: {lang: 0x2be, script: 0x52, flags: 0x0}, - 14: {lang: 0x157, script: 0xd5, flags: 0x0}, - 15: {lang: 0x9a, script: 0x2d, flags: 0x0}, - 16: {lang: 0x26f, script: 0x52, flags: 0x0}, - 17: {lang: 0x15, script: 0x5, flags: 0x0}, - 18: {lang: 0xaf, script: 0x52, flags: 0x0}, - 19: {lang: 0x11, script: 0x27, flags: 0x0}, - 20: {lang: 0x9b, script: 0x52, flags: 0x0}, - 21: {lang: 0x141, script: 0x5, flags: 0x2}, - 22: {lang: 0x2b9, script: 0x37, flags: 0x2}, - 23: {lang: 0x111, script: 0x29, flags: 0x0}, - 24: {lang: 0x2, script: 0x1e, flags: 0x0}, - 25: {lang: 0x145, script: 0x52, flags: 0x0}, - 26: {lang: 0x9a, script: 0x2d, flags: 0x0}, - 27: {lang: 0x18c, script: 0x1e, flags: 0x0}, - 28: {lang: 0xf8, script: 0x52, flags: 0x0}, - 29: {lang: 0x19a, script: 0x5, flags: 0x0}, - 30: {lang: 0xe1, script: 0x20, flags: 0x0}, - 31: {lang: 0x28c, script: 0x5, flags: 0x0}, - 32: {lang: 0x129, script: 0x6b, flags: 0x0}, - 33: {lang: 0xa4, script: 0x5, flags: 0x0}, - 34: {lang: 0x264, script: 0x52, flags: 0x0}, - 35: {lang: 0x133, script: 0x46, flags: 0x0}, - 36: {lang: 0x6d, script: 0x5, flags: 0x0}, - 37: {lang: 0x11c, script: 0xd5, flags: 0x0}, - 38: {lang: 0x15, script: 0x5, flags: 0x0}, - 39: {lang: 0xaf, script: 0x52, flags: 0x0}, - 40: {lang: 0x165, script: 0x4f, flags: 0x0}, - 41: {lang: 0x11c, script: 0xd5, flags: 0x0}, - 42: {lang: 0x15, script: 0x5, flags: 0x0}, - 43: {lang: 0xaf, script: 0x52, flags: 0x0}, - 44: {lang: 0x203, script: 0x52, flags: 0x0}, - 45: {lang: 0x286, script: 0x1e, flags: 0x0}, - 46: {lang: 0x18c, script: 0x1e, flags: 0x0}, - 47: {lang: 0x23a, script: 0x52, flags: 0x0}, - 48: {lang: 0x1a5, script: 0x6b, flags: 0x0}, - 49: {lang: 0x114, script: 0x52, flags: 0x0}, - 50: {lang: 0x18f, script: 0x1e, flags: 0x0}, - 51: {lang: 0x12f, script: 0x5, flags: 0x0}, - 52: {lang: 0x2c4, script: 0x35, flags: 0x0}, - 53: {lang: 0x1ef, script: 0x52, flags: 0x0}, - 54: {lang: 0x15, script: 0x5, flags: 0x0}, - 55: {lang: 0xaf, script: 0x52, flags: 0x0}, - 56: {lang: 0x182, script: 0x52, flags: 0x0}, - 57: {lang: 0x28c, script: 0x5, flags: 0x0}, - 58: {lang: 0x40, script: 0x20, flags: 0x0}, - 59: {lang: 0x28c, script: 0x5, flags: 0x0}, - 60: {lang: 0x28c, script: 0x5, flags: 0x0}, - 61: {lang: 0x58, script: 0x20, flags: 0x0}, - 62: {lang: 0x1e7, script: 0x52, flags: 0x0}, - 63: {lang: 0x2f, script: 0x1e, flags: 0x0}, - 64: {lang: 0x203, script: 0x52, flags: 0x0}, - 65: {lang: 0x38, script: 0x1e, flags: 0x0}, - 66: {lang: 0x207, script: 0x1e, flags: 0x0}, - 67: {lang: 0x13f, script: 0x52, flags: 0x0}, - 68: {lang: 0x247, script: 0x52, flags: 0x0}, - 69: {lang: 0x2b9, script: 0x37, flags: 0x0}, - 70: {lang: 0x22a, script: 0x52, flags: 0x0}, - 71: {lang: 0x286, script: 0x1e, flags: 0x0}, - 72: {lang: 0x15, script: 0x5, flags: 0x0}, - 73: {lang: 0xaf, script: 0x52, flags: 0x0}, - 74: {lang: 0x25d, script: 0xd5, flags: 0x0}, - 75: {lang: 0x181, script: 0x5, flags: 0x0}, - 76: {lang: 0x191, script: 0x6b, flags: 0x0}, - 77: {lang: 0x25c, script: 0x1e, flags: 0x0}, - 78: {lang: 0xa4, script: 0x5, flags: 0x0}, - 79: {lang: 0x15, script: 0x5, flags: 0x0}, - 80: {lang: 0xaf, script: 0x52, flags: 0x0}, - 81: {lang: 0x26f, script: 0x52, flags: 0x0}, - 82: {lang: 0x24, script: 0x5, flags: 0x0}, - 83: {lang: 0x118, script: 0x1e, flags: 0x0}, - 84: {lang: 0x3b, script: 0x2d, flags: 0x0}, - 85: {lang: 0x2c4, script: 0x35, flags: 0x0}, - 86: {lang: 0x271, script: 0x52, flags: 0x0}, - 87: {lang: 0x286, script: 0x1e, flags: 0x0}, - 88: {lang: 0x2b9, script: 0x37, flags: 0x0}, - 89: {lang: 0x1e7, script: 0x52, flags: 0x0}, - 90: {lang: 0x23a, script: 0x52, flags: 0x0}, - 91: {lang: 0x23b, script: 0x1e, flags: 0x0}, - 92: {lang: 0xaf, script: 0x52, flags: 0x0}, - 93: {lang: 0x249, script: 0x5, flags: 0x0}, + 0: {lang: 0x147, script: 0x5, flags: 0x0}, + 1: {lang: 0x474, script: 0x52, flags: 0x0}, + 2: {lang: 0x42f, script: 0x52, flags: 0x0}, + 3: {lang: 0x2fd, script: 0x1e, flags: 0x0}, + 4: {lang: 0x1d5, script: 0x8, flags: 0x0}, + 5: {lang: 0x272, script: 0x52, flags: 0x0}, + 6: {lang: 0xb7, script: 0x52, flags: 0x0}, + 7: {lang: 0x430, script: 0x1e, flags: 0x0}, + 8: {lang: 0x12c, script: 0xd6, flags: 0x0}, + 9: {lang: 0x34f, script: 0x20, flags: 0x0}, + 10: {lang: 0x527, script: 0x34, flags: 0x0}, + 11: {lang: 0x4aa, script: 0x5, flags: 0x0}, + 12: {lang: 0x51d, script: 0x35, flags: 0x0}, + 13: {lang: 0x521, script: 0x52, flags: 0x0}, + 14: {lang: 0x298, script: 0xd5, flags: 0x0}, + 15: {lang: 0x135, script: 0x2d, flags: 0x0}, + 16: {lang: 0x488, script: 0x52, flags: 0x0}, + 17: {lang: 0x3a, script: 0x5, flags: 0x0}, + 18: {lang: 0x15d, script: 0x52, flags: 0x0}, + 19: {lang: 0x27, script: 0x27, flags: 0x0}, + 20: {lang: 0x138, script: 0x52, flags: 0x0}, + 21: {lang: 0x268, script: 0x5, flags: 0x2}, + 22: {lang: 0x510, script: 0x37, flags: 0x2}, + 23: {lang: 0x20e, script: 0x29, flags: 0x0}, + 24: {lang: 0x5, script: 0x1e, flags: 0x0}, + 25: {lang: 0x272, script: 0x52, flags: 0x0}, + 26: {lang: 0x135, script: 0x2d, flags: 0x0}, + 27: {lang: 0x2fd, script: 0x1e, flags: 0x0}, + 28: {lang: 0x1df, script: 0x52, flags: 0x0}, + 29: {lang: 0x31d, script: 0x5, flags: 0x0}, + 30: {lang: 0x1bc, script: 0x20, flags: 0x0}, + 31: {lang: 0x4b2, script: 0x5, flags: 0x0}, + 32: {lang: 0x234, script: 0x6b, flags: 0x0}, + 33: {lang: 0x147, script: 0x5, flags: 0x0}, + 34: {lang: 0x474, script: 0x52, flags: 0x0}, + 35: {lang: 0x248, script: 0x46, flags: 0x0}, + 36: {lang: 0xe6, script: 0x5, flags: 0x0}, + 37: {lang: 0x224, script: 0xd5, flags: 0x0}, + 38: {lang: 0x3a, script: 0x5, flags: 0x0}, + 39: {lang: 0x15d, script: 0x52, flags: 0x0}, + 40: {lang: 0x2b6, script: 0x4f, flags: 0x0}, + 41: {lang: 0x224, script: 0xd5, flags: 0x0}, + 42: {lang: 0x3a, script: 0x5, flags: 0x0}, + 43: {lang: 0x15d, script: 0x52, flags: 0x0}, + 44: {lang: 0x3da, script: 0x52, flags: 0x0}, + 45: {lang: 0x4ac, script: 0x1e, flags: 0x0}, + 46: {lang: 0x2fd, script: 0x1e, flags: 0x0}, + 47: {lang: 0x42f, script: 0x52, flags: 0x0}, + 48: {lang: 0x32f, script: 0x6b, flags: 0x0}, + 49: {lang: 0x211, script: 0x52, flags: 0x0}, + 50: {lang: 0x309, script: 0x1e, flags: 0x0}, + 51: {lang: 0x240, script: 0x5, flags: 0x0}, + 52: {lang: 0x527, script: 0x35, flags: 0x0}, + 53: {lang: 0x3be, script: 0x52, flags: 0x0}, + 54: {lang: 0x3a, script: 0x5, flags: 0x0}, + 55: {lang: 0x15d, script: 0x52, flags: 0x0}, + 56: {lang: 0x2eb, script: 0x52, flags: 0x0}, + 57: {lang: 0x4b2, script: 0x5, flags: 0x0}, + 58: {lang: 0x88, script: 0x20, flags: 0x0}, + 59: {lang: 0x4b2, script: 0x5, flags: 0x0}, + 60: {lang: 0x4b2, script: 0x5, flags: 0x0}, + 61: {lang: 0xbe, script: 0x20, flags: 0x0}, + 62: {lang: 0x3da, script: 0x52, flags: 0x0}, + 63: {lang: 0x7e, script: 0x1e, flags: 0x0}, + 64: {lang: 0x3e0, script: 0x1e, flags: 0x0}, + 65: {lang: 0x265, script: 0x52, flags: 0x0}, + 66: {lang: 0x442, script: 0x52, flags: 0x0}, + 67: {lang: 0x510, script: 0x37, flags: 0x0}, + 68: {lang: 0x410, script: 0x52, flags: 0x0}, + 69: {lang: 0x4ac, script: 0x1e, flags: 0x0}, + 70: {lang: 0x3a, script: 0x5, flags: 0x0}, + 71: {lang: 0x15d, script: 0x52, flags: 0x0}, + 72: {lang: 0x15d, script: 0x52, flags: 0x0}, + 73: {lang: 0x35, script: 0x5, flags: 0x0}, + 74: {lang: 0x469, script: 0xd5, flags: 0x0}, + 75: {lang: 0x2ea, script: 0x5, flags: 0x0}, + 76: {lang: 0x30d, script: 0x6b, flags: 0x0}, + 77: {lang: 0x465, script: 0x1e, flags: 0x0}, + 78: {lang: 0x147, script: 0x5, flags: 0x0}, + 79: {lang: 0x3a, script: 0x5, flags: 0x0}, + 80: {lang: 0x15d, script: 0x52, flags: 0x0}, + 81: {lang: 0x488, script: 0x52, flags: 0x0}, + 82: {lang: 0x58, script: 0x5, flags: 0x0}, + 83: {lang: 0x217, script: 0x1e, flags: 0x0}, + 84: {lang: 0x81, script: 0x2d, flags: 0x0}, + 85: {lang: 0x527, script: 0x35, flags: 0x0}, + 86: {lang: 0x48a, script: 0x52, flags: 0x0}, + 87: {lang: 0x4ac, script: 0x1e, flags: 0x0}, + 88: {lang: 0x510, script: 0x37, flags: 0x0}, + 89: {lang: 0x3b1, script: 0x52, flags: 0x0}, + 90: {lang: 0x42f, script: 0x52, flags: 0x0}, + 91: {lang: 0x430, script: 0x1e, flags: 0x0}, + 92: {lang: 0x15d, script: 0x52, flags: 0x0}, + 93: {lang: 0x444, script: 0x5, flags: 0x0}, } type likelyTag struct { @@ -2474,186 +3236,287 @@ type likelyTag struct { // Size: 192 bytes, 32 elements var likelyRegionGroup = [32]likelyTag{ - 1: {lang: 0x9b, region: 0xd4, script: 0x52}, - 2: {lang: 0x9b, region: 0x132, script: 0x52}, - 3: {lang: 0x1ef, region: 0x40, script: 0x52}, - 4: {lang: 0x9b, region: 0x2e, script: 0x52}, - 5: {lang: 0x9b, region: 0xd4, script: 0x52}, - 6: {lang: 0x9d, region: 0xcd, script: 0x52}, - 7: {lang: 0x248, region: 0x12d, script: 0x52}, - 8: {lang: 0x15, region: 0x6a, script: 0x5}, - 9: {lang: 0x248, region: 0x4a, script: 0x52}, - 10: {lang: 0x9b, region: 0x15e, script: 0x52}, - 11: {lang: 0x9b, region: 0x132, script: 0x52}, - 12: {lang: 0x9b, region: 0x132, script: 0x52}, - 13: {lang: 0x9d, region: 0x58, script: 0x52}, - 14: {lang: 0x2c4, region: 0x52, script: 0x34}, - 15: {lang: 0xe1, region: 0x97, script: 0x20}, - 16: {lang: 0xf8, region: 0x93, script: 0x52}, - 17: {lang: 0x103, region: 0x9c, script: 0x52}, - 18: {lang: 0x9b, region: 0x2e, script: 0x52}, - 19: {lang: 0x9b, region: 0xe4, script: 0x52}, - 20: {lang: 0x9b, region: 0x88, script: 0x52}, - 21: {lang: 0x22f, region: 0x13f, script: 0x52}, - 22: {lang: 0x2c4, region: 0x52, script: 0x34}, - 23: {lang: 0x28d, region: 0x134, script: 0x52}, - 24: {lang: 0x15, region: 0x106, script: 0x5}, - 25: {lang: 0x207, region: 0x104, script: 0x1e}, - 26: {lang: 0x207, region: 0x104, script: 0x1e}, - 27: {lang: 0x9b, region: 0x79, script: 0x52}, - 28: {lang: 0x85, region: 0x5f, script: 0x52}, - 29: {lang: 0x9d, region: 0x1e, script: 0x52}, - 30: {lang: 0x9b, region: 0x98, script: 0x52}, - 31: {lang: 0x9b, region: 0x79, script: 0x52}, + 1: {lang: 0x138, region: 0xd5, script: 0x52}, + 2: {lang: 0x138, region: 0x134, script: 0x52}, + 3: {lang: 0x3be, region: 0x40, script: 0x52}, + 4: {lang: 0x138, region: 0x2e, script: 0x52}, + 5: {lang: 0x138, region: 0xd5, script: 0x52}, + 6: {lang: 0x13d, region: 0xce, script: 0x52}, + 7: {lang: 0x443, region: 0x12e, script: 0x52}, + 8: {lang: 0x3a, region: 0x6a, script: 0x5}, + 9: {lang: 0x443, region: 0x4a, script: 0x52}, + 10: {lang: 0x138, region: 0x160, script: 0x52}, + 11: {lang: 0x138, region: 0x134, script: 0x52}, + 12: {lang: 0x138, region: 0x134, script: 0x52}, + 13: {lang: 0x13d, region: 0x58, script: 0x52}, + 14: {lang: 0x527, region: 0x52, script: 0x34}, + 15: {lang: 0x1bc, region: 0x98, script: 0x20}, + 16: {lang: 0x1df, region: 0x94, script: 0x52}, + 17: {lang: 0x1f7, region: 0x9d, script: 0x52}, + 18: {lang: 0x138, region: 0x2e, script: 0x52}, + 19: {lang: 0x138, region: 0xe5, script: 0x52}, + 20: {lang: 0x138, region: 0x89, script: 0x52}, + 21: {lang: 0x419, region: 0x141, script: 0x52}, + 22: {lang: 0x527, region: 0x52, script: 0x34}, + 23: {lang: 0x4ba, region: 0x136, script: 0x52}, + 24: {lang: 0x3a, region: 0x107, script: 0x5}, + 25: {lang: 0x3e0, region: 0x105, script: 0x1e}, + 26: {lang: 0x3e0, region: 0x105, script: 0x1e}, + 27: {lang: 0x138, region: 0x7a, script: 0x52}, + 28: {lang: 0x10c, region: 0x5f, script: 0x52}, + 29: {lang: 0x13d, region: 0x1e, script: 0x52}, + 30: {lang: 0x138, region: 0x99, script: 0x52}, + 31: {lang: 0x138, region: 0x7a, script: 0x52}, +} + +// Size: 357 bytes, 357 elements +var regionToGroups = [357]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04, 0x04, + // Entry 40 - 7F + 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, 0x00, + 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + // Entry 80 - BF + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x01, + // Entry C0 - FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, 0x04, + 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x08, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, 0x00, + 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, 0x00, + // Entry 140 - 17F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, } type mutualIntelligibility struct { - want uint16 - have uint16 - conf uint8 - oneway bool + want uint16 + have uint16 + distance uint8 + oneway bool } type scriptIntelligibility struct { - lang uint16 - want uint8 - have uint8 - conf uint8 + wantLang uint16 + haveLang uint16 + wantScript uint8 + haveScript uint8 + distance uint8 +} + +type regionIntelligibility struct { + lang uint16 + script uint8 + group uint8 + distance uint8 } // matchLang holds pairs of langIDs of base languages that are typically // mutually intelligible. Each pair is associated with a confidence and // whether the intelligibility goes one or both ways. -// Size: 708 bytes, 118 elements -var matchLang = [118]mutualIntelligibility{ - 0: {want: 0x1c1, have: 0x1af, conf: 0x2, oneway: false}, - 1: {want: 0x145, have: 0x6f, conf: 0x2, oneway: false}, - 2: {want: 0xee, have: 0x54, conf: 0x2, oneway: false}, - 3: {want: 0x225, have: 0x54, conf: 0x2, oneway: false}, - 4: {want: 0x23b, have: 0x54, conf: 0x2, oneway: false}, - 5: {want: 0x225, have: 0xee, conf: 0x2, oneway: false}, - 6: {want: 0x23b, have: 0xee, conf: 0x2, oneway: false}, - 7: {want: 0x225, have: 0x23b, conf: 0x2, oneway: false}, - 8: {want: 0x241, have: 0x1, conf: 0x2, oneway: false}, - 9: {want: 0xd2, have: 0x85, conf: 0x2, oneway: true}, - 10: {want: 0x154, have: 0x85, conf: 0x2, oneway: true}, - 11: {want: 0x80, have: 0x1c1, conf: 0x2, oneway: false}, - 12: {want: 0x80, have: 0x1af, conf: 0x2, oneway: false}, - 13: {want: 0x6f, have: 0x145, conf: 0x2, oneway: false}, - 14: {want: 0x2, have: 0x207, conf: 0x2, oneway: true}, - 15: {want: 0x5, have: 0x9b, conf: 0x2, oneway: true}, - 16: {want: 0xa, have: 0x1bd, conf: 0x2, oneway: true}, - 17: {want: 0xd, have: 0x9b, conf: 0x2, oneway: true}, - 18: {want: 0x23, have: 0x9d, conf: 0x2, oneway: true}, - 19: {want: 0x24, have: 0x207, conf: 0x2, oneway: true}, - 20: {want: 0x2f, have: 0x207, conf: 0x2, oneway: true}, - 21: {want: 0x31, have: 0x9b, conf: 0x2, oneway: true}, - 22: {want: 0x3c, have: 0xe1, conf: 0x2, oneway: true}, - 23: {want: 0x4b, have: 0x9b, conf: 0x2, oneway: true}, - 24: {want: 0x50, have: 0xaf, conf: 0x2, oneway: true}, - 25: {want: 0x65, have: 0xaa, conf: 0x2, oneway: true}, - 26: {want: 0x6c, have: 0x9b, conf: 0x2, oneway: true}, - 27: {want: 0x6f, have: 0x15, conf: 0x2, oneway: true}, - 28: {want: 0x70, have: 0xaf, conf: 0x2, oneway: true}, - 29: {want: 0x78, have: 0xaf, conf: 0x2, oneway: true}, - 30: {want: 0x7f, have: 0x9b, conf: 0x2, oneway: true}, - 31: {want: 0x95, have: 0x9b, conf: 0x2, oneway: true}, - 32: {want: 0x9c, have: 0x9b, conf: 0x2, oneway: true}, - 33: {want: 0x9f, have: 0xa8, conf: 0x2, oneway: true}, - 34: {want: 0xa1, have: 0x9d, conf: 0x2, oneway: true}, - 35: {want: 0xad, have: 0x80, conf: 0x2, oneway: true}, - 36: {want: 0xb9, have: 0x1bd, conf: 0x2, oneway: true}, - 37: {want: 0xba, have: 0x9b, conf: 0x2, oneway: true}, - 38: {want: 0xbb, have: 0x9b, conf: 0x2, oneway: true}, - 39: {want: 0xc2, have: 0x9b, conf: 0x2, oneway: true}, - 40: {want: 0xc8, have: 0x9d, conf: 0x2, oneway: true}, - 41: {want: 0xca, have: 0x9d, conf: 0x2, oneway: true}, - 42: {want: 0xd3, have: 0xe1, conf: 0x2, oneway: true}, - 43: {want: 0xdc, have: 0x9b, conf: 0x2, oneway: true}, - 44: {want: 0xde, have: 0x9b, conf: 0x2, oneway: true}, - 45: {want: 0xf1, have: 0xaf, conf: 0x2, oneway: true}, - 46: {want: 0xf3, have: 0x207, conf: 0x2, oneway: true}, - 47: {want: 0xf5, have: 0x9b, conf: 0x2, oneway: true}, - 48: {want: 0xfa, have: 0x9b, conf: 0x2, oneway: true}, - 49: {want: 0x102, have: 0x9b, conf: 0x2, oneway: true}, - 50: {want: 0x10f, have: 0xf8, conf: 0x2, oneway: true}, - 51: {want: 0x111, have: 0x9b, conf: 0x2, oneway: true}, - 52: {want: 0x122, have: 0xaf, conf: 0x2, oneway: true}, - 53: {want: 0x12f, have: 0x207, conf: 0x2, oneway: true}, - 54: {want: 0x133, have: 0x9b, conf: 0x2, oneway: true}, - 55: {want: 0x135, have: 0x9b, conf: 0x2, oneway: true}, - 56: {want: 0x13d, have: 0x9b, conf: 0x2, oneway: true}, - 57: {want: 0x145, have: 0x26f, conf: 0x2, oneway: true}, - 58: {want: 0x14d, have: 0x207, conf: 0x2, oneway: true}, - 59: {want: 0x14e, have: 0x103, conf: 0x2, oneway: true}, - 60: {want: 0x15a, have: 0x9b, conf: 0x2, oneway: true}, - 61: {want: 0x164, have: 0xaf, conf: 0x2, oneway: true}, - 62: {want: 0x165, have: 0x9b, conf: 0x2, oneway: true}, - 63: {want: 0x167, have: 0x9b, conf: 0x2, oneway: true}, - 64: {want: 0x16c, have: 0xaf, conf: 0x2, oneway: true}, - 65: {want: 0x182, have: 0x9b, conf: 0x2, oneway: true}, - 66: {want: 0x183, have: 0xaf, conf: 0x2, oneway: true}, - 67: {want: 0x189, have: 0x9b, conf: 0x2, oneway: true}, - 68: {want: 0x18c, have: 0x38, conf: 0x2, oneway: true}, - 69: {want: 0x18d, have: 0x9b, conf: 0x2, oneway: true}, - 70: {want: 0x18f, have: 0x207, conf: 0x2, oneway: true}, - 71: {want: 0x196, have: 0xe1, conf: 0x2, oneway: true}, - 72: {want: 0x19a, have: 0xf8, conf: 0x2, oneway: true}, - 73: {want: 0x19b, have: 0x9b, conf: 0x2, oneway: true}, - 74: {want: 0x1a5, have: 0x9b, conf: 0x2, oneway: true}, - 75: {want: 0x1b4, have: 0x9b, conf: 0x2, oneway: true}, - 76: {want: 0x1bf, have: 0x1af, conf: 0x2, oneway: false}, - 77: {want: 0x1bf, have: 0x1c1, conf: 0x2, oneway: true}, - 78: {want: 0x1c8, have: 0x9b, conf: 0x2, oneway: true}, - 79: {want: 0x1cc, have: 0x9b, conf: 0x2, oneway: true}, - 80: {want: 0x1ce, have: 0x9b, conf: 0x2, oneway: true}, - 81: {want: 0x1d0, have: 0xaf, conf: 0x2, oneway: true}, - 82: {want: 0x1d2, have: 0x9b, conf: 0x2, oneway: true}, - 83: {want: 0x1d3, have: 0x9b, conf: 0x2, oneway: true}, - 84: {want: 0x1d7, have: 0x9b, conf: 0x2, oneway: true}, - 85: {want: 0x1de, have: 0x9b, conf: 0x2, oneway: true}, - 86: {want: 0x1ee, have: 0x9b, conf: 0x2, oneway: true}, - 87: {want: 0x1f1, have: 0x9d, conf: 0x2, oneway: true}, - 88: {want: 0x1fc, have: 0x85, conf: 0x2, oneway: true}, - 89: {want: 0x201, have: 0x9b, conf: 0x2, oneway: true}, - 90: {want: 0x20a, have: 0xaf, conf: 0x2, oneway: true}, - 91: {want: 0x20d, have: 0xe1, conf: 0x2, oneway: true}, - 92: {want: 0x21a, have: 0x9b, conf: 0x2, oneway: true}, - 93: {want: 0x228, have: 0x9b, conf: 0x2, oneway: true}, - 94: {want: 0x236, have: 0x9b, conf: 0x2, oneway: true}, - 95: {want: 0x238, have: 0x9b, conf: 0x2, oneway: true}, - 96: {want: 0x23a, have: 0x9b, conf: 0x2, oneway: true}, - 97: {want: 0x242, have: 0x9b, conf: 0x2, oneway: true}, - 98: {want: 0x244, have: 0xf8, conf: 0x2, oneway: true}, - 99: {want: 0x248, have: 0x9b, conf: 0x2, oneway: true}, - 100: {want: 0x251, have: 0x9b, conf: 0x2, oneway: true}, - 101: {want: 0x258, have: 0x9b, conf: 0x2, oneway: true}, - 102: {want: 0x25c, have: 0x207, conf: 0x2, oneway: true}, - 103: {want: 0x261, have: 0x9b, conf: 0x2, oneway: true}, - 104: {want: 0x264, have: 0x207, conf: 0x2, oneway: true}, - 105: {want: 0x361a, have: 0x9b, conf: 0x2, oneway: true}, - 106: {want: 0x26b, have: 0x9b, conf: 0x2, oneway: true}, - 107: {want: 0x26c, have: 0x9b, conf: 0x2, oneway: true}, - 108: {want: 0x277, have: 0x207, conf: 0x2, oneway: true}, - 109: {want: 0x27b, have: 0x9b, conf: 0x2, oneway: true}, - 110: {want: 0x284, have: 0x2c4, conf: 0x2, oneway: true}, - 111: {want: 0x28c, have: 0x9b, conf: 0x2, oneway: true}, - 112: {want: 0x28d, have: 0x207, conf: 0x2, oneway: true}, - 113: {want: 0x2a4, have: 0xaf, conf: 0x2, oneway: true}, - 114: {want: 0x2a9, have: 0x9b, conf: 0x2, oneway: true}, - 115: {want: 0x2b9, have: 0x9b, conf: 0x2, oneway: true}, - 116: {want: 0x2ba, have: 0x9b, conf: 0x2, oneway: true}, - 117: {want: 0x2c6, have: 0x9b, conf: 0x2, oneway: true}, +// Size: 690 bytes, 115 elements +var matchLang = [115]mutualIntelligibility{ + 0: {want: 0x1cf, have: 0xb7, distance: 0x4, oneway: false}, + 1: {want: 0x405, have: 0xb7, distance: 0x4, oneway: false}, + 2: {want: 0x405, have: 0x1cf, distance: 0x4, oneway: false}, + 3: {want: 0x405, have: 0x430, distance: 0x4, oneway: false}, + 4: {want: 0x438, have: 0x1, distance: 0x4, oneway: false}, + 5: {want: 0x1a1, have: 0x10c, distance: 0x4, oneway: true}, + 6: {want: 0x293, have: 0x10c, distance: 0x4, oneway: true}, + 7: {want: 0x430, have: 0x1cf, distance: 0x5, oneway: false}, + 8: {want: 0x430, have: 0xb7, distance: 0x5, oneway: false}, + 9: {want: 0x100, have: 0x36d, distance: 0x8, oneway: false}, + 10: {want: 0x100, have: 0x345, distance: 0x8, oneway: false}, + 11: {want: 0x5, have: 0x3e0, distance: 0xa, oneway: true}, + 12: {want: 0xd, have: 0x138, distance: 0xa, oneway: true}, + 13: {want: 0x16, have: 0x365, distance: 0xa, oneway: true}, + 14: {want: 0x21, have: 0x138, distance: 0xa, oneway: true}, + 15: {want: 0x56, have: 0x13d, distance: 0xa, oneway: true}, + 16: {want: 0x58, have: 0x3e0, distance: 0xa, oneway: true}, + 17: {want: 0x71, have: 0x3e0, distance: 0xa, oneway: true}, + 18: {want: 0x75, have: 0x138, distance: 0xa, oneway: true}, + 19: {want: 0x82, have: 0x1bc, distance: 0xa, oneway: true}, + 20: {want: 0xa5, have: 0x138, distance: 0xa, oneway: true}, + 21: {want: 0xb2, have: 0x15d, distance: 0xa, oneway: true}, + 22: {want: 0xdd, have: 0x152, distance: 0xa, oneway: true}, + 23: {want: 0xe5, have: 0x138, distance: 0xa, oneway: true}, + 24: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true}, + 25: {want: 0xef, have: 0x15d, distance: 0xa, oneway: true}, + 26: {want: 0xf8, have: 0x15d, distance: 0xa, oneway: true}, + 27: {want: 0xff, have: 0x138, distance: 0xa, oneway: true}, + 28: {want: 0x12f, have: 0x138, distance: 0xa, oneway: true}, + 29: {want: 0x13b, have: 0x138, distance: 0xa, oneway: true}, + 30: {want: 0x13f, have: 0x150, distance: 0xa, oneway: true}, + 31: {want: 0x144, have: 0x13d, distance: 0xa, oneway: true}, + 32: {want: 0x157, have: 0x100, distance: 0xa, oneway: true}, + 33: {want: 0x16c, have: 0x365, distance: 0xa, oneway: true}, + 34: {want: 0x16d, have: 0x138, distance: 0xa, oneway: true}, + 35: {want: 0x16e, have: 0x138, distance: 0xa, oneway: true}, + 36: {want: 0x17c, have: 0x138, distance: 0xa, oneway: true}, + 37: {want: 0x18e, have: 0x13d, distance: 0xa, oneway: true}, + 38: {want: 0x192, have: 0x13d, distance: 0xa, oneway: true}, + 39: {want: 0x1a2, have: 0x1bc, distance: 0xa, oneway: true}, + 40: {want: 0x1b2, have: 0x138, distance: 0xa, oneway: true}, + 41: {want: 0x1b6, have: 0x138, distance: 0xa, oneway: true}, + 42: {want: 0x1d2, have: 0x15d, distance: 0xa, oneway: true}, + 43: {want: 0x1d5, have: 0x3e0, distance: 0xa, oneway: true}, + 44: {want: 0x1d7, have: 0x138, distance: 0xa, oneway: true}, + 45: {want: 0x1e5, have: 0x138, distance: 0xa, oneway: true}, + 46: {want: 0x1f6, have: 0x138, distance: 0xa, oneway: true}, + 47: {want: 0x20c, have: 0x1df, distance: 0xa, oneway: true}, + 48: {want: 0x20e, have: 0x138, distance: 0xa, oneway: true}, + 49: {want: 0x22b, have: 0x15d, distance: 0xa, oneway: true}, + 50: {want: 0x240, have: 0x3e0, distance: 0xa, oneway: true}, + 51: {want: 0x248, have: 0x138, distance: 0xa, oneway: true}, + 52: {want: 0x24f, have: 0x138, distance: 0xa, oneway: true}, + 53: {want: 0x263, have: 0x138, distance: 0xa, oneway: true}, + 54: {want: 0x272, have: 0x488, distance: 0xa, oneway: true}, + 55: {want: 0x288, have: 0x3e0, distance: 0xa, oneway: true}, + 56: {want: 0x28c, have: 0x1f7, distance: 0xa, oneway: true}, + 57: {want: 0x2a1, have: 0x138, distance: 0xa, oneway: true}, + 58: {want: 0x2b3, have: 0x15d, distance: 0xa, oneway: true}, + 59: {want: 0x2b6, have: 0x138, distance: 0xa, oneway: true}, + 60: {want: 0x2bc, have: 0x138, distance: 0xa, oneway: true}, + 61: {want: 0x2c1, have: 0x15d, distance: 0xa, oneway: true}, + 62: {want: 0x2eb, have: 0x138, distance: 0xa, oneway: true}, + 63: {want: 0x2ef, have: 0x15d, distance: 0xa, oneway: true}, + 64: {want: 0x2f8, have: 0x138, distance: 0xa, oneway: true}, + 65: {want: 0x2fd, have: 0x7e, distance: 0xa, oneway: true}, + 66: {want: 0x302, have: 0x138, distance: 0xa, oneway: true}, + 67: {want: 0x309, have: 0x3e0, distance: 0xa, oneway: true}, + 68: {want: 0x319, have: 0x1bc, distance: 0xa, oneway: true}, + 69: {want: 0x31d, have: 0x1df, distance: 0xa, oneway: true}, + 70: {want: 0x31e, have: 0x138, distance: 0xa, oneway: true}, + 71: {want: 0x32f, have: 0x138, distance: 0xa, oneway: true}, + 72: {want: 0x34f, have: 0x138, distance: 0xa, oneway: true}, + 73: {want: 0x368, have: 0x345, distance: 0xa, oneway: false}, + 74: {want: 0x368, have: 0x36d, distance: 0xa, oneway: true}, + 75: {want: 0x378, have: 0x138, distance: 0xa, oneway: true}, + 76: {want: 0x385, have: 0x138, distance: 0xa, oneway: true}, + 77: {want: 0x387, have: 0x138, distance: 0xa, oneway: true}, + 78: {want: 0x389, have: 0x15d, distance: 0xa, oneway: true}, + 79: {want: 0x38e, have: 0x138, distance: 0xa, oneway: true}, + 80: {want: 0x393, have: 0x138, distance: 0xa, oneway: true}, + 81: {want: 0x39b, have: 0x138, distance: 0xa, oneway: true}, + 82: {want: 0x3a3, have: 0x138, distance: 0xa, oneway: true}, + 83: {want: 0x3bc, have: 0x138, distance: 0xa, oneway: true}, + 84: {want: 0x3c2, have: 0x13d, distance: 0xa, oneway: true}, + 85: {want: 0x3d2, have: 0x10c, distance: 0xa, oneway: true}, + 86: {want: 0x3d7, have: 0x138, distance: 0xa, oneway: true}, + 87: {want: 0x3e3, have: 0x15d, distance: 0xa, oneway: true}, + 88: {want: 0x3e7, have: 0x1bc, distance: 0xa, oneway: true}, + 89: {want: 0x3f8, have: 0x138, distance: 0xa, oneway: true}, + 90: {want: 0x40a, have: 0x138, distance: 0xa, oneway: true}, + 91: {want: 0x421, have: 0x138, distance: 0xa, oneway: true}, + 92: {want: 0x427, have: 0x138, distance: 0xa, oneway: true}, + 93: {want: 0x42f, have: 0x138, distance: 0xa, oneway: true}, + 94: {want: 0x439, have: 0x138, distance: 0xa, oneway: true}, + 95: {want: 0x43c, have: 0x1df, distance: 0xa, oneway: true}, + 96: {want: 0x443, have: 0x138, distance: 0xa, oneway: true}, + 97: {want: 0x44e, have: 0x138, distance: 0xa, oneway: true}, + 98: {want: 0x45f, have: 0x138, distance: 0xa, oneway: true}, + 99: {want: 0x465, have: 0x3e0, distance: 0xa, oneway: true}, + 100: {want: 0x46d, have: 0x138, distance: 0xa, oneway: true}, + 101: {want: 0x474, have: 0x3e0, distance: 0xa, oneway: true}, + 102: {want: 0x3880, have: 0x138, distance: 0xa, oneway: true}, + 103: {want: 0x47e, have: 0x138, distance: 0xa, oneway: true}, + 104: {want: 0x480, have: 0x138, distance: 0xa, oneway: true}, + 105: {want: 0x492, have: 0x3e0, distance: 0xa, oneway: true}, + 106: {want: 0x49b, have: 0x138, distance: 0xa, oneway: true}, + 107: {want: 0x4aa, have: 0x527, distance: 0xa, oneway: true}, + 108: {want: 0x4b2, have: 0x138, distance: 0xa, oneway: true}, + 109: {want: 0x4ba, have: 0x3e0, distance: 0xa, oneway: true}, + 110: {want: 0x4e3, have: 0x15d, distance: 0xa, oneway: true}, + 111: {want: 0x4f0, have: 0x138, distance: 0xa, oneway: true}, + 112: {want: 0x510, have: 0x138, distance: 0xa, oneway: true}, + 113: {want: 0x516, have: 0x138, distance: 0xa, oneway: true}, + 114: {want: 0x52c, have: 0x138, distance: 0xa, oneway: true}, } // matchScript holds pairs of scriptIDs where readers of one script // can typically also read the other. Each is associated with a confidence. -// Size: 24 bytes, 4 elements -var matchScript = [4]scriptIntelligibility{ - 0: {lang: 0x23b, want: 0x52, have: 0x1e, conf: 0x2}, - 1: {lang: 0x23b, want: 0x1e, have: 0x52, conf: 0x2}, - 2: {lang: 0x0, want: 0x34, have: 0x35, conf: 0x1}, - 3: {lang: 0x0, want: 0x35, have: 0x34, conf: 0x1}, +// Size: 208 bytes, 26 elements +var matchScript = [26]scriptIntelligibility{ + 0: {wantLang: 0x430, haveLang: 0x430, wantScript: 0x52, haveScript: 0x1e, distance: 0x5}, + 1: {wantLang: 0x430, haveLang: 0x430, wantScript: 0x1e, haveScript: 0x52, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e0, wantScript: 0x52, haveScript: 0x1e, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x138, wantScript: 0xe, haveScript: 0x52, distance: 0xa}, + 4: {wantLang: 0x1d5, haveLang: 0x3e0, wantScript: 0x8, haveScript: 0x1e, distance: 0xa}, + 5: {wantLang: 0x20e, haveLang: 0x138, wantScript: 0x29, haveScript: 0x52, distance: 0xa}, + 6: {wantLang: 0x248, haveLang: 0x138, wantScript: 0x46, haveScript: 0x52, distance: 0xa}, + 7: {wantLang: 0x24f, haveLang: 0x138, wantScript: 0x4a, haveScript: 0x52, distance: 0xa}, + 8: {wantLang: 0x2b6, haveLang: 0x138, wantScript: 0x4f, haveScript: 0x52, distance: 0xa}, + 9: {wantLang: 0x302, haveLang: 0x138, wantScript: 0x64, haveScript: 0x52, distance: 0xa}, + 10: {wantLang: 0x32f, haveLang: 0x138, wantScript: 0x6b, haveScript: 0x52, distance: 0xa}, + 11: {wantLang: 0x34f, haveLang: 0x138, wantScript: 0x20, haveScript: 0x52, distance: 0xa}, + 12: {wantLang: 0x393, haveLang: 0x138, wantScript: 0x75, haveScript: 0x52, distance: 0xa}, + 13: {wantLang: 0x39b, haveLang: 0x138, wantScript: 0x2f, haveScript: 0x52, distance: 0xa}, + 14: {wantLang: 0x3bc, haveLang: 0x138, wantScript: 0x5, haveScript: 0x52, distance: 0xa}, + 15: {wantLang: 0x3f8, haveLang: 0x138, wantScript: 0x5, haveScript: 0x52, distance: 0xa}, + 16: {wantLang: 0x40a, haveLang: 0x138, wantScript: 0xc1, haveScript: 0x52, distance: 0xa}, + 17: {wantLang: 0x44e, haveLang: 0x138, wantScript: 0xcd, haveScript: 0x52, distance: 0xa}, + 18: {wantLang: 0x45f, haveLang: 0x138, wantScript: 0xd0, haveScript: 0x52, distance: 0xa}, + 19: {wantLang: 0x46d, haveLang: 0x138, wantScript: 0x27, haveScript: 0x52, distance: 0xa}, + 20: {wantLang: 0x474, haveLang: 0x3e0, wantScript: 0x52, haveScript: 0x1e, distance: 0xa}, + 21: {wantLang: 0x4b2, haveLang: 0x138, wantScript: 0x5, haveScript: 0x52, distance: 0xa}, + 22: {wantLang: 0x4ba, haveLang: 0x3e0, wantScript: 0x52, haveScript: 0x1e, distance: 0xa}, + 23: {wantLang: 0x510, haveLang: 0x138, wantScript: 0x37, haveScript: 0x52, distance: 0xa}, + 24: {wantLang: 0x527, haveLang: 0x527, wantScript: 0x34, haveScript: 0x35, distance: 0xf}, + 25: {wantLang: 0x527, haveLang: 0x527, wantScript: 0x35, haveScript: 0x34, distance: 0x13}, +} + +// Size: 90 bytes, 15 elements +var matchRegion = [15]regionIntelligibility{ + 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4}, + 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4}, + 2: {lang: 0x138, script: 0x0, group: 0x1, distance: 0x4}, + 3: {lang: 0x138, script: 0x0, group: 0x81, distance: 0x4}, + 4: {lang: 0x13d, script: 0x0, group: 0x3, distance: 0x4}, + 5: {lang: 0x13d, script: 0x0, group: 0x83, distance: 0x4}, + 6: {lang: 0x3be, script: 0x0, group: 0x3, distance: 0x4}, + 7: {lang: 0x3be, script: 0x0, group: 0x83, distance: 0x4}, + 8: {lang: 0x527, script: 0x35, group: 0x2, distance: 0x4}, + 9: {lang: 0x527, script: 0x35, group: 0x82, distance: 0x4}, + 10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5}, + 11: {lang: 0x138, script: 0x0, group: 0x80, distance: 0x5}, + 12: {lang: 0x13d, script: 0x0, group: 0x80, distance: 0x5}, + 13: {lang: 0x3be, script: 0x0, group: 0x80, distance: 0x5}, + 14: {lang: 0x527, script: 0x35, group: 0x80, distance: 0x5}, } // Size: 128 bytes, 32 elements @@ -2671,8 +3534,8 @@ var regionContainment = [32]uint32{ // regionInclusion maps region identifiers to sets of regions in regionInclusionBits, // where each set holds all groupings that are directly connected in a region // containment graph. -// Size: 355 bytes, 355 elements -var regionInclusion = [355]uint8{ +// Size: 357 bytes, 357 elements +var regionInclusion = [357]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, @@ -2689,41 +3552,41 @@ var regionInclusion = [355]uint8{ 0x25, 0x2c, 0x25, 0x21, 0x36, 0x2d, 0x34, 0x29, 0x21, 0x2e, 0x37, 0x25, 0x25, 0x20, 0x38, 0x38, 0x27, 0x37, 0x38, 0x38, 0x2e, 0x39, 0x2e, 0x1f, - 0x37, 0x3a, 0x27, 0x3b, 0x2b, 0x20, 0x29, 0x34, - 0x26, 0x37, 0x25, 0x23, 0x27, 0x2b, 0x2c, 0x22, + 0x20, 0x37, 0x3a, 0x27, 0x3b, 0x2b, 0x20, 0x29, + 0x34, 0x26, 0x37, 0x25, 0x23, 0x27, 0x2b, 0x2c, // Entry 80 - BF - 0x2f, 0x2c, 0x2c, 0x25, 0x26, 0x39, 0x21, 0x33, - 0x3b, 0x2c, 0x27, 0x35, 0x21, 0x33, 0x39, 0x25, - 0x2d, 0x20, 0x38, 0x30, 0x37, 0x23, 0x2b, 0x24, - 0x21, 0x23, 0x24, 0x2b, 0x39, 0x2b, 0x25, 0x23, - 0x35, 0x20, 0x2e, 0x3c, 0x30, 0x3b, 0x2e, 0x25, - 0x35, 0x35, 0x23, 0x25, 0x3c, 0x30, 0x23, 0x25, - 0x34, 0x24, 0x2c, 0x31, 0x37, 0x29, 0x37, 0x38, - 0x38, 0x34, 0x32, 0x22, 0x25, 0x2e, 0x3b, 0x20, + 0x22, 0x2f, 0x2c, 0x2c, 0x25, 0x26, 0x39, 0x21, + 0x33, 0x3b, 0x2c, 0x27, 0x35, 0x21, 0x33, 0x39, + 0x25, 0x2d, 0x20, 0x38, 0x30, 0x37, 0x23, 0x2b, + 0x24, 0x21, 0x23, 0x24, 0x2b, 0x39, 0x2b, 0x25, + 0x23, 0x35, 0x20, 0x2e, 0x3c, 0x30, 0x3b, 0x2e, + 0x25, 0x35, 0x35, 0x23, 0x25, 0x3c, 0x30, 0x23, + 0x25, 0x34, 0x24, 0x2c, 0x31, 0x37, 0x29, 0x37, + 0x38, 0x38, 0x34, 0x32, 0x22, 0x25, 0x2e, 0x3b, // Entry C0 - FF - 0x22, 0x2c, 0x30, 0x35, 0x35, 0x3b, 0x25, 0x2c, - 0x25, 0x39, 0x2e, 0x24, 0x2e, 0x33, 0x30, 0x2e, - 0x31, 0x3a, 0x2c, 0x2a, 0x2c, 0x20, 0x33, 0x29, - 0x2b, 0x24, 0x20, 0x3b, 0x23, 0x28, 0x2a, 0x23, - 0x33, 0x20, 0x27, 0x28, 0x3a, 0x30, 0x24, 0x2d, - 0x2f, 0x28, 0x25, 0x23, 0x39, 0x20, 0x3b, 0x27, - 0x20, 0x23, 0x20, 0x20, 0x1e, 0x20, 0x20, 0x20, + 0x20, 0x22, 0x2c, 0x30, 0x35, 0x35, 0x3b, 0x25, + 0x2c, 0x25, 0x39, 0x2e, 0x24, 0x2e, 0x33, 0x30, + 0x2e, 0x31, 0x3a, 0x2c, 0x2a, 0x2c, 0x20, 0x33, + 0x29, 0x2b, 0x24, 0x20, 0x3b, 0x23, 0x28, 0x2a, + 0x23, 0x33, 0x20, 0x27, 0x28, 0x3a, 0x30, 0x24, + 0x2d, 0x2f, 0x28, 0x25, 0x23, 0x39, 0x20, 0x3b, + 0x27, 0x20, 0x23, 0x20, 0x20, 0x1e, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, // Entry 100 - 13F - 0x2e, 0x20, 0x2d, 0x22, 0x32, 0x2e, 0x23, 0x3a, - 0x2e, 0x38, 0x37, 0x30, 0x2c, 0x39, 0x2b, 0x2d, - 0x2c, 0x22, 0x2c, 0x2e, 0x27, 0x2e, 0x26, 0x32, - 0x33, 0x25, 0x23, 0x31, 0x21, 0x25, 0x26, 0x21, - 0x2c, 0x30, 0x3c, 0x28, 0x30, 0x3c, 0x38, 0x28, - 0x30, 0x23, 0x25, 0x28, 0x35, 0x2e, 0x32, 0x2e, - 0x20, 0x21, 0x2f, 0x27, 0x3c, 0x22, 0x25, 0x20, - 0x27, 0x25, 0x25, 0x30, 0x3a, 0x28, 0x20, 0x28, + 0x20, 0x2e, 0x20, 0x2d, 0x22, 0x32, 0x2e, 0x23, + 0x3a, 0x2e, 0x38, 0x37, 0x30, 0x2c, 0x39, 0x2b, + 0x2d, 0x2c, 0x22, 0x2c, 0x2e, 0x27, 0x2e, 0x26, + 0x32, 0x33, 0x25, 0x23, 0x31, 0x21, 0x25, 0x26, + 0x21, 0x2c, 0x30, 0x3c, 0x28, 0x30, 0x3c, 0x38, + 0x28, 0x30, 0x23, 0x25, 0x28, 0x35, 0x2e, 0x32, + 0x2e, 0x20, 0x21, 0x20, 0x2f, 0x27, 0x3c, 0x22, + 0x25, 0x20, 0x27, 0x25, 0x25, 0x30, 0x3a, 0x28, // Entry 140 - 17F + 0x20, 0x28, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, + 0x20, 0x20, 0x20, 0x20, 0x22, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, - 0x20, 0x20, 0x22, 0x20, 0x20, 0x20, 0x20, 0x20, - 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, - 0x20, 0x20, 0x23, 0x23, 0x2e, 0x22, 0x31, 0x2e, - 0x26, 0x2e, 0x20, + 0x20, 0x20, 0x20, 0x20, 0x23, 0x23, 0x2e, 0x22, + 0x31, 0x2e, 0x26, 0x2e, 0x20, } // regionInclusionBits is an array of bit vectors where every vector represents @@ -2779,13 +3642,13 @@ type parentRel struct { fromRegion []uint16 } -// Size: 412 bytes, 5 elements +// Size: 414 bytes, 5 elements var parents = [5]parentRel{ - 0: {lang: 0x9b, script: 0x0, maxScript: 0x52, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x24, 0x25, 0x2e, 0x33, 0x35, 0x3c, 0x41, 0x45, 0x47, 0x48, 0x49, 0x4f, 0x51, 0x5b, 0x5c, 0x60, 0x63, 0x6c, 0x71, 0x72, 0x73, 0x79, 0x7a, 0x7d, 0x7e, 0x7f, 0x81, 0x8a, 0x8b, 0x94, 0x95, 0x96, 0x97, 0x98, 0x9d, 0x9e, 0xa2, 0xa5, 0xa7, 0xab, 0xaf, 0xb2, 0xb3, 0xbd, 0xc4, 0xc8, 0xc9, 0xca, 0xcc, 0xce, 0xd0, 0xd3, 0xd4, 0xdb, 0xdd, 0xde, 0xe4, 0xe5, 0xe6, 0xe9, 0xee, 0x105, 0x107, 0x108, 0x109, 0x10b, 0x10c, 0x110, 0x115, 0x119, 0x11b, 0x11d, 0x123, 0x127, 0x12a, 0x12b, 0x12d, 0x12f, 0x136, 0x139, 0x13c, 0x13f, 0x15e, 0x15f, 0x161}}, - 1: {lang: 0x9b, script: 0x0, maxScript: 0x52, toRegion: 0x1a, fromRegion: []uint16{0x2d, 0x4d, 0x5f, 0x62, 0x70, 0xd7, 0x10a, 0x10d}}, - 2: {lang: 0x9d, script: 0x0, maxScript: 0x52, toRegion: 0x1e, fromRegion: []uint16{0x2b, 0x3e, 0x40, 0x50, 0x53, 0x55, 0x58, 0x64, 0x68, 0x87, 0x8d, 0xcd, 0xd6, 0xe0, 0xe2, 0xea, 0xef, 0x118, 0x132, 0x133, 0x138}}, - 3: {lang: 0x1ef, script: 0x0, maxScript: 0x52, toRegion: 0xec, fromRegion: []uint16{0x29, 0x4d, 0x59, 0x84, 0x89, 0xb5, 0xc4, 0xcf, 0x116, 0x124}}, - 4: {lang: 0x2c4, script: 0x35, maxScript: 0x35, toRegion: 0x8b, fromRegion: []uint16{0xc4}}, + 0: {lang: 0x138, script: 0x0, maxScript: 0x52, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x24, 0x25, 0x2e, 0x33, 0x35, 0x3c, 0x41, 0x45, 0x47, 0x48, 0x49, 0x4f, 0x51, 0x5b, 0x5c, 0x60, 0x63, 0x6c, 0x72, 0x73, 0x74, 0x7a, 0x7b, 0x7e, 0x7f, 0x80, 0x82, 0x8b, 0x8c, 0x95, 0x96, 0x97, 0x98, 0x99, 0x9e, 0x9f, 0xa3, 0xa6, 0xa8, 0xac, 0xb0, 0xb3, 0xb4, 0xbe, 0xc5, 0xc9, 0xca, 0xcb, 0xcd, 0xcf, 0xd1, 0xd4, 0xd5, 0xdc, 0xde, 0xdf, 0xe5, 0xe6, 0xe7, 0xea, 0xef, 0x106, 0x108, 0x109, 0x10a, 0x10c, 0x10d, 0x111, 0x116, 0x11a, 0x11c, 0x11e, 0x124, 0x128, 0x12b, 0x12c, 0x12e, 0x130, 0x138, 0x13b, 0x13e, 0x141, 0x160, 0x161, 0x163}}, + 1: {lang: 0x138, script: 0x0, maxScript: 0x52, toRegion: 0x1a, fromRegion: []uint16{0x2d, 0x4d, 0x5f, 0x62, 0x71, 0xd8, 0x10b, 0x10e}}, + 2: {lang: 0x13d, script: 0x0, maxScript: 0x52, toRegion: 0x1e, fromRegion: []uint16{0x2b, 0x3e, 0x40, 0x47, 0x50, 0x53, 0x55, 0x58, 0x64, 0x68, 0x88, 0x8e, 0xce, 0xd7, 0xe1, 0xe3, 0xeb, 0xf0, 0x119, 0x134, 0x135, 0x13a}}, + 3: {lang: 0x3be, script: 0x0, maxScript: 0x52, toRegion: 0xed, fromRegion: []uint16{0x29, 0x4d, 0x59, 0x85, 0x8a, 0xb6, 0xc5, 0xd0, 0x117, 0x125}}, + 4: {lang: 0x527, script: 0x35, maxScript: 0x35, toRegion: 0x8c, fromRegion: []uint16{0xc5}}, } -// Total table size 20315 bytes (19KiB); checksum: C16EF251 +// Total table size 26496 bytes (25KiB); checksum: 6E24B15A diff --git a/vendor/golang.org/x/text/runes/cond.go b/vendor/golang.org/x/text/runes/cond.go index ae7a921..df7aa02 100644 --- a/vendor/golang.org/x/text/runes/cond.go +++ b/vendor/golang.org/x/text/runes/cond.go @@ -41,20 +41,35 @@ func If(s Set, tIn, tNotIn transform.Transformer) Transformer { if tNotIn == nil { tNotIn = transform.Nop } + sIn, ok := tIn.(transform.SpanningTransformer) + if !ok { + sIn = dummySpan{tIn} + } + sNotIn, ok := tNotIn.(transform.SpanningTransformer) + if !ok { + sNotIn = dummySpan{tNotIn} + } + a := &cond{ - tIn: tIn, - tNotIn: tNotIn, + tIn: sIn, + tNotIn: sNotIn, f: s.Contains, } a.Reset() return Transformer{a} } +type dummySpan struct{ transform.Transformer } + +func (d dummySpan) Span(src []byte, atEOF bool) (n int, err error) { + return 0, transform.ErrEndOfSpan +} + type cond struct { - tIn, tNotIn transform.Transformer + tIn, tNotIn transform.SpanningTransformer f func(rune) bool - check func(rune) bool // current check to perform - t transform.Transformer // current transformer to use + check func(rune) bool // current check to perform + t transform.SpanningTransformer // current transformer to use } // Reset implements transform.Transformer. @@ -84,6 +99,51 @@ func (t *cond) isNot(r rune) bool { return false } +// This implementation of Span doesn't help all too much, but it needs to be +// there to satisfy this package's Transformer interface. +// TODO: there are certainly room for improvements, though. For example, if +// t.t == transform.Nop (which will a common occurrence) it will save a bundle +// to special-case that loop. +func (t *cond) Span(src []byte, atEOF bool) (n int, err error) { + p := 0 + for n < len(src) && err == nil { + // Don't process too much at a time as the Spanner that will be + // called on this block may terminate early. + const maxChunk = 4096 + max := len(src) + if v := n + maxChunk; v < max { + max = v + } + atEnd := false + size := 0 + current := t.t + for ; p < max; p += size { + r := rune(src[p]) + if r < utf8.RuneSelf { + size = 1 + } else if r, size = utf8.DecodeRune(src[p:]); size == 1 { + if !atEOF && !utf8.FullRune(src[p:]) { + err = transform.ErrShortSrc + break + } + } + if !t.check(r) { + // The next rune will be the start of a new run. + atEnd = true + break + } + } + n2, err2 := current.Span(src[n:p], atEnd || (atEOF && p == len(src))) + n += n2 + if err2 != nil { + return n, err2 + } + // At this point either err != nil or t.check will pass for the rune at p. + p = n + size + } + return n, err +} + func (t *cond) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { p := 0 for nSrc < len(src) && err == nil { @@ -99,9 +159,10 @@ func (t *cond) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error size := 0 current := t.t for ; p < max; p += size { - var r rune - r, size = utf8.DecodeRune(src[p:]) - if r == utf8.RuneError && size == 1 { + r := rune(src[p]) + if r < utf8.RuneSelf { + size = 1 + } else if r, size = utf8.DecodeRune(src[p:]); size == 1 { if !atEOF && !utf8.FullRune(src[p:]) { err = transform.ErrShortSrc break diff --git a/vendor/golang.org/x/text/runes/runes.go b/vendor/golang.org/x/text/runes/runes.go index 291de65..6a3195c 100644 --- a/vendor/golang.org/x/text/runes/runes.go +++ b/vendor/golang.org/x/text/runes/runes.go @@ -46,9 +46,19 @@ func Predicate(f func(rune) bool) Set { // Transformer implements the transform.Transformer interface. type Transformer struct { - transform.Transformer + t transform.SpanningTransformer } +func (t Transformer) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + return t.t.Transform(dst, src, atEOF) +} + +func (t Transformer) Span(b []byte, atEOF bool) (n int, err error) { + return t.t.Span(b, atEOF) +} + +func (t Transformer) Reset() { t.t.Reset() } + // Bytes returns a new byte slice with the result of converting b using t. It // calls Reset on t. It returns nil if any error was found. This can only happen // if an error-producing Transformer is passed to If. @@ -96,39 +106,57 @@ type remove func(r rune) bool func (remove) Reset() {} +// Span implements transform.Spanner. +func (t remove) Span(src []byte, atEOF bool) (n int, err error) { + for r, size := rune(0), 0; n < len(src); { + if r = rune(src[n]); r < utf8.RuneSelf { + size = 1 + } else if r, size = utf8.DecodeRune(src[n:]); size == 1 { + // Invalid rune. + if !atEOF && !utf8.FullRune(src[n:]) { + err = transform.ErrShortSrc + } else { + err = transform.ErrEndOfSpan + } + break + } + if t(r) { + err = transform.ErrEndOfSpan + break + } + n += size + } + return +} + // Transform implements transform.Transformer. func (t remove) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { for r, size := rune(0), 0; nSrc < len(src); { if r = rune(src[nSrc]); r < utf8.RuneSelf { size = 1 - } else { - r, size = utf8.DecodeRune(src[nSrc:]) - - if size == 1 { - // Invalid rune. - if !atEOF && !utf8.FullRune(src[nSrc:]) { - err = transform.ErrShortSrc + } else if r, size = utf8.DecodeRune(src[nSrc:]); size == 1 { + // Invalid rune. + if !atEOF && !utf8.FullRune(src[nSrc:]) { + err = transform.ErrShortSrc + break + } + // We replace illegal bytes with RuneError. Not doing so might + // otherwise turn a sequence of invalid UTF-8 into valid UTF-8. + // The resulting byte sequence may subsequently contain runes + // for which t(r) is true that were passed unnoticed. + if !t(utf8.RuneError) { + if nDst+3 > len(dst) { + err = transform.ErrShortDst break } - // We replace illegal bytes with RuneError. Not doing so might - // otherwise turn a sequence of invalid UTF-8 into valid UTF-8. - // The resulting byte sequence may subsequently contain runes - // for which t(r) is true that were passed unnoticed. - if !t(utf8.RuneError) { - if nDst+3 > len(dst) { - err = transform.ErrShortDst - break - } - dst[nDst+0] = runeErrorString[0] - dst[nDst+1] = runeErrorString[1] - dst[nDst+2] = runeErrorString[2] - nDst += 3 - } - nSrc++ - continue + dst[nDst+0] = runeErrorString[0] + dst[nDst+1] = runeErrorString[1] + dst[nDst+2] = runeErrorString[2] + nDst += 3 } + nSrc++ + continue } - if t(r) { nSrc += size continue @@ -157,6 +185,28 @@ type mapper func(rune) rune func (mapper) Reset() {} +// Span implements transform.Spanner. +func (t mapper) Span(src []byte, atEOF bool) (n int, err error) { + for r, size := rune(0), 0; n < len(src); n += size { + if r = rune(src[n]); r < utf8.RuneSelf { + size = 1 + } else if r, size = utf8.DecodeRune(src[n:]); size == 1 { + // Invalid rune. + if !atEOF && !utf8.FullRune(src[n:]) { + err = transform.ErrShortSrc + } else { + err = transform.ErrEndOfSpan + } + break + } + if t(r) != r { + err = transform.ErrEndOfSpan + break + } + } + return n, err +} + // Transform implements transform.Transformer. func (t mapper) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { var replacement rune @@ -230,24 +280,51 @@ func ReplaceIllFormed() Transformer { type replaceIllFormed struct{ transform.NopResetter } +func (t replaceIllFormed) Span(src []byte, atEOF bool) (n int, err error) { + for n < len(src) { + // ASCII fast path. + if src[n] < utf8.RuneSelf { + n++ + continue + } + + r, size := utf8.DecodeRune(src[n:]) + + // Look for a valid non-ASCII rune. + if r != utf8.RuneError || size != 1 { + n += size + continue + } + + // Look for short source data. + if !atEOF && !utf8.FullRune(src[n:]) { + err = transform.ErrShortSrc + break + } + + // We have an invalid rune. + err = transform.ErrEndOfSpan + break + } + return n, err +} + func (t replaceIllFormed) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { for nSrc < len(src) { - r, size := utf8.DecodeRune(src[nSrc:]) - - // Look for an ASCII rune. - if r < utf8.RuneSelf { + // ASCII fast path. + if r := src[nSrc]; r < utf8.RuneSelf { if nDst == len(dst) { err = transform.ErrShortDst break } - dst[nDst] = byte(r) + dst[nDst] = r nDst++ nSrc++ continue } // Look for a valid non-ASCII rune. - if r != utf8.RuneError || size != 1 { + if _, size := utf8.DecodeRune(src[nSrc:]); size != 1 { if size != copy(dst[nDst:], src[nSrc:nSrc+size]) { err = transform.ErrShortDst break diff --git a/vendor/golang.org/x/text/secure/bidirule/bidirule.go b/vendor/golang.org/x/text/secure/bidirule/bidirule.go index 277257f..a7161bd 100644 --- a/vendor/golang.org/x/text/secure/bidirule/bidirule.go +++ b/vendor/golang.org/x/text/secure/bidirule/bidirule.go @@ -123,34 +123,64 @@ var transitions = [...][2]ruleTransition{ // vice versa. const exclusiveRTL = uint16(1<>2) + } + span := append(b.buf[x][:0], b.src[:n]...) + b.src, _, err = transform.Append(t, span, b.src[n:]) b.buf[x] = b.src b.next++ return err } -func (b *buffers) enforce(p *Profile, src []byte) (str []byte, err error) { +// Pre-allocate transformers when possible. In some cases this avoids allocation. +var ( + foldWidthT transform.SpanningTransformer = width.Fold + lowerCaseT transform.SpanningTransformer = cases.Lower(language.Und, cases.HandleFinalSigma(false)) +) + +// TODO: make this a method on profile. + +func (b *buffers) enforce(p *Profile, src []byte, comparing bool) (str []byte, err error) { b.src = src + ascii := true + for _, c := range src { + if c >= utf8.RuneSelf { + ascii = false + break + } + } + // ASCII fast path. + if ascii { + for _, f := range p.options.additional { + if err = b.apply(f()); err != nil { + return nil, err + } + } + switch { + case p.options.asciiLower || (comparing && p.options.ignorecase): + for i, c := range b.src { + if 'A' <= c && c <= 'Z' { + b.src[i] = c ^ 1<<5 + } + } + case p.options.cases != nil: + b.apply(p.options.cases) + } + c := checker{p: p} + if _, err := c.span(b.src, true); err != nil { + return nil, err + } + if p.disallow != nil { + for _, c := range b.src { + if p.disallow.Contains(rune(c)) { + return nil, errDisallowedRune + } + } + } + if p.options.disallowEmpty && len(b.src) == 0 { + return nil, errEmptyString + } + return b.src, nil + } + // These transforms are applied in the order defined in // https://tools.ietf.org/html/rfc7564#section-7 // TODO: allow different width transforms options. - if p.options.foldWidth { - // TODO: use Span, once available. - if err = b.apply(width.Fold); err != nil { - return nil, err - } + if p.options.foldWidth || (p.options.ignorecase && comparing) { + b.apply(foldWidthT) } for _, f := range p.options.additional { if err = b.apply(f()); err != nil { @@ -123,24 +174,14 @@ func (b *buffers) enforce(p *Profile, src []byte) (str []byte, err error) { } } if p.options.cases != nil { - if err = b.apply(p.options.cases); err != nil { - return nil, err - } + b.apply(p.options.cases) } - if n := p.norm.QuickSpan(b.src); n < len(b.src) { - x := b.next & 1 - n = copy(b.buf[x], b.src[:n]) - b.src, _, err = transform.Append(p.norm, b.buf[x][:n], b.src[n:]) - b.buf[x] = b.src - b.next++ - if err != nil { - return nil, err - } + if comparing && p.options.ignorecase { + b.apply(lowerCaseT) } - if p.options.bidiRule { - if err := b.apply(bidirule.New()); err != nil { - return nil, err - } + b.apply(p.norm) + if p.options.bidiRule && !bidirule.Valid(b.src) { + return nil, bidirule.ErrInvalid } c := checker{p: p} if _, err := c.span(b.src, true); err != nil { @@ -155,9 +196,6 @@ func (b *buffers) enforce(p *Profile, src []byte) (str []byte, err error) { i += size } } - - // TODO: Add the disallow empty rule with a dummy transformer? - if p.options.disallowEmpty && len(b.src) == 0 { return nil, errEmptyString } @@ -168,19 +206,16 @@ func (b *buffers) enforce(p *Profile, src []byte) (str []byte, err error) { // It returns an error if the input string is invalid. func (p *Profile) Append(dst, src []byte) ([]byte, error) { var buf buffers - buf.init(8 + len(src) + len(src)>>2) - b, err := buf.enforce(p, src) + b, err := buf.enforce(p, src, false) if err != nil { return nil, err } return append(dst, b...), nil } -// Bytes returns a new byte slice with the result of applying the profile to b. -func (p *Profile) Bytes(b []byte) ([]byte, error) { +func processBytes(p *Profile, b []byte, key bool) ([]byte, error) { var buf buffers - buf.init(8 + len(b) + len(b)>>2) - b, err := buf.enforce(p, b) + b, err := buf.enforce(p, b, key) if err != nil { return nil, err } @@ -192,39 +227,62 @@ func (p *Profile) Bytes(b []byte) ([]byte, error) { return b, nil } -// String returns a string with the result of applying the profile to s. -func (p *Profile) String(s string) (string, error) { +// Bytes returns a new byte slice with the result of applying the profile to b. +func (p *Profile) Bytes(b []byte) ([]byte, error) { + return processBytes(p, b, false) +} + +// AppendCompareKey appends the result of applying p to src (including any +// optional rules to make strings comparable or useful in a map key such as +// applying lowercasing) writing the result to dst. It returns an error if the +// input string is invalid. +func (p *Profile) AppendCompareKey(dst, src []byte) ([]byte, error) { + var buf buffers + b, err := buf.enforce(p, src, true) + if err != nil { + return nil, err + } + return append(dst, b...), nil +} + +func processString(p *Profile, s string, key bool) (string, error) { var buf buffers - buf.init(8 + len(s) + len(s)>>2) - b, err := buf.enforce(p, []byte(s)) + b, err := buf.enforce(p, []byte(s), key) if err != nil { return "", err } return string(b), nil } +// String returns a string with the result of applying the profile to s. +func (p *Profile) String(s string) (string, error) { + return processString(p, s, false) +} + +// CompareKey returns a string that can be used for comparison, hashing, or +// collation. +func (p *Profile) CompareKey(s string) (string, error) { + return processString(p, s, true) +} + // Compare enforces both strings, and then compares them for bit-string identity // (byte-for-byte equality). If either string cannot be enforced, the comparison // is false. func (p *Profile) Compare(a, b string) bool { - a, err := p.String(a) + var buf buffers + + akey, err := buf.enforce(p, []byte(a), true) if err != nil { return false } - b, err = p.String(b) + + buf = buffers{} + bkey, err := buf.enforce(p, []byte(b), true) if err != nil { return false } - // TODO: This is out of order. Need to extract the transformation logic and - // put this in where the normal case folding would go (but only for - // comparison). - if p.options.ignorecase { - a = width.Fold.String(a) - b = width.Fold.String(a) - } - - return a == b + return bytes.Compare(akey, bkey) == 0 } // Allowed returns a runes.Set containing every rune that is a member of the @@ -264,33 +322,35 @@ func (c *checker) span(src []byte, atEOF bool) (n int, err error) { } return n, errDisallowedRune } + doLookAhead := false if property(e) < c.p.class.validFrom { if d.rule == nil { return n, errDisallowedRune } - doLookAhead, err := d.rule(c.beforeBits) + doLookAhead, err = d.rule(c.beforeBits) if err != nil { return n, err } - if doLookAhead { - c.beforeBits &= d.keep - c.beforeBits |= d.set - // We may still have a lookahead rule which we will require to - // complete (by checking termBits == 0) before setting the new - // bits. - if c.termBits != 0 && (!c.checkLookahead() || c.termBits == 0) { - return n, err - } - c.termBits = d.term - c.acceptBits = d.accept - n += sz - continue - } } c.beforeBits &= d.keep c.beforeBits |= d.set - if c.termBits != 0 && !c.checkLookahead() { - return n, errContext + if c.termBits != 0 { + // We are currently in an unterminated lookahead. + if c.beforeBits&c.termBits != 0 { + c.termBits = 0 + c.acceptBits = 0 + } else if c.beforeBits&c.acceptBits == 0 { + // Invalid continuation of the unterminated lookahead sequence. + return n, errContext + } + } + if doLookAhead { + if c.termBits != 0 { + // A previous lookahead run has not been terminated yet. + return n, errContext + } + c.termBits = d.term + c.acceptBits = d.accept } n += sz } @@ -300,18 +360,6 @@ func (c *checker) span(src []byte, atEOF bool) (n int, err error) { return n, err } -func (c *checker) checkLookahead() bool { - switch { - case c.beforeBits&c.termBits != 0: - c.termBits = 0 - c.acceptBits = 0 - case c.beforeBits&c.acceptBits != 0: - default: - return false - } - return true -} - // TODO: we may get rid of this transform if transform.Chain understands // something like a Spanner interface. func (c checker) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { diff --git a/vendor/golang.org/x/text/secure/precis/profiles.go b/vendor/golang.org/x/text/secure/precis/profiles.go index ad50ae8..8601002 100644 --- a/vendor/golang.org/x/text/secure/precis/profiles.go +++ b/vendor/golang.org/x/text/secure/precis/profiles.go @@ -13,44 +13,66 @@ import ( ) var ( - Nickname *Profile = nickname // Implements the Nickname profile specified in RFC 7700. - UsernameCaseMapped *Profile = usernameCaseMap // Implements the UsernameCaseMapped profile specified in RFC 7613. - UsernameCasePreserved *Profile = usernameNoCaseMap // Implements the UsernameCasePreserved profile specified in RFC 7613. - OpaqueString *Profile = opaquestring // Implements the OpaqueString profile defined in RFC 7613 for passwords and other secure labels. + // Implements the Nickname profile specified in RFC 7700. + // The nickname profile is not idempotent and may need to be applied multiple + // times before being used for comparisons. + Nickname *Profile = nickname + + // Implements the UsernameCaseMapped profile specified in RFC 7613. + UsernameCaseMapped *Profile = usernameCaseMap + + // Implements the UsernameCasePreserved profile specified in RFC 7613. + UsernameCasePreserved *Profile = usernameNoCaseMap + + // Implements the OpaqueString profile defined in RFC 7613 for passwords and other secure labels. + OpaqueString *Profile = opaquestring ) -// TODO: mvl: "Ultimately, I would manually define the structs for the internal -// profiles. This avoid pulling in unneeded tables when they are not used." var ( - nickname = NewFreeform( - AdditionalMapping(func() transform.Transformer { - return &nickAdditionalMapping{} - }), - IgnoreCase, - Norm(norm.NFKC), - DisallowEmpty, - ) - usernameCaseMap = NewIdentifier( - FoldWidth, - FoldCase(), - Norm(norm.NFC), - BidiRule, - ) - usernameNoCaseMap = NewIdentifier( - FoldWidth, - Norm(norm.NFC), - BidiRule, - ) - opaquestring = NewFreeform( - AdditionalMapping(func() transform.Transformer { - return runes.Map(func(r rune) rune { - if unicode.Is(unicode.Zs, r) { - return ' ' - } - return r - }) - }), - Norm(norm.NFC), - DisallowEmpty, - ) + nickname = &Profile{ + options: getOpts( + AdditionalMapping(func() transform.Transformer { + return &nickAdditionalMapping{} + }), + IgnoreCase, + Norm(norm.NFKC), + DisallowEmpty, + ), + class: freeform, + } + usernameCaseMap = &Profile{ + options: getOpts( + FoldWidth, + LowerCase(), + Norm(norm.NFC), + BidiRule, + ), + class: identifier, + } + usernameNoCaseMap = &Profile{ + options: getOpts( + FoldWidth, + Norm(norm.NFC), + BidiRule, + ), + class: identifier, + } + opaquestring = &Profile{ + options: getOpts( + AdditionalMapping(func() transform.Transformer { + return mapSpaces + }), + Norm(norm.NFC), + DisallowEmpty, + ), + class: freeform, + } ) + +// mapSpaces is a shared value of a runes.Map transformer. +var mapSpaces transform.Transformer = runes.Map(func(r rune) rune { + if unicode.Is(unicode.Zs, r) { + return ' ' + } + return r +}) diff --git a/vendor/golang.org/x/text/secure/precis/tables.go b/vendor/golang.org/x/text/secure/precis/tables.go index a9b500d..2f550c1 100644 --- a/vendor/golang.org/x/text/secure/precis/tables.go +++ b/vendor/golang.org/x/text/secure/precis/tables.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package precis diff --git a/vendor/golang.org/x/text/secure/precis/trieval.go b/vendor/golang.org/x/text/secure/precis/trieval.go index fed7d75..4833f96 100644 --- a/vendor/golang.org/x/text/secure/precis/trieval.go +++ b/vendor/golang.org/x/text/secure/precis/trieval.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package precis diff --git a/vendor/golang.org/x/text/transform/transform.go b/vendor/golang.org/x/text/transform/transform.go index 51862b0..24dcca6 100644 --- a/vendor/golang.org/x/text/transform/transform.go +++ b/vendor/golang.org/x/text/transform/transform.go @@ -24,6 +24,10 @@ var ( // complete the transformation. ErrShortSrc = errors.New("transform: short source buffer") + // ErrEndOfSpan means that the input and output (the transformed input) + // are not identical. + ErrEndOfSpan = errors.New("transform: input and output are not identical") + // errInconsistentByteCount means that Transform returned success (nil // error) but also returned nSrc inconsistent with the src argument. errInconsistentByteCount = errors.New("transform: inconsistent byte count returned") @@ -60,6 +64,41 @@ type Transformer interface { Reset() } +// SpanningTransformer extends the Transformer interface with a Span method +// that determines how much of the input already conforms to the Transformer. +type SpanningTransformer interface { + Transformer + + // Span returns a position in src such that transforming src[:n] results in + // identical output src[:n] for these bytes. It does not necessarily return + // the largest such n. The atEOF argument tells whether src represents the + // last bytes of the input. + // + // Callers should always account for the n bytes consumed before + // considering the error err. + // + // A nil error means that all input bytes are known to be identical to the + // output produced by the Transformer. A nil error can be be returned + // regardless of whether atEOF is true. If err is nil, then then n must + // equal len(src); the converse is not necessarily true. + // + // ErrEndOfSpan means that the Transformer output may differ from the + // input after n bytes. Note that n may be len(src), meaning that the output + // would contain additional bytes after otherwise identical output. + // ErrShortSrc means that src had insufficient data to determine whether the + // remaining bytes would change. Other than the error conditions listed + // here, implementations are free to report other errors that arise. + // + // Calling Span can modify the Transformer state as a side effect. In + // effect, it does the transformation just as calling Transform would, only + // without copying to a destination buffer and only up to a point it can + // determine the input and output bytes are the same. This is obviously more + // limited than calling Transform, but can be more efficient in terms of + // copying and allocating buffers. Calls to Span and Transform may be + // interleaved. + Span(src []byte, atEOF bool) (n int, err error) +} + // NopResetter can be embedded by implementations of Transformer to add a nop // Reset method. type NopResetter struct{} @@ -278,6 +317,10 @@ func (nop) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { return n, n, err } +func (nop) Span(src []byte, atEOF bool) (n int, err error) { + return len(src), nil +} + type discard struct{ NopResetter } func (discard) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { @@ -289,8 +332,8 @@ var ( // by consuming all bytes and writing nothing. Discard Transformer = discard{} - // Nop is a Transformer that copies src to dst. - Nop Transformer = nop{} + // Nop is a SpanningTransformer that copies src to dst. + Nop SpanningTransformer = nop{} ) // chain is a sequence of links. A chain with N Transformers has N+1 links and @@ -358,6 +401,8 @@ func (c *chain) Reset() { } } +// TODO: make chain use Span (is going to be fun to implement!) + // Transform applies the transformers of c in sequence. func (c *chain) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { // Set up src and dst in the chain. @@ -448,8 +493,7 @@ func (c *chain) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err erro return dstL.n, srcL.p, err } -// RemoveFunc returns a Transformer that removes from the input all runes r for -// which f(r) is true. Illegal bytes in the input are replaced by RuneError. +// Deprecated: use runes.Remove instead. func RemoveFunc(f func(r rune) bool) Transformer { return removeF(f) } diff --git a/vendor/golang.org/x/text/unicode/bidi/bracket.go b/vendor/golang.org/x/text/unicode/bidi/bracket.go index e88119d..601e259 100644 --- a/vendor/golang.org/x/text/unicode/bidi/bracket.go +++ b/vendor/golang.org/x/text/unicode/bidi/bracket.go @@ -84,7 +84,7 @@ func resolvePairedBrackets(s *isolatingRunSequence) { dirEmbed = R } p.locateBrackets(s.p.pairTypes, s.p.pairValues) - p.resolveBrackets(dirEmbed) + p.resolveBrackets(dirEmbed, s.p.initialTypes) } type bracketPairer struct { @@ -125,6 +125,8 @@ func (p *bracketPairer) matchOpener(pairValues []rune, opener, closer int) bool return pairValues[p.indexes[opener]] == pairValues[p.indexes[closer]] } +const maxPairingDepth = 63 + // locateBrackets locates matching bracket pairs according to BD16. // // This implementation uses a linked list instead of a stack, because, while @@ -136,11 +138,17 @@ func (p *bracketPairer) locateBrackets(pairTypes []bracketType, pairValues []run for i, index := range p.indexes { // look at the bracket type for each character - switch pairTypes[index] { - case bpNone: + if pairTypes[index] == bpNone || p.codesIsolatedRun[i] != ON { // continue scanning - + continue + } + switch pairTypes[index] { case bpOpen: + // check if maximum pairing depth reached + if p.openers.Len() == maxPairingDepth { + p.openers.Init() + return + } // remember opener location, most recent first p.openers.PushFront(i) @@ -270,7 +278,7 @@ func (p *bracketPairer) classBeforePair(loc bracketPair) Class { } // assignBracketType implements rule N0 for a single bracket pair. -func (p *bracketPairer) assignBracketType(loc bracketPair, dirEmbed Class) { +func (p *bracketPairer) assignBracketType(loc bracketPair, dirEmbed Class, initialTypes []Class) { // rule "N0, a", inspect contents of pair dirPair := p.classifyPairContent(loc, dirEmbed) @@ -295,13 +303,33 @@ func (p *bracketPairer) assignBracketType(loc bracketPair, dirEmbed Class) { // direction // set the bracket types to the type found + p.setBracketsToType(loc, dirPair, initialTypes) +} + +func (p *bracketPairer) setBracketsToType(loc bracketPair, dirPair Class, initialTypes []Class) { p.codesIsolatedRun[loc.opener] = dirPair p.codesIsolatedRun[loc.closer] = dirPair + + for i := loc.opener + 1; i < loc.closer; i++ { + index := p.indexes[i] + if initialTypes[index] != NSM { + break + } + p.codesIsolatedRun[i] = dirPair + } + + for i := loc.closer + 1; i < len(p.indexes); i++ { + index := p.indexes[i] + if initialTypes[index] != NSM { + break + } + p.codesIsolatedRun[i] = dirPair + } } // resolveBrackets implements rule N0 for a list of pairs. -func (p *bracketPairer) resolveBrackets(dirEmbed Class) { +func (p *bracketPairer) resolveBrackets(dirEmbed Class, initialTypes []Class) { for _, loc := range p.pairPositions { - p.assignBracketType(loc, dirEmbed) + p.assignBracketType(loc, dirEmbed, initialTypes) } } diff --git a/vendor/golang.org/x/text/unicode/bidi/core.go b/vendor/golang.org/x/text/unicode/bidi/core.go index 381f30a..d4c1399 100644 --- a/vendor/golang.org/x/text/unicode/bidi/core.go +++ b/vendor/golang.org/x/text/unicode/bidi/core.go @@ -309,6 +309,9 @@ func (p *paragraph) determineExplicitEmbeddingLevels() { } if isIsolate { p.resultLevels[i] = stack.lastEmbeddingLevel() + if stack.lastDirectionalOverrideStatus() != ON { + p.resultTypes[i] = stack.lastDirectionalOverrideStatus() + } } var newLevel level @@ -723,7 +726,7 @@ loop: continue loop } } - log.Panicf("invalid bidi code %s present in assertOnly at position %d", t, s.indexes[i]) + log.Panicf("invalid bidi code %v present in assertOnly at position %d", t, s.indexes[i]) } } diff --git a/vendor/golang.org/x/text/unicode/bidi/tables.go b/vendor/golang.org/x/text/unicode/bidi/tables.go index 2d4dde0..7212d5a 100644 --- a/vendor/golang.org/x/text/unicode/bidi/tables.go +++ b/vendor/golang.org/x/text/unicode/bidi/tables.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package bidi diff --git a/vendor/golang.org/x/text/unicode/bidi/trieval.go b/vendor/golang.org/x/text/unicode/bidi/trieval.go index bebd855..4c459c4 100644 --- a/vendor/golang.org/x/text/unicode/bidi/trieval.go +++ b/vendor/golang.org/x/text/unicode/bidi/trieval.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package bidi diff --git a/vendor/golang.org/x/text/unicode/norm/composition.go b/vendor/golang.org/x/text/unicode/norm/composition.go index d17b278..bab4c5d 100644 --- a/vendor/golang.org/x/text/unicode/norm/composition.go +++ b/vendor/golang.org/x/text/unicode/norm/composition.go @@ -33,17 +33,9 @@ const ( // streamSafe implements the policy of when a CGJ should be inserted. type streamSafe uint8 -// mkStreamSafe is a shorthand for declaring a streamSafe var and calling -// first on it. -func mkStreamSafe(p Properties) streamSafe { - return streamSafe(p.nTrailingNonStarters()) -} - -// first inserts the first rune of a segment. +// first inserts the first rune of a segment. It is a faster version of next if +// it is known p represents the first rune in a segment. func (ss *streamSafe) first(p Properties) { - if *ss != 0 { - panic("!= 0") - } *ss = streamSafe(p.nTrailingNonStarters()) } @@ -66,7 +58,7 @@ func (ss *streamSafe) next(p Properties) ssState { // be a non-starter. Note that it always hold that if nLead > 0 then // nLead == nTrail. if n == 0 { - *ss = 0 + *ss = streamSafe(p.nTrailingNonStarters()) return ssStarter } return ssSuccess @@ -142,7 +134,6 @@ func (rb *reorderBuffer) setFlusher(out []byte, f func(*reorderBuffer) bool) { func (rb *reorderBuffer) reset() { rb.nrune = 0 rb.nbyte = 0 - rb.ss = 0 } func (rb *reorderBuffer) doFlush() bool { @@ -257,6 +248,9 @@ func (rb *reorderBuffer) insertUnsafe(src input, i int, info Properties) { // It flushes the buffer on each new segment start. func (rb *reorderBuffer) insertDecomposed(dcomp []byte) insertErr { rb.tmpBytes.setBytes(dcomp) + // As the streamSafe accounting already handles the counting for modifiers, + // we don't have to call next. However, we do need to keep the accounting + // intact when flushing the buffer. for i := 0; i < len(dcomp); { info := rb.f.info(rb.tmpBytes, i) if info.BoundaryBefore() && rb.nrune > 0 && !rb.doFlush() { diff --git a/vendor/golang.org/x/text/unicode/norm/forminfo.go b/vendor/golang.org/x/text/unicode/norm/forminfo.go index 15a67c6..e67e765 100644 --- a/vendor/golang.org/x/text/unicode/norm/forminfo.go +++ b/vendor/golang.org/x/text/unicode/norm/forminfo.go @@ -10,7 +10,7 @@ package norm // and its corresponding decomposing form share the same trie. Each trie maps // a rune to a uint16. The values take two forms. For v >= 0x8000: // bits -// 15: 1 (inverse of NFD_QD bit of qcInfo) +// 15: 1 (inverse of NFD_QC bit of qcInfo) // 13..7: qcInfo (see below). isYesD is always true (no decompostion). // 6..0: ccc (compressed CCC value). // For v < 0x8000, the respective rune has a decomposition and v is an index @@ -56,28 +56,31 @@ type formInfo struct { nextMain iterFunc } -var formTable []*formInfo - -func init() { - formTable = make([]*formInfo, 4) - - for i := range formTable { - f := &formInfo{} - formTable[i] = f - f.form = Form(i) - if Form(i) == NFKD || Form(i) == NFKC { - f.compatibility = true - f.info = lookupInfoNFKC - } else { - f.info = lookupInfoNFC - } - f.nextMain = nextDecomposed - if Form(i) == NFC || Form(i) == NFKC { - f.nextMain = nextComposed - f.composing = true - } - } -} +var formTable = []*formInfo{{ + form: NFC, + composing: true, + compatibility: false, + info: lookupInfoNFC, + nextMain: nextComposed, +}, { + form: NFD, + composing: false, + compatibility: false, + info: lookupInfoNFC, + nextMain: nextDecomposed, +}, { + form: NFKC, + composing: true, + compatibility: true, + info: lookupInfoNFKC, + nextMain: nextComposed, +}, { + form: NFKD, + composing: false, + compatibility: true, + info: lookupInfoNFKC, + nextMain: nextDecomposed, +}} // We do not distinguish between boundaries for NFC, NFD, etc. to avoid // unexpected behavior for the user. For example, in NFD, there is a boundary diff --git a/vendor/golang.org/x/text/unicode/norm/input.go b/vendor/golang.org/x/text/unicode/norm/input.go index 045d4cc..479e35b 100644 --- a/vendor/golang.org/x/text/unicode/norm/input.go +++ b/vendor/golang.org/x/text/unicode/norm/input.go @@ -90,16 +90,20 @@ func (in *input) charinfoNFKC(p int) (uint16, int) { } func (in *input) hangul(p int) (r rune) { + var size int if in.bytes == nil { if !isHangulString(in.str[p:]) { return 0 } - r, _ = utf8.DecodeRuneInString(in.str[p:]) + r, size = utf8.DecodeRuneInString(in.str[p:]) } else { if !isHangul(in.bytes[p:]) { return 0 } - r, _ = utf8.DecodeRune(in.bytes[p:]) + r, size = utf8.DecodeRune(in.bytes[p:]) + } + if size != hangulUTF8Size { + return 0 } return r } diff --git a/vendor/golang.org/x/text/unicode/norm/iter.go b/vendor/golang.org/x/text/unicode/norm/iter.go index 0a42a72..ce17f96 100644 --- a/vendor/golang.org/x/text/unicode/norm/iter.go +++ b/vendor/golang.org/x/text/unicode/norm/iter.go @@ -41,6 +41,7 @@ func (i *Iter) Init(f Form, src []byte) { i.next = i.rb.f.nextMain i.asciiF = nextASCIIBytes i.info = i.rb.f.info(i.rb.src, i.p) + i.rb.ss.first(i.info) } // InitString initializes i to iterate over src after normalizing it to Form f. @@ -56,11 +57,12 @@ func (i *Iter) InitString(f Form, src string) { i.next = i.rb.f.nextMain i.asciiF = nextASCIIString i.info = i.rb.f.info(i.rb.src, i.p) + i.rb.ss.first(i.info) } // Seek sets the segment to be returned by the next call to Next to start // at position p. It is the responsibility of the caller to set p to the -// start of a UTF8 rune. +// start of a segment. func (i *Iter) Seek(offset int64, whence int) (int64, error) { var abs int64 switch whence { @@ -84,6 +86,7 @@ func (i *Iter) Seek(offset int64, whence int) (int64, error) { i.multiSeg = nil i.next = i.rb.f.nextMain i.info = i.rb.f.info(i.rb.src, i.p) + i.rb.ss.first(i.info) return abs, nil } @@ -161,6 +164,7 @@ func nextHangul(i *Iter) []byte { if next >= i.rb.nsrc { i.setDone() } else if i.rb.src.hangul(next) == 0 { + i.rb.ss.next(i.info) i.info = i.rb.f.info(i.rb.src, i.p) i.next = i.rb.f.nextMain return i.next(i) @@ -204,12 +208,10 @@ func nextMultiNorm(i *Iter) []byte { if info.BoundaryBefore() { i.rb.compose() seg := i.buf[:i.rb.flushCopy(i.buf[:])] - i.rb.ss.first(info) i.rb.insertUnsafe(input{bytes: d}, j, info) i.multiSeg = d[j+int(info.size):] return seg } - i.rb.ss.next(info) i.rb.insertUnsafe(input{bytes: d}, j, info) j += int(info.size) } @@ -222,9 +224,9 @@ func nextMultiNorm(i *Iter) []byte { func nextDecomposed(i *Iter) (next []byte) { outp := 0 inCopyStart, outCopyStart := i.p, 0 - ss := mkStreamSafe(i.info) for { if sz := int(i.info.size); sz <= 1 { + i.rb.ss = 0 p := i.p i.p++ // ASCII or illegal byte. Either way, advance by 1. if i.p >= i.rb.nsrc { @@ -243,6 +245,8 @@ func nextDecomposed(i *Iter) (next []byte) { p := outp + len(d) if outp > 0 { i.rb.src.copySlice(i.buf[outCopyStart:], inCopyStart, i.p) + // TODO: this condition should not be possible, but we leave it + // in for defensive purposes. if p > len(i.buf) { return i.buf[:outp] } @@ -266,7 +270,7 @@ func nextDecomposed(i *Iter) (next []byte) { } else { i.info = i.rb.f.info(i.rb.src, i.p) } - switch ss.next(i.info) { + switch i.rb.ss.next(i.info) { case ssOverflow: i.next = nextCGJDecompose fallthrough @@ -309,7 +313,7 @@ func nextDecomposed(i *Iter) (next []byte) { } prevCC := i.info.tccc i.info = i.rb.f.info(i.rb.src, i.p) - if v := ss.next(i.info); v == ssStarter { + if v := i.rb.ss.next(i.info); v == ssStarter { break } else if v == ssOverflow { i.next = nextCGJDecompose @@ -335,10 +339,6 @@ doNorm: func doNormDecomposed(i *Iter) []byte { for { - if s := i.rb.ss.next(i.info); s == ssOverflow { - i.next = nextCGJDecompose - break - } i.rb.insertUnsafe(i.rb.src, i.p, i.info) if i.p += int(i.info.size); i.p >= i.rb.nsrc { i.setDone() @@ -348,6 +348,10 @@ func doNormDecomposed(i *Iter) []byte { if i.info.ccc == 0 { break } + if s := i.rb.ss.next(i.info); s == ssOverflow { + i.next = nextCGJDecompose + break + } } // new segment or too many combining characters: exit normalization return i.buf[:i.rb.flushCopy(i.buf[:])] @@ -357,6 +361,7 @@ func nextCGJDecompose(i *Iter) []byte { i.rb.ss = 0 i.rb.insertCGJ() i.next = nextDecomposed + i.rb.ss.first(i.info) buf := doNormDecomposed(i) return buf } @@ -365,7 +370,6 @@ func nextCGJDecompose(i *Iter) []byte { func nextComposed(i *Iter) []byte { outp, startp := 0, i.p var prevCC uint8 - ss := mkStreamSafe(i.info) for { if !i.info.isYesC() { goto doNorm @@ -385,11 +389,12 @@ func nextComposed(i *Iter) []byte { i.setDone() break } else if i.rb.src._byte(i.p) < utf8.RuneSelf { + i.rb.ss = 0 i.next = i.asciiF break } i.info = i.rb.f.info(i.rb.src, i.p) - if v := ss.next(i.info); v == ssStarter { + if v := i.rb.ss.next(i.info); v == ssStarter { break } else if v == ssOverflow { i.next = nextCGJCompose @@ -401,8 +406,10 @@ func nextComposed(i *Iter) []byte { } return i.returnSlice(startp, i.p) doNorm: + // reset to start position i.p = startp i.info = i.rb.f.info(i.rb.src, i.p) + i.rb.ss.first(i.info) if i.info.multiSegment() { d := i.info.Decomposition() info := i.rb.f.info(input{bytes: d}, 0) diff --git a/vendor/golang.org/x/text/unicode/norm/maketables.go b/vendor/golang.org/x/text/unicode/norm/maketables.go index 07bdff6..8d41816 100644 --- a/vendor/golang.org/x/text/unicode/norm/maketables.go +++ b/vendor/golang.org/x/text/unicode/norm/maketables.go @@ -35,12 +35,9 @@ func main() { computeNonStarterCounts() verifyComputed() printChars() - if *test { - testDerived() - printTestdata() - } else { - makeTables() - } + testDerived() + printTestdata() + makeTables() } var ( @@ -602,6 +599,7 @@ func printCharInfoTables(w io.Writer) int { } index := normalDecomp nTrail := chars[r].nTrailingNonStarters + nLead := chars[r].nLeadingNonStarters if tccc > 0 || lccc > 0 || nTrail > 0 { tccc <<= 2 tccc |= nTrail @@ -612,7 +610,7 @@ func printCharInfoTables(w io.Writer) int { index = firstCCC } } - if lccc > 0 { + if lccc > 0 || nLead > 0 { s += string([]byte{lccc}) if index == firstCCC { log.Fatalf("%U: multi-segment decomposition not supported for decompositions with leading CCC != 0", r) diff --git a/vendor/golang.org/x/text/unicode/norm/normalize.go b/vendor/golang.org/x/text/unicode/norm/normalize.go index a70805c..2747f6c 100644 --- a/vendor/golang.org/x/text/unicode/norm/normalize.go +++ b/vendor/golang.org/x/text/unicode/norm/normalize.go @@ -2,13 +2,18 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. +// Note: the file data_test.go that is generated should not be checked in. //go:generate go run maketables.go triegen.go -//go:generate go run maketables.go triegen.go -test +//go:generate go test -tags test // Package norm contains types and functions for normalizing Unicode strings. package norm -import "unicode/utf8" +import ( + "unicode/utf8" + + "golang.org/x/text/transform" +) // A Form denotes a canonical representation of Unicode code points. // The Unicode-defined normalization and equivalence forms are: @@ -263,6 +268,34 @@ func (f Form) QuickSpan(b []byte) int { return n } +// Span implements transform.SpanningTransformer. It returns a boundary n such +// that b[0:n] == f(b[0:n]). It is not guaranteed to return the largest such n. +func (f Form) Span(b []byte, atEOF bool) (n int, err error) { + n, ok := formTable[f].quickSpan(inputBytes(b), 0, len(b), atEOF) + if n < len(b) { + if !ok { + err = transform.ErrEndOfSpan + } else { + err = transform.ErrShortSrc + } + } + return n, err +} + +// SpanString returns a boundary n such that s[0:n] == f(s[0:n]). +// It is not guaranteed to return the largest such n. +func (f Form) SpanString(s string, atEOF bool) (n int, err error) { + n, ok := formTable[f].quickSpan(inputString(s), 0, len(s), atEOF) + if n < len(s) { + if !ok { + err = transform.ErrEndOfSpan + } else { + err = transform.ErrShortSrc + } + } + return n, err +} + // quickSpan returns a boundary n such that src[0:n] == f(src[0:n]) and // whether any non-normalized parts were found. If atEOF is false, n will // not point past the last segment if this segment might be become @@ -291,7 +324,6 @@ func (f *formInfo) quickSpan(src input, i, end int, atEOF bool) (n int, ok bool) // have an overflow for runes that are starters (e.g. with U+FF9E). switch ss.next(info) { case ssStarter: - ss.first(info) lastSegStart = i case ssOverflow: return lastSegStart, false @@ -321,7 +353,7 @@ func (f *formInfo) quickSpan(src input, i, end int, atEOF bool) (n int, ok bool) return lastSegStart, false } -// QuickSpanString returns a boundary n such that b[0:n] == f(s[0:n]). +// QuickSpanString returns a boundary n such that s[0:n] == f(s[0:n]). // It is not guaranteed to return the largest such n. func (f Form) QuickSpanString(s string) int { n, _ := formTable[f].quickSpan(inputString(s), 0, len(s), true) @@ -408,6 +440,8 @@ func (f Form) nextBoundary(src input, nsrc int, atEOF bool) int { } return -1 } + // TODO: Using streamSafe to determine the boundary isn't the same as + // using BoundaryBefore. Determine which should be used. if s := ss.next(info); s != ssSuccess { return i } @@ -472,15 +506,14 @@ func decomposeSegment(rb *reorderBuffer, sp int, atEOF bool) int { if info.size == 0 { return 0 } - if rb.nrune > 0 { - if s := rb.ss.next(info); s == ssStarter { - goto end - } else if s == ssOverflow { - rb.insertCGJ() + if s := rb.ss.next(info); s == ssStarter { + // TODO: this could be removed if we don't support merging. + if rb.nrune > 0 { goto end } - } else { - rb.ss.first(info) + } else if s == ssOverflow { + rb.insertCGJ() + goto end } if err := rb.insertFlush(rb.src, sp, info); err != iSuccess { return int(err) diff --git a/vendor/golang.org/x/text/unicode/norm/readwriter.go b/vendor/golang.org/x/text/unicode/norm/readwriter.go index 4fa0e04..d926ee9 100644 --- a/vendor/golang.org/x/text/unicode/norm/readwriter.go +++ b/vendor/golang.org/x/text/unicode/norm/readwriter.go @@ -112,7 +112,6 @@ func (r *normReader) Read(p []byte) (int, error) { } } } - panic("should not reach here") } // Reader returns a new reader that implements Read diff --git a/vendor/golang.org/x/text/unicode/norm/tables.go b/vendor/golang.org/x/text/unicode/norm/tables.go index a56697b..bf9ff80 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables.go +++ b/vendor/golang.org/x/text/unicode/norm/tables.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package norm @@ -27,14 +27,14 @@ const ( firstMulti = 0x186D firstCCC = 0x2C9E endMulti = 0x2F60 - firstLeadingCCC = 0x4A44 - firstCCCZeroExcept = 0x4A5A - firstStarterWithNLead = 0x4A81 - lastDecomp = 0x4A83 + firstLeadingCCC = 0x49AE + firstCCCZeroExcept = 0x4A78 + firstStarterWithNLead = 0x4A9F + lastDecomp = 0x4AA1 maxDecomp = 0x8000 ) -// decomps: 19075 bytes +// decomps: 19105 bytes var decomps = [...]byte{ // Bytes 0 - 3f 0x00, 0x41, 0x20, 0x41, 0x21, 0x41, 0x22, 0x41, @@ -2443,283 +2443,287 @@ var decomps = [...]byte{ 0xD9, 0x8F, 0x69, 0x43, 0x20, 0xD9, 0x90, 0x6D, 0x43, 0x20, 0xD9, 0x91, 0x71, 0x43, 0x20, 0xD9, 0x92, 0x75, 0x43, 0x41, 0xCC, 0x8A, 0xC9, 0x43, - 0x73, 0xCC, 0x87, 0xC9, 0x43, 0xE1, 0x85, 0xA1, - 0x01, 0x43, 0xE1, 0x85, 0xA2, 0x01, 0x43, 0xE1, - 0x85, 0xA3, 0x01, 0x43, 0xE1, 0x85, 0xA4, 0x01, - 0x43, 0xE1, 0x85, 0xA5, 0x01, 0x43, 0xE1, 0x85, - 0xA6, 0x01, 0x43, 0xE1, 0x85, 0xA7, 0x01, 0x43, + 0x73, 0xCC, 0x87, 0xC9, 0x44, 0x20, 0xE3, 0x82, + 0x99, 0x0D, 0x44, 0x20, 0xE3, 0x82, 0x9A, 0x0D, + 0x44, 0xC2, 0xA8, 0xCC, 0x81, 0xCA, 0x44, 0xCE, + 0x91, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0x95, 0xCC, + 0x81, 0xC9, 0x44, 0xCE, 0x97, 0xCC, 0x81, 0xC9, // Bytes 4300 - 433f - 0xE1, 0x85, 0xA8, 0x01, 0x43, 0xE1, 0x85, 0xA9, - 0x01, 0x43, 0xE1, 0x85, 0xAA, 0x01, 0x43, 0xE1, - 0x85, 0xAB, 0x01, 0x43, 0xE1, 0x85, 0xAC, 0x01, - 0x43, 0xE1, 0x85, 0xAD, 0x01, 0x43, 0xE1, 0x85, - 0xAE, 0x01, 0x43, 0xE1, 0x85, 0xAF, 0x01, 0x43, - 0xE1, 0x85, 0xB0, 0x01, 0x43, 0xE1, 0x85, 0xB1, - 0x01, 0x43, 0xE1, 0x85, 0xB2, 0x01, 0x43, 0xE1, - 0x85, 0xB3, 0x01, 0x43, 0xE1, 0x85, 0xB4, 0x01, + 0x44, 0xCE, 0x99, 0xCC, 0x81, 0xC9, 0x44, 0xCE, + 0x9F, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0xA5, 0xCC, + 0x81, 0xC9, 0x44, 0xCE, 0xA5, 0xCC, 0x88, 0xC9, + 0x44, 0xCE, 0xA9, 0xCC, 0x81, 0xC9, 0x44, 0xCE, + 0xB1, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0xB5, 0xCC, + 0x81, 0xC9, 0x44, 0xCE, 0xB7, 0xCC, 0x81, 0xC9, + 0x44, 0xCE, 0xB9, 0xCC, 0x81, 0xC9, 0x44, 0xCE, + 0xBF, 0xCC, 0x81, 0xC9, 0x44, 0xCF, 0x85, 0xCC, // Bytes 4340 - 437f - 0x43, 0xE1, 0x85, 0xB5, 0x01, 0x43, 0xE1, 0x86, - 0xAA, 0x01, 0x43, 0xE1, 0x86, 0xAC, 0x01, 0x43, - 0xE1, 0x86, 0xAD, 0x01, 0x43, 0xE1, 0x86, 0xB0, - 0x01, 0x43, 0xE1, 0x86, 0xB1, 0x01, 0x43, 0xE1, - 0x86, 0xB2, 0x01, 0x43, 0xE1, 0x86, 0xB3, 0x01, - 0x43, 0xE1, 0x86, 0xB4, 0x01, 0x43, 0xE1, 0x86, - 0xB5, 0x01, 0x44, 0x20, 0xE3, 0x82, 0x99, 0x0D, - 0x44, 0x20, 0xE3, 0x82, 0x9A, 0x0D, 0x44, 0xC2, + 0x81, 0xC9, 0x44, 0xCF, 0x89, 0xCC, 0x81, 0xC9, + 0x44, 0xD7, 0x90, 0xD6, 0xB7, 0x31, 0x44, 0xD7, + 0x90, 0xD6, 0xB8, 0x35, 0x44, 0xD7, 0x90, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0x91, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0x91, 0xD6, 0xBF, 0x49, 0x44, 0xD7, + 0x92, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x93, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0x94, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0x95, 0xD6, 0xB9, 0x39, 0x44, 0xD7, // Bytes 4380 - 43bf - 0xA8, 0xCC, 0x81, 0xCA, 0x44, 0xCE, 0x91, 0xCC, - 0x81, 0xC9, 0x44, 0xCE, 0x95, 0xCC, 0x81, 0xC9, - 0x44, 0xCE, 0x97, 0xCC, 0x81, 0xC9, 0x44, 0xCE, - 0x99, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0x9F, 0xCC, - 0x81, 0xC9, 0x44, 0xCE, 0xA5, 0xCC, 0x81, 0xC9, - 0x44, 0xCE, 0xA5, 0xCC, 0x88, 0xC9, 0x44, 0xCE, - 0xA9, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0xB1, 0xCC, - 0x81, 0xC9, 0x44, 0xCE, 0xB5, 0xCC, 0x81, 0xC9, + 0x95, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x96, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0x98, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0x99, 0xD6, 0xB4, 0x25, 0x44, 0xD7, + 0x99, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x9A, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0x9B, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0x9B, 0xD6, 0xBF, 0x49, 0x44, 0xD7, + 0x9C, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x9E, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0xA0, 0xD6, 0xBC, 0x41, // Bytes 43c0 - 43ff - 0x44, 0xCE, 0xB7, 0xCC, 0x81, 0xC9, 0x44, 0xCE, - 0xB9, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0xBF, 0xCC, - 0x81, 0xC9, 0x44, 0xCF, 0x85, 0xCC, 0x81, 0xC9, - 0x44, 0xCF, 0x89, 0xCC, 0x81, 0xC9, 0x44, 0xD7, - 0x90, 0xD6, 0xB7, 0x31, 0x44, 0xD7, 0x90, 0xD6, - 0xB8, 0x35, 0x44, 0xD7, 0x90, 0xD6, 0xBC, 0x41, - 0x44, 0xD7, 0x91, 0xD6, 0xBC, 0x41, 0x44, 0xD7, - 0x91, 0xD6, 0xBF, 0x49, 0x44, 0xD7, 0x92, 0xD6, + 0x44, 0xD7, 0xA1, 0xD6, 0xBC, 0x41, 0x44, 0xD7, + 0xA3, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0xA4, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0xA4, 0xD6, 0xBF, 0x49, + 0x44, 0xD7, 0xA6, 0xD6, 0xBC, 0x41, 0x44, 0xD7, + 0xA7, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0xA8, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0xA9, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0xA9, 0xD7, 0x81, 0x4D, 0x44, 0xD7, + 0xA9, 0xD7, 0x82, 0x51, 0x44, 0xD7, 0xAA, 0xD6, // Bytes 4400 - 443f - 0xBC, 0x41, 0x44, 0xD7, 0x93, 0xD6, 0xBC, 0x41, - 0x44, 0xD7, 0x94, 0xD6, 0xBC, 0x41, 0x44, 0xD7, - 0x95, 0xD6, 0xB9, 0x39, 0x44, 0xD7, 0x95, 0xD6, - 0xBC, 0x41, 0x44, 0xD7, 0x96, 0xD6, 0xBC, 0x41, - 0x44, 0xD7, 0x98, 0xD6, 0xBC, 0x41, 0x44, 0xD7, - 0x99, 0xD6, 0xB4, 0x25, 0x44, 0xD7, 0x99, 0xD6, - 0xBC, 0x41, 0x44, 0xD7, 0x9A, 0xD6, 0xBC, 0x41, - 0x44, 0xD7, 0x9B, 0xD6, 0xBC, 0x41, 0x44, 0xD7, + 0xBC, 0x41, 0x44, 0xD7, 0xB2, 0xD6, 0xB7, 0x31, + 0x44, 0xD8, 0xA7, 0xD9, 0x8B, 0x59, 0x44, 0xD8, + 0xA7, 0xD9, 0x93, 0xC9, 0x44, 0xD8, 0xA7, 0xD9, + 0x94, 0xC9, 0x44, 0xD8, 0xA7, 0xD9, 0x95, 0xB5, + 0x44, 0xD8, 0xB0, 0xD9, 0xB0, 0x79, 0x44, 0xD8, + 0xB1, 0xD9, 0xB0, 0x79, 0x44, 0xD9, 0x80, 0xD9, + 0x8B, 0x59, 0x44, 0xD9, 0x80, 0xD9, 0x8E, 0x65, + 0x44, 0xD9, 0x80, 0xD9, 0x8F, 0x69, 0x44, 0xD9, // Bytes 4440 - 447f - 0x9B, 0xD6, 0xBF, 0x49, 0x44, 0xD7, 0x9C, 0xD6, - 0xBC, 0x41, 0x44, 0xD7, 0x9E, 0xD6, 0xBC, 0x41, - 0x44, 0xD7, 0xA0, 0xD6, 0xBC, 0x41, 0x44, 0xD7, - 0xA1, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0xA3, 0xD6, - 0xBC, 0x41, 0x44, 0xD7, 0xA4, 0xD6, 0xBC, 0x41, - 0x44, 0xD7, 0xA4, 0xD6, 0xBF, 0x49, 0x44, 0xD7, - 0xA6, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0xA7, 0xD6, - 0xBC, 0x41, 0x44, 0xD7, 0xA8, 0xD6, 0xBC, 0x41, + 0x80, 0xD9, 0x90, 0x6D, 0x44, 0xD9, 0x80, 0xD9, + 0x91, 0x71, 0x44, 0xD9, 0x80, 0xD9, 0x92, 0x75, + 0x44, 0xD9, 0x87, 0xD9, 0xB0, 0x79, 0x44, 0xD9, + 0x88, 0xD9, 0x94, 0xC9, 0x44, 0xD9, 0x89, 0xD9, + 0xB0, 0x79, 0x44, 0xD9, 0x8A, 0xD9, 0x94, 0xC9, + 0x44, 0xDB, 0x92, 0xD9, 0x94, 0xC9, 0x44, 0xDB, + 0x95, 0xD9, 0x94, 0xC9, 0x45, 0x20, 0xCC, 0x88, + 0xCC, 0x80, 0xCA, 0x45, 0x20, 0xCC, 0x88, 0xCC, // Bytes 4480 - 44bf - 0x44, 0xD7, 0xA9, 0xD6, 0xBC, 0x41, 0x44, 0xD7, - 0xA9, 0xD7, 0x81, 0x4D, 0x44, 0xD7, 0xA9, 0xD7, - 0x82, 0x51, 0x44, 0xD7, 0xAA, 0xD6, 0xBC, 0x41, - 0x44, 0xD7, 0xB2, 0xD6, 0xB7, 0x31, 0x44, 0xD8, - 0xA7, 0xD9, 0x8B, 0x59, 0x44, 0xD8, 0xA7, 0xD9, - 0x93, 0xC9, 0x44, 0xD8, 0xA7, 0xD9, 0x94, 0xC9, - 0x44, 0xD8, 0xA7, 0xD9, 0x95, 0xB5, 0x44, 0xD8, - 0xB0, 0xD9, 0xB0, 0x79, 0x44, 0xD8, 0xB1, 0xD9, + 0x81, 0xCA, 0x45, 0x20, 0xCC, 0x88, 0xCD, 0x82, + 0xCA, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x80, 0xCA, + 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x45, + 0x20, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x45, 0x20, + 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x45, 0x20, 0xCC, + 0x94, 0xCC, 0x81, 0xCA, 0x45, 0x20, 0xCC, 0x94, + 0xCD, 0x82, 0xCA, 0x45, 0x20, 0xD9, 0x8C, 0xD9, + 0x91, 0x72, 0x45, 0x20, 0xD9, 0x8D, 0xD9, 0x91, // Bytes 44c0 - 44ff - 0xB0, 0x79, 0x44, 0xD9, 0x80, 0xD9, 0x8B, 0x59, - 0x44, 0xD9, 0x80, 0xD9, 0x8E, 0x65, 0x44, 0xD9, - 0x80, 0xD9, 0x8F, 0x69, 0x44, 0xD9, 0x80, 0xD9, - 0x90, 0x6D, 0x44, 0xD9, 0x80, 0xD9, 0x91, 0x71, - 0x44, 0xD9, 0x80, 0xD9, 0x92, 0x75, 0x44, 0xD9, - 0x87, 0xD9, 0xB0, 0x79, 0x44, 0xD9, 0x88, 0xD9, - 0x94, 0xC9, 0x44, 0xD9, 0x89, 0xD9, 0xB0, 0x79, - 0x44, 0xD9, 0x8A, 0xD9, 0x94, 0xC9, 0x44, 0xDB, + 0x72, 0x45, 0x20, 0xD9, 0x8E, 0xD9, 0x91, 0x72, + 0x45, 0x20, 0xD9, 0x8F, 0xD9, 0x91, 0x72, 0x45, + 0x20, 0xD9, 0x90, 0xD9, 0x91, 0x72, 0x45, 0x20, + 0xD9, 0x91, 0xD9, 0xB0, 0x7A, 0x45, 0xE2, 0xAB, + 0x9D, 0xCC, 0xB8, 0x05, 0x46, 0xCE, 0xB9, 0xCC, + 0x88, 0xCC, 0x81, 0xCA, 0x46, 0xCF, 0x85, 0xCC, + 0x88, 0xCC, 0x81, 0xCA, 0x46, 0xD7, 0xA9, 0xD6, + 0xBC, 0xD7, 0x81, 0x4E, 0x46, 0xD7, 0xA9, 0xD6, // Bytes 4500 - 453f - 0x92, 0xD9, 0x94, 0xC9, 0x44, 0xDB, 0x95, 0xD9, - 0x94, 0xC9, 0x45, 0x20, 0xCC, 0x88, 0xCC, 0x80, - 0xCA, 0x45, 0x20, 0xCC, 0x88, 0xCC, 0x81, 0xCA, - 0x45, 0x20, 0xCC, 0x88, 0xCD, 0x82, 0xCA, 0x45, - 0x20, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x45, 0x20, - 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x45, 0x20, 0xCC, - 0x93, 0xCD, 0x82, 0xCA, 0x45, 0x20, 0xCC, 0x94, - 0xCC, 0x80, 0xCA, 0x45, 0x20, 0xCC, 0x94, 0xCC, + 0xBC, 0xD7, 0x82, 0x52, 0x46, 0xD9, 0x80, 0xD9, + 0x8E, 0xD9, 0x91, 0x72, 0x46, 0xD9, 0x80, 0xD9, + 0x8F, 0xD9, 0x91, 0x72, 0x46, 0xD9, 0x80, 0xD9, + 0x90, 0xD9, 0x91, 0x72, 0x46, 0xE0, 0xA4, 0x95, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x96, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x97, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x9C, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xA1, // Bytes 4540 - 457f - 0x81, 0xCA, 0x45, 0x20, 0xCC, 0x94, 0xCD, 0x82, - 0xCA, 0x45, 0x20, 0xD9, 0x8C, 0xD9, 0x91, 0x72, - 0x45, 0x20, 0xD9, 0x8D, 0xD9, 0x91, 0x72, 0x45, - 0x20, 0xD9, 0x8E, 0xD9, 0x91, 0x72, 0x45, 0x20, - 0xD9, 0x8F, 0xD9, 0x91, 0x72, 0x45, 0x20, 0xD9, - 0x90, 0xD9, 0x91, 0x72, 0x45, 0x20, 0xD9, 0x91, - 0xD9, 0xB0, 0x7A, 0x45, 0xE2, 0xAB, 0x9D, 0xCC, - 0xB8, 0x05, 0x46, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xA2, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xAB, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xAF, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xA1, + 0xE0, 0xA6, 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xA2, + 0xE0, 0xA6, 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xAF, + 0xE0, 0xA6, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x96, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x97, // Bytes 4580 - 45bf - 0x81, 0xCA, 0x46, 0xCF, 0x85, 0xCC, 0x88, 0xCC, - 0x81, 0xCA, 0x46, 0xD7, 0xA9, 0xD6, 0xBC, 0xD7, - 0x81, 0x4E, 0x46, 0xD7, 0xA9, 0xD6, 0xBC, 0xD7, - 0x82, 0x52, 0x46, 0xD9, 0x80, 0xD9, 0x8E, 0xD9, - 0x91, 0x72, 0x46, 0xD9, 0x80, 0xD9, 0x8F, 0xD9, - 0x91, 0x72, 0x46, 0xD9, 0x80, 0xD9, 0x90, 0xD9, - 0x91, 0x72, 0x46, 0xE0, 0xA4, 0x95, 0xE0, 0xA4, - 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x96, 0xE0, 0xA4, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x9C, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xAB, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xB2, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xB8, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xAC, 0xA1, + 0xE0, 0xAC, 0xBC, 0x09, 0x46, 0xE0, 0xAC, 0xA2, + 0xE0, 0xAC, 0xBC, 0x09, 0x46, 0xE0, 0xBE, 0xB2, + 0xE0, 0xBE, 0x80, 0x9D, 0x46, 0xE0, 0xBE, 0xB3, // Bytes 45c0 - 45ff - 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x97, 0xE0, 0xA4, - 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x9C, 0xE0, 0xA4, - 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xA1, 0xE0, 0xA4, - 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xA2, 0xE0, 0xA4, - 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xAB, 0xE0, 0xA4, - 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xAF, 0xE0, 0xA4, - 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xA1, 0xE0, 0xA6, - 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xA2, 0xE0, 0xA6, + 0xE0, 0xBE, 0x80, 0x9D, 0x46, 0xE3, 0x83, 0x86, + 0xE3, 0x82, 0x99, 0x0D, 0x48, 0xF0, 0x9D, 0x85, + 0x97, 0xF0, 0x9D, 0x85, 0xA5, 0xAD, 0x48, 0xF0, + 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xAD, + 0x48, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, + 0xA5, 0xAD, 0x48, 0xF0, 0x9D, 0x86, 0xBA, 0xF0, + 0x9D, 0x85, 0xA5, 0xAD, 0x49, 0xE0, 0xBE, 0xB2, + 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0x9E, 0x49, // Bytes 4600 - 463f - 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xAF, 0xE0, 0xA6, - 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x96, 0xE0, 0xA8, - 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x97, 0xE0, 0xA8, - 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x9C, 0xE0, 0xA8, - 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xAB, 0xE0, 0xA8, - 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xB2, 0xE0, 0xA8, - 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xB8, 0xE0, 0xA8, - 0xBC, 0x09, 0x46, 0xE0, 0xAC, 0xA1, 0xE0, 0xAC, - // Bytes 4640 - 467f - 0xBC, 0x09, 0x46, 0xE0, 0xAC, 0xA2, 0xE0, 0xAC, - 0xBC, 0x09, 0x46, 0xE0, 0xBE, 0xB2, 0xE0, 0xBE, - 0x80, 0x9D, 0x46, 0xE0, 0xBE, 0xB3, 0xE0, 0xBE, - 0x80, 0x9D, 0x46, 0xE3, 0x83, 0x86, 0xE3, 0x82, - 0x99, 0x0D, 0x48, 0xF0, 0x9D, 0x85, 0x97, 0xF0, - 0x9D, 0x85, 0xA5, 0xAD, 0x48, 0xF0, 0x9D, 0x85, - 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xAD, 0x48, 0xF0, - 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, 0xAD, - // Bytes 4680 - 46bf - 0x48, 0xF0, 0x9D, 0x86, 0xBA, 0xF0, 0x9D, 0x85, - 0xA5, 0xAD, 0x49, 0xE0, 0xBE, 0xB2, 0xE0, 0xBD, - 0xB1, 0xE0, 0xBE, 0x80, 0x9E, 0x49, 0xE0, 0xBE, - 0xB3, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0x9E, + 0xE0, 0xBE, 0xB3, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, + 0x80, 0x9E, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, + 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xAE, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, - 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xAE, 0x4C, 0xF0, + 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xAE, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, - 0x9D, 0x85, 0xAF, 0xAE, 0x4C, 0xF0, 0x9D, 0x85, - // Bytes 46c0 - 46ff + 0x9D, 0x85, 0xB0, 0xAE, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, - 0xB0, 0xAE, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, - 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xB1, 0xAE, - 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, - 0xA5, 0xF0, 0x9D, 0x85, 0xB2, 0xAE, 0x4C, 0xF0, + // Bytes 4640 - 467f + 0xB1, 0xAE, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, + 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xB2, 0xAE, + 0x4C, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, + 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xAE, 0x4C, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, - 0x9D, 0x85, 0xAE, 0xAE, 0x4C, 0xF0, 0x9D, 0x86, - 0xB9, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, + 0x9D, 0x85, 0xAF, 0xAE, 0x4C, 0xF0, 0x9D, 0x86, + 0xBA, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, + 0xAE, 0xAE, 0x4C, 0xF0, 0x9D, 0x86, 0xBA, 0xF0, + // Bytes 4680 - 46bf + 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xAE, + 0x83, 0x41, 0xCC, 0x82, 0xC9, 0x83, 0x41, 0xCC, + 0x86, 0xC9, 0x83, 0x41, 0xCC, 0x87, 0xC9, 0x83, + 0x41, 0xCC, 0x88, 0xC9, 0x83, 0x41, 0xCC, 0x8A, + 0xC9, 0x83, 0x41, 0xCC, 0xA3, 0xB5, 0x83, 0x43, + 0xCC, 0xA7, 0xA5, 0x83, 0x45, 0xCC, 0x82, 0xC9, + 0x83, 0x45, 0xCC, 0x84, 0xC9, 0x83, 0x45, 0xCC, + 0xA3, 0xB5, 0x83, 0x45, 0xCC, 0xA7, 0xA5, 0x83, + // Bytes 46c0 - 46ff + 0x49, 0xCC, 0x88, 0xC9, 0x83, 0x4C, 0xCC, 0xA3, + 0xB5, 0x83, 0x4F, 0xCC, 0x82, 0xC9, 0x83, 0x4F, + 0xCC, 0x83, 0xC9, 0x83, 0x4F, 0xCC, 0x84, 0xC9, + 0x83, 0x4F, 0xCC, 0x87, 0xC9, 0x83, 0x4F, 0xCC, + 0x88, 0xC9, 0x83, 0x4F, 0xCC, 0x9B, 0xAD, 0x83, + 0x4F, 0xCC, 0xA3, 0xB5, 0x83, 0x4F, 0xCC, 0xA8, + 0xA5, 0x83, 0x52, 0xCC, 0xA3, 0xB5, 0x83, 0x53, + 0xCC, 0x81, 0xC9, 0x83, 0x53, 0xCC, 0x8C, 0xC9, // Bytes 4700 - 473f - 0xAF, 0xAE, 0x4C, 0xF0, 0x9D, 0x86, 0xBA, 0xF0, - 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xAE, - 0x4C, 0xF0, 0x9D, 0x86, 0xBA, 0xF0, 0x9D, 0x85, - 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xAE, 0x83, 0x41, - 0xCC, 0x82, 0xC9, 0x83, 0x41, 0xCC, 0x86, 0xC9, - 0x83, 0x41, 0xCC, 0x87, 0xC9, 0x83, 0x41, 0xCC, - 0x88, 0xC9, 0x83, 0x41, 0xCC, 0x8A, 0xC9, 0x83, - 0x41, 0xCC, 0xA3, 0xB5, 0x83, 0x43, 0xCC, 0xA7, + 0x83, 0x53, 0xCC, 0xA3, 0xB5, 0x83, 0x55, 0xCC, + 0x83, 0xC9, 0x83, 0x55, 0xCC, 0x84, 0xC9, 0x83, + 0x55, 0xCC, 0x88, 0xC9, 0x83, 0x55, 0xCC, 0x9B, + 0xAD, 0x83, 0x61, 0xCC, 0x82, 0xC9, 0x83, 0x61, + 0xCC, 0x86, 0xC9, 0x83, 0x61, 0xCC, 0x87, 0xC9, + 0x83, 0x61, 0xCC, 0x88, 0xC9, 0x83, 0x61, 0xCC, + 0x8A, 0xC9, 0x83, 0x61, 0xCC, 0xA3, 0xB5, 0x83, + 0x63, 0xCC, 0xA7, 0xA5, 0x83, 0x65, 0xCC, 0x82, // Bytes 4740 - 477f - 0xA5, 0x83, 0x45, 0xCC, 0x82, 0xC9, 0x83, 0x45, - 0xCC, 0x84, 0xC9, 0x83, 0x45, 0xCC, 0xA3, 0xB5, - 0x83, 0x45, 0xCC, 0xA7, 0xA5, 0x83, 0x49, 0xCC, - 0x88, 0xC9, 0x83, 0x4C, 0xCC, 0xA3, 0xB5, 0x83, - 0x4F, 0xCC, 0x82, 0xC9, 0x83, 0x4F, 0xCC, 0x83, - 0xC9, 0x83, 0x4F, 0xCC, 0x84, 0xC9, 0x83, 0x4F, - 0xCC, 0x87, 0xC9, 0x83, 0x4F, 0xCC, 0x88, 0xC9, - 0x83, 0x4F, 0xCC, 0x9B, 0xAD, 0x83, 0x4F, 0xCC, + 0xC9, 0x83, 0x65, 0xCC, 0x84, 0xC9, 0x83, 0x65, + 0xCC, 0xA3, 0xB5, 0x83, 0x65, 0xCC, 0xA7, 0xA5, + 0x83, 0x69, 0xCC, 0x88, 0xC9, 0x83, 0x6C, 0xCC, + 0xA3, 0xB5, 0x83, 0x6F, 0xCC, 0x82, 0xC9, 0x83, + 0x6F, 0xCC, 0x83, 0xC9, 0x83, 0x6F, 0xCC, 0x84, + 0xC9, 0x83, 0x6F, 0xCC, 0x87, 0xC9, 0x83, 0x6F, + 0xCC, 0x88, 0xC9, 0x83, 0x6F, 0xCC, 0x9B, 0xAD, + 0x83, 0x6F, 0xCC, 0xA3, 0xB5, 0x83, 0x6F, 0xCC, // Bytes 4780 - 47bf - 0xA3, 0xB5, 0x83, 0x4F, 0xCC, 0xA8, 0xA5, 0x83, - 0x52, 0xCC, 0xA3, 0xB5, 0x83, 0x53, 0xCC, 0x81, - 0xC9, 0x83, 0x53, 0xCC, 0x8C, 0xC9, 0x83, 0x53, - 0xCC, 0xA3, 0xB5, 0x83, 0x55, 0xCC, 0x83, 0xC9, - 0x83, 0x55, 0xCC, 0x84, 0xC9, 0x83, 0x55, 0xCC, - 0x88, 0xC9, 0x83, 0x55, 0xCC, 0x9B, 0xAD, 0x83, - 0x61, 0xCC, 0x82, 0xC9, 0x83, 0x61, 0xCC, 0x86, - 0xC9, 0x83, 0x61, 0xCC, 0x87, 0xC9, 0x83, 0x61, + 0xA8, 0xA5, 0x83, 0x72, 0xCC, 0xA3, 0xB5, 0x83, + 0x73, 0xCC, 0x81, 0xC9, 0x83, 0x73, 0xCC, 0x8C, + 0xC9, 0x83, 0x73, 0xCC, 0xA3, 0xB5, 0x83, 0x75, + 0xCC, 0x83, 0xC9, 0x83, 0x75, 0xCC, 0x84, 0xC9, + 0x83, 0x75, 0xCC, 0x88, 0xC9, 0x83, 0x75, 0xCC, + 0x9B, 0xAD, 0x84, 0xCE, 0x91, 0xCC, 0x93, 0xC9, + 0x84, 0xCE, 0x91, 0xCC, 0x94, 0xC9, 0x84, 0xCE, + 0x95, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0x95, 0xCC, // Bytes 47c0 - 47ff - 0xCC, 0x88, 0xC9, 0x83, 0x61, 0xCC, 0x8A, 0xC9, - 0x83, 0x61, 0xCC, 0xA3, 0xB5, 0x83, 0x63, 0xCC, - 0xA7, 0xA5, 0x83, 0x65, 0xCC, 0x82, 0xC9, 0x83, - 0x65, 0xCC, 0x84, 0xC9, 0x83, 0x65, 0xCC, 0xA3, - 0xB5, 0x83, 0x65, 0xCC, 0xA7, 0xA5, 0x83, 0x69, - 0xCC, 0x88, 0xC9, 0x83, 0x6C, 0xCC, 0xA3, 0xB5, - 0x83, 0x6F, 0xCC, 0x82, 0xC9, 0x83, 0x6F, 0xCC, - 0x83, 0xC9, 0x83, 0x6F, 0xCC, 0x84, 0xC9, 0x83, + 0x94, 0xC9, 0x84, 0xCE, 0x97, 0xCC, 0x93, 0xC9, + 0x84, 0xCE, 0x97, 0xCC, 0x94, 0xC9, 0x84, 0xCE, + 0x99, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0x99, 0xCC, + 0x94, 0xC9, 0x84, 0xCE, 0x9F, 0xCC, 0x93, 0xC9, + 0x84, 0xCE, 0x9F, 0xCC, 0x94, 0xC9, 0x84, 0xCE, + 0xA5, 0xCC, 0x94, 0xC9, 0x84, 0xCE, 0xA9, 0xCC, + 0x93, 0xC9, 0x84, 0xCE, 0xA9, 0xCC, 0x94, 0xC9, + 0x84, 0xCE, 0xB1, 0xCC, 0x80, 0xC9, 0x84, 0xCE, // Bytes 4800 - 483f - 0x6F, 0xCC, 0x87, 0xC9, 0x83, 0x6F, 0xCC, 0x88, - 0xC9, 0x83, 0x6F, 0xCC, 0x9B, 0xAD, 0x83, 0x6F, - 0xCC, 0xA3, 0xB5, 0x83, 0x6F, 0xCC, 0xA8, 0xA5, - 0x83, 0x72, 0xCC, 0xA3, 0xB5, 0x83, 0x73, 0xCC, - 0x81, 0xC9, 0x83, 0x73, 0xCC, 0x8C, 0xC9, 0x83, - 0x73, 0xCC, 0xA3, 0xB5, 0x83, 0x75, 0xCC, 0x83, - 0xC9, 0x83, 0x75, 0xCC, 0x84, 0xC9, 0x83, 0x75, - 0xCC, 0x88, 0xC9, 0x83, 0x75, 0xCC, 0x9B, 0xAD, + 0xB1, 0xCC, 0x81, 0xC9, 0x84, 0xCE, 0xB1, 0xCC, + 0x93, 0xC9, 0x84, 0xCE, 0xB1, 0xCC, 0x94, 0xC9, + 0x84, 0xCE, 0xB1, 0xCD, 0x82, 0xC9, 0x84, 0xCE, + 0xB5, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0xB5, 0xCC, + 0x94, 0xC9, 0x84, 0xCE, 0xB7, 0xCC, 0x80, 0xC9, + 0x84, 0xCE, 0xB7, 0xCC, 0x81, 0xC9, 0x84, 0xCE, + 0xB7, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0xB7, 0xCC, + 0x94, 0xC9, 0x84, 0xCE, 0xB7, 0xCD, 0x82, 0xC9, // Bytes 4840 - 487f - 0x84, 0xCE, 0x91, 0xCC, 0x93, 0xC9, 0x84, 0xCE, - 0x91, 0xCC, 0x94, 0xC9, 0x84, 0xCE, 0x95, 0xCC, - 0x93, 0xC9, 0x84, 0xCE, 0x95, 0xCC, 0x94, 0xC9, - 0x84, 0xCE, 0x97, 0xCC, 0x93, 0xC9, 0x84, 0xCE, - 0x97, 0xCC, 0x94, 0xC9, 0x84, 0xCE, 0x99, 0xCC, - 0x93, 0xC9, 0x84, 0xCE, 0x99, 0xCC, 0x94, 0xC9, - 0x84, 0xCE, 0x9F, 0xCC, 0x93, 0xC9, 0x84, 0xCE, - 0x9F, 0xCC, 0x94, 0xC9, 0x84, 0xCE, 0xA5, 0xCC, + 0x84, 0xCE, 0xB9, 0xCC, 0x88, 0xC9, 0x84, 0xCE, + 0xB9, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0xB9, 0xCC, + 0x94, 0xC9, 0x84, 0xCE, 0xBF, 0xCC, 0x93, 0xC9, + 0x84, 0xCE, 0xBF, 0xCC, 0x94, 0xC9, 0x84, 0xCF, + 0x85, 0xCC, 0x88, 0xC9, 0x84, 0xCF, 0x85, 0xCC, + 0x93, 0xC9, 0x84, 0xCF, 0x85, 0xCC, 0x94, 0xC9, + 0x84, 0xCF, 0x89, 0xCC, 0x80, 0xC9, 0x84, 0xCF, + 0x89, 0xCC, 0x81, 0xC9, 0x84, 0xCF, 0x89, 0xCC, // Bytes 4880 - 48bf - 0x94, 0xC9, 0x84, 0xCE, 0xA9, 0xCC, 0x93, 0xC9, - 0x84, 0xCE, 0xA9, 0xCC, 0x94, 0xC9, 0x84, 0xCE, - 0xB1, 0xCC, 0x80, 0xC9, 0x84, 0xCE, 0xB1, 0xCC, - 0x81, 0xC9, 0x84, 0xCE, 0xB1, 0xCC, 0x93, 0xC9, - 0x84, 0xCE, 0xB1, 0xCC, 0x94, 0xC9, 0x84, 0xCE, - 0xB1, 0xCD, 0x82, 0xC9, 0x84, 0xCE, 0xB5, 0xCC, - 0x93, 0xC9, 0x84, 0xCE, 0xB5, 0xCC, 0x94, 0xC9, - 0x84, 0xCE, 0xB7, 0xCC, 0x80, 0xC9, 0x84, 0xCE, + 0x93, 0xC9, 0x84, 0xCF, 0x89, 0xCC, 0x94, 0xC9, + 0x84, 0xCF, 0x89, 0xCD, 0x82, 0xC9, 0x86, 0xCE, + 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, // Bytes 48c0 - 48ff - 0xB7, 0xCC, 0x81, 0xC9, 0x84, 0xCE, 0xB7, 0xCC, - 0x93, 0xC9, 0x84, 0xCE, 0xB7, 0xCC, 0x94, 0xC9, - 0x84, 0xCE, 0xB7, 0xCD, 0x82, 0xC9, 0x84, 0xCE, - 0xB9, 0xCC, 0x88, 0xC9, 0x84, 0xCE, 0xB9, 0xCC, - 0x93, 0xC9, 0x84, 0xCE, 0xB9, 0xCC, 0x94, 0xC9, - 0x84, 0xCE, 0xBF, 0xCC, 0x93, 0xC9, 0x84, 0xCE, - 0xBF, 0xCC, 0x94, 0xC9, 0x84, 0xCF, 0x85, 0xCC, - 0x88, 0xC9, 0x84, 0xCF, 0x85, 0xCC, 0x93, 0xC9, + 0x97, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, // Bytes 4900 - 493f - 0x84, 0xCF, 0x85, 0xCC, 0x94, 0xC9, 0x84, 0xCF, - 0x89, 0xCC, 0x80, 0xC9, 0x84, 0xCF, 0x89, 0xCC, - 0x81, 0xC9, 0x84, 0xCF, 0x89, 0xCC, 0x93, 0xC9, - 0x84, 0xCF, 0x89, 0xCC, 0x94, 0xC9, 0x84, 0xCF, - 0x89, 0xCD, 0x82, 0xC9, 0x86, 0xCE, 0x91, 0xCC, - 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0x91, 0xCC, - 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0x91, 0xCC, - 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, 0x91, 0xCC, + 0xA9, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, // Bytes 4940 - 497f - 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0x91, 0xCC, - 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0x91, 0xCC, - 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, 0x97, 0xCC, - 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0x97, 0xCC, - 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0x97, 0xCC, - 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, 0x97, 0xCC, - 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0x97, 0xCC, - 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0x97, 0xCC, + 0xB1, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCF, // Bytes 4980 - 49bf - 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, 0xA9, 0xCC, - 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0xA9, 0xCC, - 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0xA9, 0xCC, - 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, 0xA9, 0xCC, - 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0xA9, 0xCC, - 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0xA9, 0xCC, - 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, 0xB1, 0xCC, - 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0xB1, 0xCC, + 0x89, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x42, 0xCC, + 0x80, 0xC9, 0x32, 0x42, 0xCC, 0x81, 0xC9, 0x32, + 0x42, 0xCC, 0x93, 0xC9, 0x32, 0x43, 0xE1, 0x85, // Bytes 49c0 - 49ff - 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0xB1, 0xCC, - 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, 0xB1, 0xCC, - 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0xB1, 0xCC, - 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0xB1, 0xCC, - 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, 0xB7, 0xCC, - 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0xB7, 0xCC, - 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0xB7, 0xCC, - 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, 0xB7, 0xCC, + 0xA1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA2, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xA3, 0x01, 0x00, 0x43, + 0xE1, 0x85, 0xA4, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xA5, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA6, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xA7, 0x01, 0x00, 0x43, + 0xE1, 0x85, 0xA8, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xA9, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAA, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xAB, 0x01, 0x00, 0x43, // Bytes 4a00 - 4a3f - 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, 0xB7, 0xCC, - 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, 0xB7, 0xCC, - 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCF, 0x89, 0xCC, - 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCF, 0x89, 0xCC, - 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCF, 0x89, 0xCC, - 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCF, 0x89, 0xCC, - 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCF, 0x89, 0xCC, - 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCF, 0x89, 0xCC, + 0xE1, 0x85, 0xAC, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAE, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xAF, 0x01, 0x00, 0x43, + 0xE1, 0x85, 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xB1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB2, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xB3, 0x01, 0x00, 0x43, + 0xE1, 0x85, 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xB5, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAA, 0x01, // Bytes 4a40 - 4a7f - 0x94, 0xCD, 0x82, 0xCA, 0x42, 0xCC, 0x80, 0xC9, - 0x32, 0x42, 0xCC, 0x81, 0xC9, 0x32, 0x42, 0xCC, - 0x93, 0xC9, 0x32, 0x44, 0xCC, 0x88, 0xCC, 0x81, - 0xCA, 0x32, 0x43, 0xE3, 0x82, 0x99, 0x0D, 0x03, - 0x43, 0xE3, 0x82, 0x9A, 0x0D, 0x03, 0x46, 0xE0, - 0xBD, 0xB1, 0xE0, 0xBD, 0xB2, 0x9E, 0x26, 0x46, - 0xE0, 0xBD, 0xB1, 0xE0, 0xBD, 0xB4, 0xA2, 0x26, - 0x46, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0x9E, + 0x00, 0x43, 0xE1, 0x86, 0xAC, 0x01, 0x00, 0x43, + 0xE1, 0x86, 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x86, + 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB1, 0x01, + 0x00, 0x43, 0xE1, 0x86, 0xB2, 0x01, 0x00, 0x43, + 0xE1, 0x86, 0xB3, 0x01, 0x00, 0x43, 0xE1, 0x86, + 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB5, 0x01, + 0x00, 0x44, 0xCC, 0x88, 0xCC, 0x81, 0xCA, 0x32, + 0x43, 0xE3, 0x82, 0x99, 0x0D, 0x03, 0x43, 0xE3, // Bytes 4a80 - 4abf - 0x26, 0x00, 0x01, + 0x82, 0x9A, 0x0D, 0x03, 0x46, 0xE0, 0xBD, 0xB1, + 0xE0, 0xBD, 0xB2, 0x9E, 0x26, 0x46, 0xE0, 0xBD, + 0xB1, 0xE0, 0xBD, 0xB4, 0xA2, 0x26, 0x46, 0xE0, + 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0x9E, 0x26, 0x00, + 0x01, } // lookup returns the trie value for the first UTF-8 encoding in s and @@ -2892,7 +2896,7 @@ func (t *nfcTrie) lookupStringUnsafe(s string) uint16 { return 0 } -// nfcTrie. Total size: 10332 bytes (10.09 KiB). Checksum: ad355b768fddb1b6. +// nfcTrie. Total size: 10332 bytes (10.09 KiB). Checksum: 51cc525b297fc970. type nfcTrie struct{} func newNfcTrie(i int) *nfcTrie { @@ -2928,22 +2932,22 @@ var nfcValues = [2944]uint16{ 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, // Block 0x2, offset 0x80 // Block 0x3, offset 0xc0 - 0xc0: 0x2f6f, 0xc1: 0x2f74, 0xc2: 0x471e, 0xc3: 0x2f79, 0xc4: 0x472d, 0xc5: 0x4732, - 0xc6: 0xa000, 0xc7: 0x473c, 0xc8: 0x2fe2, 0xc9: 0x2fe7, 0xca: 0x4741, 0xcb: 0x2ffb, - 0xcc: 0x306e, 0xcd: 0x3073, 0xce: 0x3078, 0xcf: 0x4755, 0xd1: 0x3104, - 0xd2: 0x3127, 0xd3: 0x312c, 0xd4: 0x475f, 0xd5: 0x4764, 0xd6: 0x4773, - 0xd8: 0xa000, 0xd9: 0x31b3, 0xda: 0x31b8, 0xdb: 0x31bd, 0xdc: 0x47a5, 0xdd: 0x3235, - 0xe0: 0x327b, 0xe1: 0x3280, 0xe2: 0x47af, 0xe3: 0x3285, - 0xe4: 0x47be, 0xe5: 0x47c3, 0xe6: 0xa000, 0xe7: 0x47cd, 0xe8: 0x32ee, 0xe9: 0x32f3, - 0xea: 0x47d2, 0xeb: 0x3307, 0xec: 0x337f, 0xed: 0x3384, 0xee: 0x3389, 0xef: 0x47e6, - 0xf1: 0x3415, 0xf2: 0x3438, 0xf3: 0x343d, 0xf4: 0x47f0, 0xf5: 0x47f5, - 0xf6: 0x4804, 0xf8: 0xa000, 0xf9: 0x34c9, 0xfa: 0x34ce, 0xfb: 0x34d3, - 0xfc: 0x4836, 0xfd: 0x3550, 0xff: 0x3569, + 0xc0: 0x2f6f, 0xc1: 0x2f74, 0xc2: 0x4688, 0xc3: 0x2f79, 0xc4: 0x4697, 0xc5: 0x469c, + 0xc6: 0xa000, 0xc7: 0x46a6, 0xc8: 0x2fe2, 0xc9: 0x2fe7, 0xca: 0x46ab, 0xcb: 0x2ffb, + 0xcc: 0x306e, 0xcd: 0x3073, 0xce: 0x3078, 0xcf: 0x46bf, 0xd1: 0x3104, + 0xd2: 0x3127, 0xd3: 0x312c, 0xd4: 0x46c9, 0xd5: 0x46ce, 0xd6: 0x46dd, + 0xd8: 0xa000, 0xd9: 0x31b3, 0xda: 0x31b8, 0xdb: 0x31bd, 0xdc: 0x470f, 0xdd: 0x3235, + 0xe0: 0x327b, 0xe1: 0x3280, 0xe2: 0x4719, 0xe3: 0x3285, + 0xe4: 0x4728, 0xe5: 0x472d, 0xe6: 0xa000, 0xe7: 0x4737, 0xe8: 0x32ee, 0xe9: 0x32f3, + 0xea: 0x473c, 0xeb: 0x3307, 0xec: 0x337f, 0xed: 0x3384, 0xee: 0x3389, 0xef: 0x4750, + 0xf1: 0x3415, 0xf2: 0x3438, 0xf3: 0x343d, 0xf4: 0x475a, 0xf5: 0x475f, + 0xf6: 0x476e, 0xf8: 0xa000, 0xf9: 0x34c9, 0xfa: 0x34ce, 0xfb: 0x34d3, + 0xfc: 0x47a0, 0xfd: 0x3550, 0xff: 0x3569, // Block 0x4, offset 0x100 - 0x100: 0x2f7e, 0x101: 0x328a, 0x102: 0x4723, 0x103: 0x47b4, 0x104: 0x2f9c, 0x105: 0x32a8, + 0x100: 0x2f7e, 0x101: 0x328a, 0x102: 0x468d, 0x103: 0x471e, 0x104: 0x2f9c, 0x105: 0x32a8, 0x106: 0x2fb0, 0x107: 0x32bc, 0x108: 0x2fb5, 0x109: 0x32c1, 0x10a: 0x2fba, 0x10b: 0x32c6, 0x10c: 0x2fbf, 0x10d: 0x32cb, 0x10e: 0x2fc9, 0x10f: 0x32d5, - 0x112: 0x4746, 0x113: 0x47d7, 0x114: 0x2ff1, 0x115: 0x32fd, 0x116: 0x2ff6, 0x117: 0x3302, + 0x112: 0x46b0, 0x113: 0x4741, 0x114: 0x2ff1, 0x115: 0x32fd, 0x116: 0x2ff6, 0x117: 0x3302, 0x118: 0x3014, 0x119: 0x3320, 0x11a: 0x3005, 0x11b: 0x3311, 0x11c: 0x302d, 0x11d: 0x3339, 0x11e: 0x3037, 0x11f: 0x3343, 0x120: 0x303c, 0x121: 0x3348, 0x122: 0x3046, 0x123: 0x3352, 0x124: 0x304b, 0x125: 0x3357, 0x128: 0x307d, 0x129: 0x338e, @@ -2954,12 +2958,12 @@ var nfcValues = [2944]uint16{ // Block 0x5, offset 0x140 0x143: 0x30ff, 0x144: 0x3410, 0x145: 0x3118, 0x146: 0x3429, 0x147: 0x310e, 0x148: 0x341f, - 0x14c: 0x4769, 0x14d: 0x47fa, 0x14e: 0x3131, 0x14f: 0x3442, 0x150: 0x313b, 0x151: 0x344c, + 0x14c: 0x46d3, 0x14d: 0x4764, 0x14e: 0x3131, 0x14f: 0x3442, 0x150: 0x313b, 0x151: 0x344c, 0x154: 0x3159, 0x155: 0x346a, 0x156: 0x3172, 0x157: 0x3483, - 0x158: 0x3163, 0x159: 0x3474, 0x15a: 0x478c, 0x15b: 0x481d, 0x15c: 0x317c, 0x15d: 0x348d, - 0x15e: 0x318b, 0x15f: 0x349c, 0x160: 0x4791, 0x161: 0x4822, 0x162: 0x31a4, 0x163: 0x34ba, - 0x164: 0x3195, 0x165: 0x34ab, 0x168: 0x479b, 0x169: 0x482c, - 0x16a: 0x47a0, 0x16b: 0x4831, 0x16c: 0x31c2, 0x16d: 0x34d8, 0x16e: 0x31cc, 0x16f: 0x34e2, + 0x158: 0x3163, 0x159: 0x3474, 0x15a: 0x46f6, 0x15b: 0x4787, 0x15c: 0x317c, 0x15d: 0x348d, + 0x15e: 0x318b, 0x15f: 0x349c, 0x160: 0x46fb, 0x161: 0x478c, 0x162: 0x31a4, 0x163: 0x34ba, + 0x164: 0x3195, 0x165: 0x34ab, 0x168: 0x4705, 0x169: 0x4796, + 0x16a: 0x470a, 0x16b: 0x479b, 0x16c: 0x31c2, 0x16d: 0x34d8, 0x16e: 0x31cc, 0x16f: 0x34e2, 0x170: 0x31d1, 0x171: 0x34e7, 0x172: 0x31ef, 0x173: 0x3505, 0x174: 0x3212, 0x175: 0x3528, 0x176: 0x323a, 0x177: 0x3555, 0x178: 0x324e, 0x179: 0x325d, 0x17a: 0x357d, 0x17b: 0x3267, 0x17c: 0x3587, 0x17d: 0x326c, 0x17e: 0x358c, 0x17f: 0xa000, @@ -2971,7 +2975,7 @@ var nfcValues = [2944]uint16{ 0x198: 0x3b57, 0x199: 0x39d6, 0x19a: 0x3b65, 0x19b: 0x39c1, 0x19c: 0x3b50, 0x19e: 0x38b0, 0x19f: 0x3a3f, 0x1a0: 0x38a9, 0x1a1: 0x3a38, 0x1a2: 0x35b3, 0x1a3: 0x35c5, 0x1a6: 0x3041, 0x1a7: 0x334d, 0x1a8: 0x30be, 0x1a9: 0x33cf, - 0x1aa: 0x4782, 0x1ab: 0x4813, 0x1ac: 0x3990, 0x1ad: 0x3b1f, 0x1ae: 0x35d7, 0x1af: 0x35dd, + 0x1aa: 0x46ec, 0x1ab: 0x477d, 0x1ac: 0x3990, 0x1ad: 0x3b1f, 0x1ae: 0x35d7, 0x1af: 0x35dd, 0x1b0: 0x33c5, 0x1b4: 0x3028, 0x1b5: 0x3334, 0x1b8: 0x30fa, 0x1b9: 0x340b, 0x1ba: 0x38b7, 0x1bb: 0x3a46, 0x1bc: 0x35ad, 0x1bd: 0x35bf, 0x1be: 0x35b9, 0x1bf: 0x35cb, @@ -2982,8 +2986,8 @@ var nfcValues = [2944]uint16{ 0x1d2: 0x316d, 0x1d3: 0x347e, 0x1d4: 0x31db, 0x1d5: 0x34f1, 0x1d6: 0x31e0, 0x1d7: 0x34f6, 0x1d8: 0x3186, 0x1d9: 0x3497, 0x1da: 0x319f, 0x1db: 0x34b5, 0x1de: 0x305a, 0x1df: 0x3366, - 0x1e6: 0x4728, 0x1e7: 0x47b9, 0x1e8: 0x4750, 0x1e9: 0x47e1, - 0x1ea: 0x395f, 0x1eb: 0x3aee, 0x1ec: 0x393c, 0x1ed: 0x3acb, 0x1ee: 0x476e, 0x1ef: 0x47ff, + 0x1e6: 0x4692, 0x1e7: 0x4723, 0x1e8: 0x46ba, 0x1e9: 0x474b, + 0x1ea: 0x395f, 0x1eb: 0x3aee, 0x1ec: 0x393c, 0x1ed: 0x3acb, 0x1ee: 0x46d8, 0x1ef: 0x4769, 0x1f0: 0x3958, 0x1f1: 0x3ae7, 0x1f2: 0x3244, 0x1f3: 0x355f, // Block 0x8, offset 0x200 0x200: 0x9932, 0x201: 0x9932, 0x202: 0x9932, 0x203: 0x9932, 0x204: 0x9932, 0x205: 0x8132, @@ -2998,7 +3002,7 @@ var nfcValues = [2944]uint16{ 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812d, 0x23a: 0x812d, 0x23b: 0x812d, 0x23c: 0x812d, 0x23d: 0x8132, 0x23e: 0x8132, 0x23f: 0x8132, // Block 0x9, offset 0x240 - 0x240: 0x4a44, 0x241: 0x4a49, 0x242: 0x9932, 0x243: 0x4a4e, 0x244: 0x4a53, 0x245: 0x9936, + 0x240: 0x49ae, 0x241: 0x49b3, 0x242: 0x9932, 0x243: 0x49b8, 0x244: 0x4a71, 0x245: 0x9936, 0x246: 0x8132, 0x247: 0x812d, 0x248: 0x812d, 0x249: 0x812d, 0x24a: 0x8132, 0x24b: 0x8132, 0x24c: 0x8132, 0x24d: 0x812d, 0x24e: 0x812d, 0x250: 0x8132, 0x251: 0x8132, 0x252: 0x8132, 0x253: 0x812d, 0x254: 0x812d, 0x255: 0x812d, 0x256: 0x812d, 0x257: 0x8132, @@ -3017,7 +3021,7 @@ var nfcValues = [2944]uint16{ 0x299: 0xa000, 0x29f: 0xa000, 0x2a1: 0xa000, 0x2a5: 0xa000, 0x2a9: 0xa000, - 0x2aa: 0x3637, 0x2ab: 0x3667, 0x2ac: 0x4894, 0x2ad: 0x3697, 0x2ae: 0x48be, 0x2af: 0x36a9, + 0x2aa: 0x3637, 0x2ab: 0x3667, 0x2ac: 0x47fe, 0x2ad: 0x3697, 0x2ae: 0x4828, 0x2af: 0x36a9, 0x2b0: 0x3e70, 0x2b1: 0xa000, 0x2b5: 0xa000, 0x2b7: 0xa000, 0x2b9: 0xa000, 0x2bf: 0xa000, @@ -3078,15 +3082,15 @@ var nfcValues = [2944]uint16{ 0x424: 0x305f, 0x425: 0x336b, 0x426: 0x3055, 0x427: 0x3361, 0x428: 0x3064, 0x429: 0x3370, 0x42a: 0x3069, 0x42b: 0x3375, 0x42c: 0x30af, 0x42d: 0x33bb, 0x42e: 0x390b, 0x42f: 0x3a9a, 0x430: 0x30b9, 0x431: 0x33ca, 0x432: 0x30c3, 0x433: 0x33d4, 0x434: 0x30cd, 0x435: 0x33de, - 0x436: 0x475a, 0x437: 0x47eb, 0x438: 0x3912, 0x439: 0x3aa1, 0x43a: 0x30e6, 0x43b: 0x33f7, + 0x436: 0x46c4, 0x437: 0x4755, 0x438: 0x3912, 0x439: 0x3aa1, 0x43a: 0x30e6, 0x43b: 0x33f7, 0x43c: 0x30e1, 0x43d: 0x33f2, 0x43e: 0x30eb, 0x43f: 0x33fc, // Block 0x11, offset 0x440 0x440: 0x30f0, 0x441: 0x3401, 0x442: 0x30f5, 0x443: 0x3406, 0x444: 0x3109, 0x445: 0x341a, 0x446: 0x3113, 0x447: 0x3424, 0x448: 0x3122, 0x449: 0x3433, 0x44a: 0x311d, 0x44b: 0x342e, 0x44c: 0x3935, 0x44d: 0x3ac4, 0x44e: 0x3943, 0x44f: 0x3ad2, 0x450: 0x394a, 0x451: 0x3ad9, 0x452: 0x3951, 0x453: 0x3ae0, 0x454: 0x314f, 0x455: 0x3460, 0x456: 0x3154, 0x457: 0x3465, - 0x458: 0x315e, 0x459: 0x346f, 0x45a: 0x4787, 0x45b: 0x4818, 0x45c: 0x3997, 0x45d: 0x3b26, - 0x45e: 0x3177, 0x45f: 0x3488, 0x460: 0x3181, 0x461: 0x3492, 0x462: 0x4796, 0x463: 0x4827, + 0x458: 0x315e, 0x459: 0x346f, 0x45a: 0x46f1, 0x45b: 0x4782, 0x45c: 0x3997, 0x45d: 0x3b26, + 0x45e: 0x3177, 0x45f: 0x3488, 0x460: 0x3181, 0x461: 0x3492, 0x462: 0x4700, 0x463: 0x4791, 0x464: 0x399e, 0x465: 0x3b2d, 0x466: 0x39a5, 0x467: 0x3b34, 0x468: 0x39ac, 0x469: 0x3b3b, 0x46a: 0x3190, 0x46b: 0x34a1, 0x46c: 0x319a, 0x46d: 0x34b0, 0x46e: 0x31ae, 0x46f: 0x34c4, 0x470: 0x31a9, 0x471: 0x34bf, 0x472: 0x31ea, 0x473: 0x3500, 0x474: 0x31f9, 0x475: 0x350f, @@ -3098,16 +3102,16 @@ var nfcValues = [2944]uint16{ 0x48c: 0x322b, 0x48d: 0x3546, 0x48e: 0x3249, 0x48f: 0x3564, 0x490: 0x3262, 0x491: 0x3582, 0x492: 0x3271, 0x493: 0x3591, 0x494: 0x3276, 0x495: 0x3596, 0x496: 0x337a, 0x497: 0x34a6, 0x498: 0x3537, 0x499: 0x3573, 0x49b: 0x35d1, - 0x4a0: 0x4737, 0x4a1: 0x47c8, 0x4a2: 0x2f83, 0x4a3: 0x328f, + 0x4a0: 0x46a1, 0x4a1: 0x4732, 0x4a2: 0x2f83, 0x4a3: 0x328f, 0x4a4: 0x3878, 0x4a5: 0x3a07, 0x4a6: 0x3871, 0x4a7: 0x3a00, 0x4a8: 0x3886, 0x4a9: 0x3a15, 0x4aa: 0x387f, 0x4ab: 0x3a0e, 0x4ac: 0x38be, 0x4ad: 0x3a4d, 0x4ae: 0x3894, 0x4af: 0x3a23, 0x4b0: 0x388d, 0x4b1: 0x3a1c, 0x4b2: 0x38a2, 0x4b3: 0x3a31, 0x4b4: 0x389b, 0x4b5: 0x3a2a, - 0x4b6: 0x38c5, 0x4b7: 0x3a54, 0x4b8: 0x474b, 0x4b9: 0x47dc, 0x4ba: 0x3000, 0x4bb: 0x330c, + 0x4b6: 0x38c5, 0x4b7: 0x3a54, 0x4b8: 0x46b5, 0x4b9: 0x4746, 0x4ba: 0x3000, 0x4bb: 0x330c, 0x4bc: 0x2fec, 0x4bd: 0x32f8, 0x4be: 0x38da, 0x4bf: 0x3a69, // Block 0x13, offset 0x4c0 0x4c0: 0x38d3, 0x4c1: 0x3a62, 0x4c2: 0x38e8, 0x4c3: 0x3a77, 0x4c4: 0x38e1, 0x4c5: 0x3a70, 0x4c6: 0x38fd, 0x4c7: 0x3a8c, 0x4c8: 0x3091, 0x4c9: 0x339d, 0x4ca: 0x30a5, 0x4cb: 0x33b1, - 0x4cc: 0x477d, 0x4cd: 0x480e, 0x4ce: 0x3136, 0x4cf: 0x3447, 0x4d0: 0x3920, 0x4d1: 0x3aaf, + 0x4cc: 0x46e7, 0x4cd: 0x4778, 0x4ce: 0x3136, 0x4cf: 0x3447, 0x4d0: 0x3920, 0x4d1: 0x3aaf, 0x4d2: 0x3919, 0x4d3: 0x3aa8, 0x4d4: 0x392e, 0x4d5: 0x3abd, 0x4d6: 0x3927, 0x4d7: 0x3ab6, 0x4d8: 0x3989, 0x4d9: 0x3b18, 0x4da: 0x396d, 0x4db: 0x3afc, 0x4dc: 0x3966, 0x4dd: 0x3af5, 0x4de: 0x397b, 0x4df: 0x3b0a, 0x4e0: 0x3974, 0x4e1: 0x3b03, 0x4e2: 0x3982, 0x4e3: 0x3b11, @@ -3116,29 +3120,29 @@ var nfcValues = [2944]uint16{ 0x4f0: 0x39f9, 0x4f1: 0x3b88, 0x4f2: 0x3230, 0x4f3: 0x354b, 0x4f4: 0x3258, 0x4f5: 0x3578, 0x4f6: 0x3253, 0x4f7: 0x356e, 0x4f8: 0x323f, 0x4f9: 0x355a, // Block 0x14, offset 0x500 - 0x500: 0x489a, 0x501: 0x48a0, 0x502: 0x49b4, 0x503: 0x49cc, 0x504: 0x49bc, 0x505: 0x49d4, - 0x506: 0x49c4, 0x507: 0x49dc, 0x508: 0x4840, 0x509: 0x4846, 0x50a: 0x4924, 0x50b: 0x493c, - 0x50c: 0x492c, 0x50d: 0x4944, 0x50e: 0x4934, 0x50f: 0x494c, 0x510: 0x48ac, 0x511: 0x48b2, + 0x500: 0x4804, 0x501: 0x480a, 0x502: 0x491e, 0x503: 0x4936, 0x504: 0x4926, 0x505: 0x493e, + 0x506: 0x492e, 0x507: 0x4946, 0x508: 0x47aa, 0x509: 0x47b0, 0x50a: 0x488e, 0x50b: 0x48a6, + 0x50c: 0x4896, 0x50d: 0x48ae, 0x50e: 0x489e, 0x50f: 0x48b6, 0x510: 0x4816, 0x511: 0x481c, 0x512: 0x3db8, 0x513: 0x3dc8, 0x514: 0x3dc0, 0x515: 0x3dd0, - 0x518: 0x484c, 0x519: 0x4852, 0x51a: 0x3ce8, 0x51b: 0x3cf8, 0x51c: 0x3cf0, 0x51d: 0x3d00, - 0x520: 0x48c4, 0x521: 0x48ca, 0x522: 0x49e4, 0x523: 0x49fc, - 0x524: 0x49ec, 0x525: 0x4a04, 0x526: 0x49f4, 0x527: 0x4a0c, 0x528: 0x4858, 0x529: 0x485e, - 0x52a: 0x4954, 0x52b: 0x496c, 0x52c: 0x495c, 0x52d: 0x4974, 0x52e: 0x4964, 0x52f: 0x497c, - 0x530: 0x48dc, 0x531: 0x48e2, 0x532: 0x3e18, 0x533: 0x3e30, 0x534: 0x3e20, 0x535: 0x3e38, - 0x536: 0x3e28, 0x537: 0x3e40, 0x538: 0x4864, 0x539: 0x486a, 0x53a: 0x3d18, 0x53b: 0x3d30, + 0x518: 0x47b6, 0x519: 0x47bc, 0x51a: 0x3ce8, 0x51b: 0x3cf8, 0x51c: 0x3cf0, 0x51d: 0x3d00, + 0x520: 0x482e, 0x521: 0x4834, 0x522: 0x494e, 0x523: 0x4966, + 0x524: 0x4956, 0x525: 0x496e, 0x526: 0x495e, 0x527: 0x4976, 0x528: 0x47c2, 0x529: 0x47c8, + 0x52a: 0x48be, 0x52b: 0x48d6, 0x52c: 0x48c6, 0x52d: 0x48de, 0x52e: 0x48ce, 0x52f: 0x48e6, + 0x530: 0x4846, 0x531: 0x484c, 0x532: 0x3e18, 0x533: 0x3e30, 0x534: 0x3e20, 0x535: 0x3e38, + 0x536: 0x3e28, 0x537: 0x3e40, 0x538: 0x47ce, 0x539: 0x47d4, 0x53a: 0x3d18, 0x53b: 0x3d30, 0x53c: 0x3d20, 0x53d: 0x3d38, 0x53e: 0x3d28, 0x53f: 0x3d40, // Block 0x15, offset 0x540 - 0x540: 0x48e8, 0x541: 0x48ee, 0x542: 0x3e48, 0x543: 0x3e58, 0x544: 0x3e50, 0x545: 0x3e60, - 0x548: 0x4870, 0x549: 0x4876, 0x54a: 0x3d48, 0x54b: 0x3d58, - 0x54c: 0x3d50, 0x54d: 0x3d60, 0x550: 0x48fa, 0x551: 0x4900, + 0x540: 0x4852, 0x541: 0x4858, 0x542: 0x3e48, 0x543: 0x3e58, 0x544: 0x3e50, 0x545: 0x3e60, + 0x548: 0x47da, 0x549: 0x47e0, 0x54a: 0x3d48, 0x54b: 0x3d58, + 0x54c: 0x3d50, 0x54d: 0x3d60, 0x550: 0x4864, 0x551: 0x486a, 0x552: 0x3e80, 0x553: 0x3e98, 0x554: 0x3e88, 0x555: 0x3ea0, 0x556: 0x3e90, 0x557: 0x3ea8, - 0x559: 0x487c, 0x55b: 0x3d68, 0x55d: 0x3d70, - 0x55f: 0x3d78, 0x560: 0x4912, 0x561: 0x4918, 0x562: 0x4a14, 0x563: 0x4a2c, - 0x564: 0x4a1c, 0x565: 0x4a34, 0x566: 0x4a24, 0x567: 0x4a3c, 0x568: 0x4882, 0x569: 0x4888, - 0x56a: 0x4984, 0x56b: 0x499c, 0x56c: 0x498c, 0x56d: 0x49a4, 0x56e: 0x4994, 0x56f: 0x49ac, - 0x570: 0x488e, 0x571: 0x43b4, 0x572: 0x3691, 0x573: 0x43ba, 0x574: 0x48b8, 0x575: 0x43c0, - 0x576: 0x36a3, 0x577: 0x43c6, 0x578: 0x36c1, 0x579: 0x43cc, 0x57a: 0x36d9, 0x57b: 0x43d2, - 0x57c: 0x4906, 0x57d: 0x43d8, + 0x559: 0x47e6, 0x55b: 0x3d68, 0x55d: 0x3d70, + 0x55f: 0x3d78, 0x560: 0x487c, 0x561: 0x4882, 0x562: 0x497e, 0x563: 0x4996, + 0x564: 0x4986, 0x565: 0x499e, 0x566: 0x498e, 0x567: 0x49a6, 0x568: 0x47ec, 0x569: 0x47f2, + 0x56a: 0x48ee, 0x56b: 0x4906, 0x56c: 0x48f6, 0x56d: 0x490e, 0x56e: 0x48fe, 0x56f: 0x4916, + 0x570: 0x47f8, 0x571: 0x431e, 0x572: 0x3691, 0x573: 0x4324, 0x574: 0x4822, 0x575: 0x432a, + 0x576: 0x36a3, 0x577: 0x4330, 0x578: 0x36c1, 0x579: 0x4336, 0x57a: 0x36d9, 0x57b: 0x433c, + 0x57c: 0x4870, 0x57d: 0x4342, // Block 0x16, offset 0x580 0x580: 0x3da0, 0x581: 0x3da8, 0x582: 0x4184, 0x583: 0x41a2, 0x584: 0x418e, 0x585: 0x41ac, 0x586: 0x4198, 0x587: 0x41b6, 0x588: 0x3cd8, 0x589: 0x3ce0, 0x58a: 0x40d0, 0x58b: 0x40ee, @@ -3149,19 +3153,19 @@ var nfcValues = [2944]uint16{ 0x5a4: 0x4206, 0x5a5: 0x4224, 0x5a6: 0x4210, 0x5a7: 0x422e, 0x5a8: 0x3d80, 0x5a9: 0x3d88, 0x5aa: 0x4148, 0x5ab: 0x4166, 0x5ac: 0x4152, 0x5ad: 0x4170, 0x5ae: 0x415c, 0x5af: 0x417a, 0x5b0: 0x3685, 0x5b1: 0x367f, 0x5b2: 0x3d90, 0x5b3: 0x368b, 0x5b4: 0x3d98, - 0x5b6: 0x48a6, 0x5b7: 0x3db0, 0x5b8: 0x35f5, 0x5b9: 0x35ef, 0x5ba: 0x35e3, 0x5bb: 0x4384, + 0x5b6: 0x4810, 0x5b7: 0x3db0, 0x5b8: 0x35f5, 0x5b9: 0x35ef, 0x5ba: 0x35e3, 0x5bb: 0x42ee, 0x5bc: 0x35fb, 0x5bd: 0x8100, 0x5be: 0x01d3, 0x5bf: 0xa100, // Block 0x17, offset 0x5c0 0x5c0: 0x8100, 0x5c1: 0x35a7, 0x5c2: 0x3dd8, 0x5c3: 0x369d, 0x5c4: 0x3de0, - 0x5c6: 0x48d0, 0x5c7: 0x3df8, 0x5c8: 0x3601, 0x5c9: 0x438a, 0x5ca: 0x360d, 0x5cb: 0x4390, + 0x5c6: 0x483a, 0x5c7: 0x3df8, 0x5c8: 0x3601, 0x5c9: 0x42f4, 0x5ca: 0x360d, 0x5cb: 0x42fa, 0x5cc: 0x3619, 0x5cd: 0x3b8f, 0x5ce: 0x3b96, 0x5cf: 0x3b9d, 0x5d0: 0x36b5, 0x5d1: 0x36af, - 0x5d2: 0x3e00, 0x5d3: 0x457a, 0x5d6: 0x36bb, 0x5d7: 0x3e10, - 0x5d8: 0x3631, 0x5d9: 0x362b, 0x5da: 0x361f, 0x5db: 0x4396, 0x5dd: 0x3ba4, - 0x5de: 0x3bab, 0x5df: 0x3bb2, 0x5e0: 0x36eb, 0x5e1: 0x36e5, 0x5e2: 0x3e68, 0x5e3: 0x4582, + 0x5d2: 0x3e00, 0x5d3: 0x44e4, 0x5d6: 0x36bb, 0x5d7: 0x3e10, + 0x5d8: 0x3631, 0x5d9: 0x362b, 0x5da: 0x361f, 0x5db: 0x4300, 0x5dd: 0x3ba4, + 0x5de: 0x3bab, 0x5df: 0x3bb2, 0x5e0: 0x36eb, 0x5e1: 0x36e5, 0x5e2: 0x3e68, 0x5e3: 0x44ec, 0x5e4: 0x36cd, 0x5e5: 0x36d3, 0x5e6: 0x36f1, 0x5e7: 0x3e78, 0x5e8: 0x3661, 0x5e9: 0x365b, - 0x5ea: 0x364f, 0x5eb: 0x43a2, 0x5ec: 0x3649, 0x5ed: 0x359b, 0x5ee: 0x437e, 0x5ef: 0x0081, + 0x5ea: 0x364f, 0x5eb: 0x430c, 0x5ec: 0x3649, 0x5ed: 0x359b, 0x5ee: 0x42e8, 0x5ef: 0x0081, 0x5f2: 0x3eb0, 0x5f3: 0x36f7, 0x5f4: 0x3eb8, - 0x5f6: 0x491e, 0x5f7: 0x3ed0, 0x5f8: 0x363d, 0x5f9: 0x439c, 0x5fa: 0x366d, 0x5fb: 0x43ae, + 0x5f6: 0x4888, 0x5f7: 0x3ed0, 0x5f8: 0x363d, 0x5f9: 0x4306, 0x5fa: 0x366d, 0x5fb: 0x4318, 0x5fc: 0x3679, 0x5fd: 0x4256, 0x5fe: 0xa100, // Block 0x18, offset 0x600 0x601: 0x3c06, 0x603: 0xa000, 0x604: 0x3c0d, 0x605: 0xa000, @@ -3519,8 +3523,8 @@ var nfcSparseValues = [688]valueRange{ {value: 0x8100, lo: 0xb8, hi: 0xb8}, // Block 0x1, offset 0x5 {value: 0x0091, lo: 0x03}, - {value: 0x4778, lo: 0xa0, hi: 0xa1}, - {value: 0x47aa, lo: 0xaf, hi: 0xb0}, + {value: 0x46e2, lo: 0xa0, hi: 0xa1}, + {value: 0x4714, lo: 0xaf, hi: 0xb0}, {value: 0xa000, lo: 0xb7, hi: 0xb7}, // Block 0x2, offset 0x9 {value: 0x0000, lo: 0x01}, @@ -3533,11 +3537,11 @@ var nfcSparseValues = [688]valueRange{ {value: 0xa000, lo: 0x81, hi: 0x81}, {value: 0xa000, lo: 0x85, hi: 0x85}, {value: 0xa000, lo: 0x89, hi: 0x89}, - {value: 0x48d6, lo: 0x8a, hi: 0x8a}, - {value: 0x48f4, lo: 0x8b, hi: 0x8b}, + {value: 0x4840, lo: 0x8a, hi: 0x8a}, + {value: 0x485e, lo: 0x8b, hi: 0x8b}, {value: 0x36c7, lo: 0x8c, hi: 0x8c}, {value: 0x36df, lo: 0x8d, hi: 0x8d}, - {value: 0x490c, lo: 0x8e, hi: 0x8e}, + {value: 0x4876, lo: 0x8e, hi: 0x8e}, {value: 0xa000, lo: 0x92, hi: 0x92}, {value: 0x36fd, lo: 0x93, hi: 0x94}, // Block 0x5, offset 0x18 @@ -3665,7 +3669,7 @@ var nfcSparseValues = [688]valueRange{ {value: 0x812d, lo: 0x92, hi: 0x92}, {value: 0x8132, lo: 0x93, hi: 0x93}, {value: 0x8132, lo: 0x94, hi: 0x94}, - {value: 0x45b2, lo: 0x98, hi: 0x9f}, + {value: 0x451c, lo: 0x98, hi: 0x9f}, // Block 0x12, offset 0x89 {value: 0x0000, lo: 0x02}, {value: 0x8102, lo: 0xbc, hi: 0xbc}, @@ -3676,18 +3680,18 @@ var nfcSparseValues = [688]valueRange{ {value: 0x2c9e, lo: 0x8b, hi: 0x8c}, {value: 0x8104, lo: 0x8d, hi: 0x8d}, {value: 0x9900, lo: 0x97, hi: 0x97}, - {value: 0x45f2, lo: 0x9c, hi: 0x9d}, - {value: 0x4602, lo: 0x9f, hi: 0x9f}, + {value: 0x455c, lo: 0x9c, hi: 0x9d}, + {value: 0x456c, lo: 0x9f, hi: 0x9f}, // Block 0x14, offset 0x93 {value: 0x0000, lo: 0x03}, - {value: 0x462a, lo: 0xb3, hi: 0xb3}, - {value: 0x4632, lo: 0xb6, hi: 0xb6}, + {value: 0x4594, lo: 0xb3, hi: 0xb3}, + {value: 0x459c, lo: 0xb6, hi: 0xb6}, {value: 0x8102, lo: 0xbc, hi: 0xbc}, // Block 0x15, offset 0x97 {value: 0x0008, lo: 0x03}, {value: 0x8104, lo: 0x8d, hi: 0x8d}, - {value: 0x460a, lo: 0x99, hi: 0x9b}, - {value: 0x4622, lo: 0x9e, hi: 0x9e}, + {value: 0x4574, lo: 0x99, hi: 0x9b}, + {value: 0x458c, lo: 0x9e, hi: 0x9e}, // Block 0x16, offset 0x9b {value: 0x0000, lo: 0x01}, {value: 0x8102, lo: 0xbc, hi: 0xbc}, @@ -3702,8 +3706,8 @@ var nfcSparseValues = [688]valueRange{ {value: 0x2cbe, lo: 0x8c, hi: 0x8c}, {value: 0x8104, lo: 0x8d, hi: 0x8d}, {value: 0x9900, lo: 0x96, hi: 0x97}, - {value: 0x463a, lo: 0x9c, hi: 0x9c}, - {value: 0x4642, lo: 0x9d, hi: 0x9d}, + {value: 0x45a4, lo: 0x9c, hi: 0x9c}, + {value: 0x45ac, lo: 0x9d, hi: 0x9d}, // Block 0x19, offset 0xa8 {value: 0x0000, lo: 0x03}, {value: 0xa000, lo: 0x92, hi: 0x92}, @@ -3787,18 +3791,18 @@ var nfcSparseValues = [688]valueRange{ {value: 0x263d, lo: 0xa9, hi: 0xa9}, {value: 0x8126, lo: 0xb1, hi: 0xb1}, {value: 0x8127, lo: 0xb2, hi: 0xb2}, - {value: 0x4a66, lo: 0xb3, hi: 0xb3}, + {value: 0x4a84, lo: 0xb3, hi: 0xb3}, {value: 0x8128, lo: 0xb4, hi: 0xb4}, - {value: 0x4a6f, lo: 0xb5, hi: 0xb5}, - {value: 0x464a, lo: 0xb6, hi: 0xb6}, + {value: 0x4a8d, lo: 0xb5, hi: 0xb5}, + {value: 0x45b4, lo: 0xb6, hi: 0xb6}, {value: 0x8200, lo: 0xb7, hi: 0xb7}, - {value: 0x4652, lo: 0xb8, hi: 0xb8}, + {value: 0x45bc, lo: 0xb8, hi: 0xb8}, {value: 0x8200, lo: 0xb9, hi: 0xb9}, {value: 0x8127, lo: 0xba, hi: 0xbd}, // Block 0x27, offset 0xf5 {value: 0x0000, lo: 0x0b}, {value: 0x8127, lo: 0x80, hi: 0x80}, - {value: 0x4a78, lo: 0x81, hi: 0x81}, + {value: 0x4a96, lo: 0x81, hi: 0x81}, {value: 0x8132, lo: 0x82, hi: 0x83}, {value: 0x8104, lo: 0x84, hi: 0x84}, {value: 0x8132, lo: 0x86, hi: 0x87}, @@ -3975,7 +3979,7 @@ var nfcSparseValues = [688]valueRange{ {value: 0x048b, lo: 0xa9, hi: 0xaa}, // Block 0x45, offset 0x189 {value: 0x0000, lo: 0x01}, - {value: 0x4573, lo: 0x9c, hi: 0x9c}, + {value: 0x44dd, lo: 0x9c, hi: 0x9c}, // Block 0x46, offset 0x18b {value: 0x0000, lo: 0x01}, {value: 0x8132, lo: 0xaf, hi: 0xb1}, @@ -3994,12 +3998,12 @@ var nfcSparseValues = [688]valueRange{ {value: 0x812f, lo: 0xae, hi: 0xaf}, // Block 0x4a, offset 0x197 {value: 0x0000, lo: 0x03}, - {value: 0x4a81, lo: 0xb3, hi: 0xb3}, - {value: 0x4a81, lo: 0xb5, hi: 0xb6}, - {value: 0x4a81, lo: 0xba, hi: 0xbf}, + {value: 0x4a9f, lo: 0xb3, hi: 0xb3}, + {value: 0x4a9f, lo: 0xb5, hi: 0xb6}, + {value: 0x4a9f, lo: 0xba, hi: 0xbf}, // Block 0x4b, offset 0x19b {value: 0x0000, lo: 0x01}, - {value: 0x4a81, lo: 0x8f, hi: 0xa3}, + {value: 0x4a9f, lo: 0x8f, hi: 0xa3}, // Block 0x4c, offset 0x19d {value: 0x0000, lo: 0x01}, {value: 0x8100, lo: 0xae, hi: 0xbe}, @@ -4119,29 +4123,29 @@ var nfcSparseValues = [688]valueRange{ {value: 0xc600, lo: 0x89, hi: 0xa3}, // Block 0x63, offset 0x1fb {value: 0x0006, lo: 0x0d}, - {value: 0x4426, lo: 0x9d, hi: 0x9d}, + {value: 0x4390, lo: 0x9d, hi: 0x9d}, {value: 0x8115, lo: 0x9e, hi: 0x9e}, - {value: 0x4498, lo: 0x9f, hi: 0x9f}, - {value: 0x4486, lo: 0xaa, hi: 0xab}, - {value: 0x458a, lo: 0xac, hi: 0xac}, - {value: 0x4592, lo: 0xad, hi: 0xad}, - {value: 0x43de, lo: 0xae, hi: 0xb1}, - {value: 0x43fc, lo: 0xb2, hi: 0xb4}, - {value: 0x4414, lo: 0xb5, hi: 0xb6}, - {value: 0x4420, lo: 0xb8, hi: 0xb8}, - {value: 0x442c, lo: 0xb9, hi: 0xbb}, - {value: 0x4444, lo: 0xbc, hi: 0xbc}, - {value: 0x444a, lo: 0xbe, hi: 0xbe}, + {value: 0x4402, lo: 0x9f, hi: 0x9f}, + {value: 0x43f0, lo: 0xaa, hi: 0xab}, + {value: 0x44f4, lo: 0xac, hi: 0xac}, + {value: 0x44fc, lo: 0xad, hi: 0xad}, + {value: 0x4348, lo: 0xae, hi: 0xb1}, + {value: 0x4366, lo: 0xb2, hi: 0xb4}, + {value: 0x437e, lo: 0xb5, hi: 0xb6}, + {value: 0x438a, lo: 0xb8, hi: 0xb8}, + {value: 0x4396, lo: 0xb9, hi: 0xbb}, + {value: 0x43ae, lo: 0xbc, hi: 0xbc}, + {value: 0x43b4, lo: 0xbe, hi: 0xbe}, // Block 0x64, offset 0x209 {value: 0x0006, lo: 0x08}, - {value: 0x4450, lo: 0x80, hi: 0x81}, - {value: 0x445c, lo: 0x83, hi: 0x84}, - {value: 0x446e, lo: 0x86, hi: 0x89}, - {value: 0x4492, lo: 0x8a, hi: 0x8a}, - {value: 0x440e, lo: 0x8b, hi: 0x8b}, - {value: 0x43f6, lo: 0x8c, hi: 0x8c}, - {value: 0x443e, lo: 0x8d, hi: 0x8d}, - {value: 0x4468, lo: 0x8e, hi: 0x8e}, + {value: 0x43ba, lo: 0x80, hi: 0x81}, + {value: 0x43c6, lo: 0x83, hi: 0x84}, + {value: 0x43d8, lo: 0x86, hi: 0x89}, + {value: 0x43fc, lo: 0x8a, hi: 0x8a}, + {value: 0x4378, lo: 0x8b, hi: 0x8b}, + {value: 0x4360, lo: 0x8c, hi: 0x8c}, + {value: 0x43a8, lo: 0x8d, hi: 0x8d}, + {value: 0x43d2, lo: 0x8e, hi: 0x8e}, // Block 0x65, offset 0x212 {value: 0x0000, lo: 0x02}, {value: 0x8100, lo: 0xa4, hi: 0xa5}, @@ -4179,16 +4183,16 @@ var nfcSparseValues = [688]valueRange{ {value: 0x8100, lo: 0xb5, hi: 0xba}, // Block 0x6e, offset 0x22c {value: 0x0000, lo: 0x04}, - {value: 0x4a81, lo: 0x9e, hi: 0x9f}, - {value: 0x4a81, lo: 0xa3, hi: 0xa3}, - {value: 0x4a81, lo: 0xa5, hi: 0xa6}, - {value: 0x4a81, lo: 0xaa, hi: 0xaf}, + {value: 0x4a9f, lo: 0x9e, hi: 0x9f}, + {value: 0x4a9f, lo: 0xa3, hi: 0xa3}, + {value: 0x4a9f, lo: 0xa5, hi: 0xa6}, + {value: 0x4a9f, lo: 0xaa, hi: 0xaf}, // Block 0x6f, offset 0x231 {value: 0x0000, lo: 0x05}, - {value: 0x4a81, lo: 0x82, hi: 0x87}, - {value: 0x4a81, lo: 0x8a, hi: 0x8f}, - {value: 0x4a81, lo: 0x92, hi: 0x97}, - {value: 0x4a81, lo: 0x9a, hi: 0x9c}, + {value: 0x4a9f, lo: 0x82, hi: 0x87}, + {value: 0x4a9f, lo: 0x8a, hi: 0x8f}, + {value: 0x4a9f, lo: 0x92, hi: 0x97}, + {value: 0x4a9f, lo: 0x9a, hi: 0x9c}, {value: 0x8100, lo: 0xa3, hi: 0xa3}, // Block 0x70, offset 0x237 {value: 0x0000, lo: 0x01}, @@ -4295,13 +4299,13 @@ var nfcSparseValues = [688]valueRange{ {value: 0x8101, lo: 0x9e, hi: 0x9e}, // Block 0x86, offset 0x288 {value: 0x0000, lo: 0x0c}, - {value: 0x4662, lo: 0x9e, hi: 0x9e}, - {value: 0x466c, lo: 0x9f, hi: 0x9f}, - {value: 0x46a0, lo: 0xa0, hi: 0xa0}, - {value: 0x46ae, lo: 0xa1, hi: 0xa1}, - {value: 0x46bc, lo: 0xa2, hi: 0xa2}, - {value: 0x46ca, lo: 0xa3, hi: 0xa3}, - {value: 0x46d8, lo: 0xa4, hi: 0xa4}, + {value: 0x45cc, lo: 0x9e, hi: 0x9e}, + {value: 0x45d6, lo: 0x9f, hi: 0x9f}, + {value: 0x460a, lo: 0xa0, hi: 0xa0}, + {value: 0x4618, lo: 0xa1, hi: 0xa1}, + {value: 0x4626, lo: 0xa2, hi: 0xa2}, + {value: 0x4634, lo: 0xa3, hi: 0xa3}, + {value: 0x4642, lo: 0xa4, hi: 0xa4}, {value: 0x812b, lo: 0xa5, hi: 0xa6}, {value: 0x8101, lo: 0xa7, hi: 0xa9}, {value: 0x8130, lo: 0xad, hi: 0xad}, @@ -4313,14 +4317,14 @@ var nfcSparseValues = [688]valueRange{ {value: 0x8132, lo: 0x85, hi: 0x89}, {value: 0x812d, lo: 0x8a, hi: 0x8b}, {value: 0x8132, lo: 0xaa, hi: 0xad}, - {value: 0x4676, lo: 0xbb, hi: 0xbb}, - {value: 0x4680, lo: 0xbc, hi: 0xbc}, - {value: 0x46e6, lo: 0xbd, hi: 0xbd}, - {value: 0x4702, lo: 0xbe, hi: 0xbe}, - {value: 0x46f4, lo: 0xbf, hi: 0xbf}, + {value: 0x45e0, lo: 0xbb, hi: 0xbb}, + {value: 0x45ea, lo: 0xbc, hi: 0xbc}, + {value: 0x4650, lo: 0xbd, hi: 0xbd}, + {value: 0x466c, lo: 0xbe, hi: 0xbe}, + {value: 0x465e, lo: 0xbf, hi: 0xbf}, // Block 0x88, offset 0x29f {value: 0x0000, lo: 0x01}, - {value: 0x4710, lo: 0x80, hi: 0x80}, + {value: 0x467a, lo: 0x80, hi: 0x80}, // Block 0x89, offset 0x2a1 {value: 0x0000, lo: 0x01}, {value: 0x8132, lo: 0x82, hi: 0x84}, @@ -4513,7 +4517,7 @@ func (t *nfkcTrie) lookupStringUnsafe(s string) uint16 { return 0 } -// nfkcTrie. Total size: 16994 bytes (16.60 KiB). Checksum: 146925fc21092b17. +// nfkcTrie. Total size: 16994 bytes (16.60 KiB). Checksum: c3ed54ee046f3c46. type nfkcTrie struct{} func newNfkcTrie(i int) *nfkcTrie { @@ -4549,22 +4553,22 @@ var nfkcValues = [5888]uint16{ 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, // Block 0x2, offset 0x80 // Block 0x3, offset 0xc0 - 0xc0: 0x2f6f, 0xc1: 0x2f74, 0xc2: 0x471e, 0xc3: 0x2f79, 0xc4: 0x472d, 0xc5: 0x4732, - 0xc6: 0xa000, 0xc7: 0x473c, 0xc8: 0x2fe2, 0xc9: 0x2fe7, 0xca: 0x4741, 0xcb: 0x2ffb, - 0xcc: 0x306e, 0xcd: 0x3073, 0xce: 0x3078, 0xcf: 0x4755, 0xd1: 0x3104, - 0xd2: 0x3127, 0xd3: 0x312c, 0xd4: 0x475f, 0xd5: 0x4764, 0xd6: 0x4773, - 0xd8: 0xa000, 0xd9: 0x31b3, 0xda: 0x31b8, 0xdb: 0x31bd, 0xdc: 0x47a5, 0xdd: 0x3235, - 0xe0: 0x327b, 0xe1: 0x3280, 0xe2: 0x47af, 0xe3: 0x3285, - 0xe4: 0x47be, 0xe5: 0x47c3, 0xe6: 0xa000, 0xe7: 0x47cd, 0xe8: 0x32ee, 0xe9: 0x32f3, - 0xea: 0x47d2, 0xeb: 0x3307, 0xec: 0x337f, 0xed: 0x3384, 0xee: 0x3389, 0xef: 0x47e6, - 0xf1: 0x3415, 0xf2: 0x3438, 0xf3: 0x343d, 0xf4: 0x47f0, 0xf5: 0x47f5, - 0xf6: 0x4804, 0xf8: 0xa000, 0xf9: 0x34c9, 0xfa: 0x34ce, 0xfb: 0x34d3, - 0xfc: 0x4836, 0xfd: 0x3550, 0xff: 0x3569, + 0xc0: 0x2f6f, 0xc1: 0x2f74, 0xc2: 0x4688, 0xc3: 0x2f79, 0xc4: 0x4697, 0xc5: 0x469c, + 0xc6: 0xa000, 0xc7: 0x46a6, 0xc8: 0x2fe2, 0xc9: 0x2fe7, 0xca: 0x46ab, 0xcb: 0x2ffb, + 0xcc: 0x306e, 0xcd: 0x3073, 0xce: 0x3078, 0xcf: 0x46bf, 0xd1: 0x3104, + 0xd2: 0x3127, 0xd3: 0x312c, 0xd4: 0x46c9, 0xd5: 0x46ce, 0xd6: 0x46dd, + 0xd8: 0xa000, 0xd9: 0x31b3, 0xda: 0x31b8, 0xdb: 0x31bd, 0xdc: 0x470f, 0xdd: 0x3235, + 0xe0: 0x327b, 0xe1: 0x3280, 0xe2: 0x4719, 0xe3: 0x3285, + 0xe4: 0x4728, 0xe5: 0x472d, 0xe6: 0xa000, 0xe7: 0x4737, 0xe8: 0x32ee, 0xe9: 0x32f3, + 0xea: 0x473c, 0xeb: 0x3307, 0xec: 0x337f, 0xed: 0x3384, 0xee: 0x3389, 0xef: 0x4750, + 0xf1: 0x3415, 0xf2: 0x3438, 0xf3: 0x343d, 0xf4: 0x475a, 0xf5: 0x475f, + 0xf6: 0x476e, 0xf8: 0xa000, 0xf9: 0x34c9, 0xfa: 0x34ce, 0xfb: 0x34d3, + 0xfc: 0x47a0, 0xfd: 0x3550, 0xff: 0x3569, // Block 0x4, offset 0x100 - 0x100: 0x2f7e, 0x101: 0x328a, 0x102: 0x4723, 0x103: 0x47b4, 0x104: 0x2f9c, 0x105: 0x32a8, + 0x100: 0x2f7e, 0x101: 0x328a, 0x102: 0x468d, 0x103: 0x471e, 0x104: 0x2f9c, 0x105: 0x32a8, 0x106: 0x2fb0, 0x107: 0x32bc, 0x108: 0x2fb5, 0x109: 0x32c1, 0x10a: 0x2fba, 0x10b: 0x32c6, 0x10c: 0x2fbf, 0x10d: 0x32cb, 0x10e: 0x2fc9, 0x10f: 0x32d5, - 0x112: 0x4746, 0x113: 0x47d7, 0x114: 0x2ff1, 0x115: 0x32fd, 0x116: 0x2ff6, 0x117: 0x3302, + 0x112: 0x46b0, 0x113: 0x4741, 0x114: 0x2ff1, 0x115: 0x32fd, 0x116: 0x2ff6, 0x117: 0x3302, 0x118: 0x3014, 0x119: 0x3320, 0x11a: 0x3005, 0x11b: 0x3311, 0x11c: 0x302d, 0x11d: 0x3339, 0x11e: 0x3037, 0x11f: 0x3343, 0x120: 0x303c, 0x121: 0x3348, 0x122: 0x3046, 0x123: 0x3352, 0x124: 0x304b, 0x125: 0x3357, 0x128: 0x307d, 0x129: 0x338e, @@ -4575,12 +4579,12 @@ var nfkcValues = [5888]uint16{ // Block 0x5, offset 0x140 0x140: 0x1c34, 0x143: 0x30ff, 0x144: 0x3410, 0x145: 0x3118, 0x146: 0x3429, 0x147: 0x310e, 0x148: 0x341f, 0x149: 0x1c5c, - 0x14c: 0x4769, 0x14d: 0x47fa, 0x14e: 0x3131, 0x14f: 0x3442, 0x150: 0x313b, 0x151: 0x344c, + 0x14c: 0x46d3, 0x14d: 0x4764, 0x14e: 0x3131, 0x14f: 0x3442, 0x150: 0x313b, 0x151: 0x344c, 0x154: 0x3159, 0x155: 0x346a, 0x156: 0x3172, 0x157: 0x3483, - 0x158: 0x3163, 0x159: 0x3474, 0x15a: 0x478c, 0x15b: 0x481d, 0x15c: 0x317c, 0x15d: 0x348d, - 0x15e: 0x318b, 0x15f: 0x349c, 0x160: 0x4791, 0x161: 0x4822, 0x162: 0x31a4, 0x163: 0x34ba, - 0x164: 0x3195, 0x165: 0x34ab, 0x168: 0x479b, 0x169: 0x482c, - 0x16a: 0x47a0, 0x16b: 0x4831, 0x16c: 0x31c2, 0x16d: 0x34d8, 0x16e: 0x31cc, 0x16f: 0x34e2, + 0x158: 0x3163, 0x159: 0x3474, 0x15a: 0x46f6, 0x15b: 0x4787, 0x15c: 0x317c, 0x15d: 0x348d, + 0x15e: 0x318b, 0x15f: 0x349c, 0x160: 0x46fb, 0x161: 0x478c, 0x162: 0x31a4, 0x163: 0x34ba, + 0x164: 0x3195, 0x165: 0x34ab, 0x168: 0x4705, 0x169: 0x4796, + 0x16a: 0x470a, 0x16b: 0x479b, 0x16c: 0x31c2, 0x16d: 0x34d8, 0x16e: 0x31cc, 0x16f: 0x34e2, 0x170: 0x31d1, 0x171: 0x34e7, 0x172: 0x31ef, 0x173: 0x3505, 0x174: 0x3212, 0x175: 0x3528, 0x176: 0x323a, 0x177: 0x3555, 0x178: 0x324e, 0x179: 0x325d, 0x17a: 0x357d, 0x17b: 0x3267, 0x17c: 0x3587, 0x17d: 0x326c, 0x17e: 0x358c, 0x17f: 0x00a7, @@ -4592,7 +4596,7 @@ var nfkcValues = [5888]uint16{ 0x198: 0x3b57, 0x199: 0x39d6, 0x19a: 0x3b65, 0x19b: 0x39c1, 0x19c: 0x3b50, 0x19e: 0x38b0, 0x19f: 0x3a3f, 0x1a0: 0x38a9, 0x1a1: 0x3a38, 0x1a2: 0x35b3, 0x1a3: 0x35c5, 0x1a6: 0x3041, 0x1a7: 0x334d, 0x1a8: 0x30be, 0x1a9: 0x33cf, - 0x1aa: 0x4782, 0x1ab: 0x4813, 0x1ac: 0x3990, 0x1ad: 0x3b1f, 0x1ae: 0x35d7, 0x1af: 0x35dd, + 0x1aa: 0x46ec, 0x1ab: 0x477d, 0x1ac: 0x3990, 0x1ad: 0x3b1f, 0x1ae: 0x35d7, 0x1af: 0x35dd, 0x1b0: 0x33c5, 0x1b1: 0x1942, 0x1b2: 0x1945, 0x1b3: 0x19cf, 0x1b4: 0x3028, 0x1b5: 0x3334, 0x1b8: 0x30fa, 0x1b9: 0x340b, 0x1ba: 0x38b7, 0x1bb: 0x3a46, 0x1bc: 0x35ad, 0x1bd: 0x35bf, 0x1be: 0x35b9, 0x1bf: 0x35cb, @@ -4603,8 +4607,8 @@ var nfkcValues = [5888]uint16{ 0x1d2: 0x316d, 0x1d3: 0x347e, 0x1d4: 0x31db, 0x1d5: 0x34f1, 0x1d6: 0x31e0, 0x1d7: 0x34f6, 0x1d8: 0x3186, 0x1d9: 0x3497, 0x1da: 0x319f, 0x1db: 0x34b5, 0x1de: 0x305a, 0x1df: 0x3366, - 0x1e6: 0x4728, 0x1e7: 0x47b9, 0x1e8: 0x4750, 0x1e9: 0x47e1, - 0x1ea: 0x395f, 0x1eb: 0x3aee, 0x1ec: 0x393c, 0x1ed: 0x3acb, 0x1ee: 0x476e, 0x1ef: 0x47ff, + 0x1e6: 0x4692, 0x1e7: 0x4723, 0x1e8: 0x46ba, 0x1e9: 0x474b, + 0x1ea: 0x395f, 0x1eb: 0x3aee, 0x1ec: 0x393c, 0x1ed: 0x3acb, 0x1ee: 0x46d8, 0x1ef: 0x4769, 0x1f0: 0x3958, 0x1f1: 0x3ae7, 0x1f2: 0x3244, 0x1f3: 0x355f, // Block 0x8, offset 0x200 0x200: 0x9932, 0x201: 0x9932, 0x202: 0x9932, 0x203: 0x9932, 0x204: 0x9932, 0x205: 0x8132, @@ -4619,7 +4623,7 @@ var nfkcValues = [5888]uint16{ 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812d, 0x23a: 0x812d, 0x23b: 0x812d, 0x23c: 0x812d, 0x23d: 0x8132, 0x23e: 0x8132, 0x23f: 0x8132, // Block 0x9, offset 0x240 - 0x240: 0x4a44, 0x241: 0x4a49, 0x242: 0x9932, 0x243: 0x4a4e, 0x244: 0x4a53, 0x245: 0x9936, + 0x240: 0x49ae, 0x241: 0x49b3, 0x242: 0x9932, 0x243: 0x49b8, 0x244: 0x4a71, 0x245: 0x9936, 0x246: 0x8132, 0x247: 0x812d, 0x248: 0x812d, 0x249: 0x812d, 0x24a: 0x8132, 0x24b: 0x8132, 0x24c: 0x8132, 0x24d: 0x812d, 0x24e: 0x812d, 0x250: 0x8132, 0x251: 0x8132, 0x252: 0x8132, 0x253: 0x812d, 0x254: 0x812d, 0x255: 0x812d, 0x256: 0x812d, 0x257: 0x8132, @@ -4631,22 +4635,22 @@ var nfkcValues = [5888]uint16{ 0x27a: 0x42a5, 0x27e: 0x0037, // Block 0xa, offset 0x280 - 0x284: 0x425a, 0x285: 0x4511, + 0x284: 0x425a, 0x285: 0x447b, 0x286: 0x35e9, 0x287: 0x00ce, 0x288: 0x3607, 0x289: 0x3613, 0x28a: 0x3625, 0x28c: 0x3643, 0x28e: 0x3655, 0x28f: 0x3673, 0x290: 0x3e08, 0x291: 0xa000, 0x295: 0xa000, 0x297: 0xa000, 0x299: 0xa000, 0x29f: 0xa000, 0x2a1: 0xa000, 0x2a5: 0xa000, 0x2a9: 0xa000, - 0x2aa: 0x3637, 0x2ab: 0x3667, 0x2ac: 0x4894, 0x2ad: 0x3697, 0x2ae: 0x48be, 0x2af: 0x36a9, + 0x2aa: 0x3637, 0x2ab: 0x3667, 0x2ac: 0x47fe, 0x2ad: 0x3697, 0x2ae: 0x4828, 0x2af: 0x36a9, 0x2b0: 0x3e70, 0x2b1: 0xa000, 0x2b5: 0xa000, 0x2b7: 0xa000, 0x2b9: 0xa000, 0x2bf: 0xa000, // Block 0xb, offset 0x2c0 0x2c1: 0xa000, 0x2c5: 0xa000, - 0x2c9: 0xa000, 0x2ca: 0x48d6, 0x2cb: 0x48f4, - 0x2cc: 0x36c7, 0x2cd: 0x36df, 0x2ce: 0x490c, 0x2d0: 0x01be, 0x2d1: 0x01d0, - 0x2d2: 0x01ac, 0x2d3: 0x43a2, 0x2d4: 0x43a8, 0x2d5: 0x01fa, 0x2d6: 0x01e8, + 0x2c9: 0xa000, 0x2ca: 0x4840, 0x2cb: 0x485e, + 0x2cc: 0x36c7, 0x2cd: 0x36df, 0x2ce: 0x4876, 0x2d0: 0x01be, 0x2d1: 0x01d0, + 0x2d2: 0x01ac, 0x2d3: 0x430c, 0x2d4: 0x4312, 0x2d5: 0x01fa, 0x2d6: 0x01e8, 0x2f0: 0x01d6, 0x2f1: 0x01eb, 0x2f2: 0x01ee, 0x2f4: 0x0188, 0x2f5: 0x01c7, 0x2f9: 0x01a6, // Block 0xc, offset 0x300 @@ -4726,15 +4730,15 @@ var nfkcValues = [5888]uint16{ 0x4e4: 0x305f, 0x4e5: 0x336b, 0x4e6: 0x3055, 0x4e7: 0x3361, 0x4e8: 0x3064, 0x4e9: 0x3370, 0x4ea: 0x3069, 0x4eb: 0x3375, 0x4ec: 0x30af, 0x4ed: 0x33bb, 0x4ee: 0x390b, 0x4ef: 0x3a9a, 0x4f0: 0x30b9, 0x4f1: 0x33ca, 0x4f2: 0x30c3, 0x4f3: 0x33d4, 0x4f4: 0x30cd, 0x4f5: 0x33de, - 0x4f6: 0x475a, 0x4f7: 0x47eb, 0x4f8: 0x3912, 0x4f9: 0x3aa1, 0x4fa: 0x30e6, 0x4fb: 0x33f7, + 0x4f6: 0x46c4, 0x4f7: 0x4755, 0x4f8: 0x3912, 0x4f9: 0x3aa1, 0x4fa: 0x30e6, 0x4fb: 0x33f7, 0x4fc: 0x30e1, 0x4fd: 0x33f2, 0x4fe: 0x30eb, 0x4ff: 0x33fc, // Block 0x14, offset 0x500 0x500: 0x30f0, 0x501: 0x3401, 0x502: 0x30f5, 0x503: 0x3406, 0x504: 0x3109, 0x505: 0x341a, 0x506: 0x3113, 0x507: 0x3424, 0x508: 0x3122, 0x509: 0x3433, 0x50a: 0x311d, 0x50b: 0x342e, 0x50c: 0x3935, 0x50d: 0x3ac4, 0x50e: 0x3943, 0x50f: 0x3ad2, 0x510: 0x394a, 0x511: 0x3ad9, 0x512: 0x3951, 0x513: 0x3ae0, 0x514: 0x314f, 0x515: 0x3460, 0x516: 0x3154, 0x517: 0x3465, - 0x518: 0x315e, 0x519: 0x346f, 0x51a: 0x4787, 0x51b: 0x4818, 0x51c: 0x3997, 0x51d: 0x3b26, - 0x51e: 0x3177, 0x51f: 0x3488, 0x520: 0x3181, 0x521: 0x3492, 0x522: 0x4796, 0x523: 0x4827, + 0x518: 0x315e, 0x519: 0x346f, 0x51a: 0x46f1, 0x51b: 0x4782, 0x51c: 0x3997, 0x51d: 0x3b26, + 0x51e: 0x3177, 0x51f: 0x3488, 0x520: 0x3181, 0x521: 0x3492, 0x522: 0x4700, 0x523: 0x4791, 0x524: 0x399e, 0x525: 0x3b2d, 0x526: 0x39a5, 0x527: 0x3b34, 0x528: 0x39ac, 0x529: 0x3b3b, 0x52a: 0x3190, 0x52b: 0x34a1, 0x52c: 0x319a, 0x52d: 0x34b0, 0x52e: 0x31ae, 0x52f: 0x34c4, 0x530: 0x31a9, 0x531: 0x34bf, 0x532: 0x31ea, 0x533: 0x3500, 0x534: 0x31f9, 0x535: 0x350f, @@ -4746,16 +4750,16 @@ var nfkcValues = [5888]uint16{ 0x54c: 0x322b, 0x54d: 0x3546, 0x54e: 0x3249, 0x54f: 0x3564, 0x550: 0x3262, 0x551: 0x3582, 0x552: 0x3271, 0x553: 0x3591, 0x554: 0x3276, 0x555: 0x3596, 0x556: 0x337a, 0x557: 0x34a6, 0x558: 0x3537, 0x559: 0x3573, 0x55a: 0x1be0, 0x55b: 0x42d7, - 0x560: 0x4737, 0x561: 0x47c8, 0x562: 0x2f83, 0x563: 0x328f, + 0x560: 0x46a1, 0x561: 0x4732, 0x562: 0x2f83, 0x563: 0x328f, 0x564: 0x3878, 0x565: 0x3a07, 0x566: 0x3871, 0x567: 0x3a00, 0x568: 0x3886, 0x569: 0x3a15, 0x56a: 0x387f, 0x56b: 0x3a0e, 0x56c: 0x38be, 0x56d: 0x3a4d, 0x56e: 0x3894, 0x56f: 0x3a23, 0x570: 0x388d, 0x571: 0x3a1c, 0x572: 0x38a2, 0x573: 0x3a31, 0x574: 0x389b, 0x575: 0x3a2a, - 0x576: 0x38c5, 0x577: 0x3a54, 0x578: 0x474b, 0x579: 0x47dc, 0x57a: 0x3000, 0x57b: 0x330c, + 0x576: 0x38c5, 0x577: 0x3a54, 0x578: 0x46b5, 0x579: 0x4746, 0x57a: 0x3000, 0x57b: 0x330c, 0x57c: 0x2fec, 0x57d: 0x32f8, 0x57e: 0x38da, 0x57f: 0x3a69, // Block 0x16, offset 0x580 0x580: 0x38d3, 0x581: 0x3a62, 0x582: 0x38e8, 0x583: 0x3a77, 0x584: 0x38e1, 0x585: 0x3a70, 0x586: 0x38fd, 0x587: 0x3a8c, 0x588: 0x3091, 0x589: 0x339d, 0x58a: 0x30a5, 0x58b: 0x33b1, - 0x58c: 0x477d, 0x58d: 0x480e, 0x58e: 0x3136, 0x58f: 0x3447, 0x590: 0x3920, 0x591: 0x3aaf, + 0x58c: 0x46e7, 0x58d: 0x4778, 0x58e: 0x3136, 0x58f: 0x3447, 0x590: 0x3920, 0x591: 0x3aaf, 0x592: 0x3919, 0x593: 0x3aa8, 0x594: 0x392e, 0x595: 0x3abd, 0x596: 0x3927, 0x597: 0x3ab6, 0x598: 0x3989, 0x599: 0x3b18, 0x59a: 0x396d, 0x59b: 0x3afc, 0x59c: 0x3966, 0x59d: 0x3af5, 0x59e: 0x397b, 0x59f: 0x3b0a, 0x5a0: 0x3974, 0x5a1: 0x3b03, 0x5a2: 0x3982, 0x5a3: 0x3b11, @@ -4764,29 +4768,29 @@ var nfkcValues = [5888]uint16{ 0x5b0: 0x39f9, 0x5b1: 0x3b88, 0x5b2: 0x3230, 0x5b3: 0x354b, 0x5b4: 0x3258, 0x5b5: 0x3578, 0x5b6: 0x3253, 0x5b7: 0x356e, 0x5b8: 0x323f, 0x5b9: 0x355a, // Block 0x17, offset 0x5c0 - 0x5c0: 0x489a, 0x5c1: 0x48a0, 0x5c2: 0x49b4, 0x5c3: 0x49cc, 0x5c4: 0x49bc, 0x5c5: 0x49d4, - 0x5c6: 0x49c4, 0x5c7: 0x49dc, 0x5c8: 0x4840, 0x5c9: 0x4846, 0x5ca: 0x4924, 0x5cb: 0x493c, - 0x5cc: 0x492c, 0x5cd: 0x4944, 0x5ce: 0x4934, 0x5cf: 0x494c, 0x5d0: 0x48ac, 0x5d1: 0x48b2, + 0x5c0: 0x4804, 0x5c1: 0x480a, 0x5c2: 0x491e, 0x5c3: 0x4936, 0x5c4: 0x4926, 0x5c5: 0x493e, + 0x5c6: 0x492e, 0x5c7: 0x4946, 0x5c8: 0x47aa, 0x5c9: 0x47b0, 0x5ca: 0x488e, 0x5cb: 0x48a6, + 0x5cc: 0x4896, 0x5cd: 0x48ae, 0x5ce: 0x489e, 0x5cf: 0x48b6, 0x5d0: 0x4816, 0x5d1: 0x481c, 0x5d2: 0x3db8, 0x5d3: 0x3dc8, 0x5d4: 0x3dc0, 0x5d5: 0x3dd0, - 0x5d8: 0x484c, 0x5d9: 0x4852, 0x5da: 0x3ce8, 0x5db: 0x3cf8, 0x5dc: 0x3cf0, 0x5dd: 0x3d00, - 0x5e0: 0x48c4, 0x5e1: 0x48ca, 0x5e2: 0x49e4, 0x5e3: 0x49fc, - 0x5e4: 0x49ec, 0x5e5: 0x4a04, 0x5e6: 0x49f4, 0x5e7: 0x4a0c, 0x5e8: 0x4858, 0x5e9: 0x485e, - 0x5ea: 0x4954, 0x5eb: 0x496c, 0x5ec: 0x495c, 0x5ed: 0x4974, 0x5ee: 0x4964, 0x5ef: 0x497c, - 0x5f0: 0x48dc, 0x5f1: 0x48e2, 0x5f2: 0x3e18, 0x5f3: 0x3e30, 0x5f4: 0x3e20, 0x5f5: 0x3e38, - 0x5f6: 0x3e28, 0x5f7: 0x3e40, 0x5f8: 0x4864, 0x5f9: 0x486a, 0x5fa: 0x3d18, 0x5fb: 0x3d30, + 0x5d8: 0x47b6, 0x5d9: 0x47bc, 0x5da: 0x3ce8, 0x5db: 0x3cf8, 0x5dc: 0x3cf0, 0x5dd: 0x3d00, + 0x5e0: 0x482e, 0x5e1: 0x4834, 0x5e2: 0x494e, 0x5e3: 0x4966, + 0x5e4: 0x4956, 0x5e5: 0x496e, 0x5e6: 0x495e, 0x5e7: 0x4976, 0x5e8: 0x47c2, 0x5e9: 0x47c8, + 0x5ea: 0x48be, 0x5eb: 0x48d6, 0x5ec: 0x48c6, 0x5ed: 0x48de, 0x5ee: 0x48ce, 0x5ef: 0x48e6, + 0x5f0: 0x4846, 0x5f1: 0x484c, 0x5f2: 0x3e18, 0x5f3: 0x3e30, 0x5f4: 0x3e20, 0x5f5: 0x3e38, + 0x5f6: 0x3e28, 0x5f7: 0x3e40, 0x5f8: 0x47ce, 0x5f9: 0x47d4, 0x5fa: 0x3d18, 0x5fb: 0x3d30, 0x5fc: 0x3d20, 0x5fd: 0x3d38, 0x5fe: 0x3d28, 0x5ff: 0x3d40, // Block 0x18, offset 0x600 - 0x600: 0x48e8, 0x601: 0x48ee, 0x602: 0x3e48, 0x603: 0x3e58, 0x604: 0x3e50, 0x605: 0x3e60, - 0x608: 0x4870, 0x609: 0x4876, 0x60a: 0x3d48, 0x60b: 0x3d58, - 0x60c: 0x3d50, 0x60d: 0x3d60, 0x610: 0x48fa, 0x611: 0x4900, + 0x600: 0x4852, 0x601: 0x4858, 0x602: 0x3e48, 0x603: 0x3e58, 0x604: 0x3e50, 0x605: 0x3e60, + 0x608: 0x47da, 0x609: 0x47e0, 0x60a: 0x3d48, 0x60b: 0x3d58, + 0x60c: 0x3d50, 0x60d: 0x3d60, 0x610: 0x4864, 0x611: 0x486a, 0x612: 0x3e80, 0x613: 0x3e98, 0x614: 0x3e88, 0x615: 0x3ea0, 0x616: 0x3e90, 0x617: 0x3ea8, - 0x619: 0x487c, 0x61b: 0x3d68, 0x61d: 0x3d70, - 0x61f: 0x3d78, 0x620: 0x4912, 0x621: 0x4918, 0x622: 0x4a14, 0x623: 0x4a2c, - 0x624: 0x4a1c, 0x625: 0x4a34, 0x626: 0x4a24, 0x627: 0x4a3c, 0x628: 0x4882, 0x629: 0x4888, - 0x62a: 0x4984, 0x62b: 0x499c, 0x62c: 0x498c, 0x62d: 0x49a4, 0x62e: 0x4994, 0x62f: 0x49ac, - 0x630: 0x488e, 0x631: 0x43b4, 0x632: 0x3691, 0x633: 0x43ba, 0x634: 0x48b8, 0x635: 0x43c0, - 0x636: 0x36a3, 0x637: 0x43c6, 0x638: 0x36c1, 0x639: 0x43cc, 0x63a: 0x36d9, 0x63b: 0x43d2, - 0x63c: 0x4906, 0x63d: 0x43d8, + 0x619: 0x47e6, 0x61b: 0x3d68, 0x61d: 0x3d70, + 0x61f: 0x3d78, 0x620: 0x487c, 0x621: 0x4882, 0x622: 0x497e, 0x623: 0x4996, + 0x624: 0x4986, 0x625: 0x499e, 0x626: 0x498e, 0x627: 0x49a6, 0x628: 0x47ec, 0x629: 0x47f2, + 0x62a: 0x48ee, 0x62b: 0x4906, 0x62c: 0x48f6, 0x62d: 0x490e, 0x62e: 0x48fe, 0x62f: 0x4916, + 0x630: 0x47f8, 0x631: 0x431e, 0x632: 0x3691, 0x633: 0x4324, 0x634: 0x4822, 0x635: 0x432a, + 0x636: 0x36a3, 0x637: 0x4330, 0x638: 0x36c1, 0x639: 0x4336, 0x63a: 0x36d9, 0x63b: 0x433c, + 0x63c: 0x4870, 0x63d: 0x4342, // Block 0x19, offset 0x640 0x640: 0x3da0, 0x641: 0x3da8, 0x642: 0x4184, 0x643: 0x41a2, 0x644: 0x418e, 0x645: 0x41ac, 0x646: 0x4198, 0x647: 0x41b6, 0x648: 0x3cd8, 0x649: 0x3ce0, 0x64a: 0x40d0, 0x64b: 0x40ee, @@ -4797,19 +4801,19 @@ var nfkcValues = [5888]uint16{ 0x664: 0x4206, 0x665: 0x4224, 0x666: 0x4210, 0x667: 0x422e, 0x668: 0x3d80, 0x669: 0x3d88, 0x66a: 0x4148, 0x66b: 0x4166, 0x66c: 0x4152, 0x66d: 0x4170, 0x66e: 0x415c, 0x66f: 0x417a, 0x670: 0x3685, 0x671: 0x367f, 0x672: 0x3d90, 0x673: 0x368b, 0x674: 0x3d98, - 0x676: 0x48a6, 0x677: 0x3db0, 0x678: 0x35f5, 0x679: 0x35ef, 0x67a: 0x35e3, 0x67b: 0x4384, + 0x676: 0x4810, 0x677: 0x3db0, 0x678: 0x35f5, 0x679: 0x35ef, 0x67a: 0x35e3, 0x67b: 0x42ee, 0x67c: 0x35fb, 0x67d: 0x4287, 0x67e: 0x01d3, 0x67f: 0x4287, // Block 0x1a, offset 0x680 - 0x680: 0x42a0, 0x681: 0x4518, 0x682: 0x3dd8, 0x683: 0x369d, 0x684: 0x3de0, - 0x686: 0x48d0, 0x687: 0x3df8, 0x688: 0x3601, 0x689: 0x438a, 0x68a: 0x360d, 0x68b: 0x4390, - 0x68c: 0x3619, 0x68d: 0x451f, 0x68e: 0x4526, 0x68f: 0x452d, 0x690: 0x36b5, 0x691: 0x36af, - 0x692: 0x3e00, 0x693: 0x457a, 0x696: 0x36bb, 0x697: 0x3e10, - 0x698: 0x3631, 0x699: 0x362b, 0x69a: 0x361f, 0x69b: 0x4396, 0x69d: 0x4534, - 0x69e: 0x453b, 0x69f: 0x4542, 0x6a0: 0x36eb, 0x6a1: 0x36e5, 0x6a2: 0x3e68, 0x6a3: 0x4582, + 0x680: 0x42a0, 0x681: 0x4482, 0x682: 0x3dd8, 0x683: 0x369d, 0x684: 0x3de0, + 0x686: 0x483a, 0x687: 0x3df8, 0x688: 0x3601, 0x689: 0x42f4, 0x68a: 0x360d, 0x68b: 0x42fa, + 0x68c: 0x3619, 0x68d: 0x4489, 0x68e: 0x4490, 0x68f: 0x4497, 0x690: 0x36b5, 0x691: 0x36af, + 0x692: 0x3e00, 0x693: 0x44e4, 0x696: 0x36bb, 0x697: 0x3e10, + 0x698: 0x3631, 0x699: 0x362b, 0x69a: 0x361f, 0x69b: 0x4300, 0x69d: 0x449e, + 0x69e: 0x44a5, 0x69f: 0x44ac, 0x6a0: 0x36eb, 0x6a1: 0x36e5, 0x6a2: 0x3e68, 0x6a3: 0x44ec, 0x6a4: 0x36cd, 0x6a5: 0x36d3, 0x6a6: 0x36f1, 0x6a7: 0x3e78, 0x6a8: 0x3661, 0x6a9: 0x365b, - 0x6aa: 0x364f, 0x6ab: 0x43a2, 0x6ac: 0x3649, 0x6ad: 0x450a, 0x6ae: 0x4511, 0x6af: 0x0081, + 0x6aa: 0x364f, 0x6ab: 0x430c, 0x6ac: 0x3649, 0x6ad: 0x4474, 0x6ae: 0x447b, 0x6af: 0x0081, 0x6b2: 0x3eb0, 0x6b3: 0x36f7, 0x6b4: 0x3eb8, - 0x6b6: 0x491e, 0x6b7: 0x3ed0, 0x6b8: 0x363d, 0x6b9: 0x439c, 0x6ba: 0x366d, 0x6bb: 0x43ae, + 0x6b6: 0x4888, 0x6b7: 0x3ed0, 0x6b8: 0x363d, 0x6b9: 0x4306, 0x6ba: 0x366d, 0x6bb: 0x4318, 0x6bc: 0x3679, 0x6bd: 0x425a, 0x6be: 0x428c, // Block 0x1b, offset 0x6c0 0x6c0: 0x1bd8, 0x6c1: 0x1bdc, 0x6c2: 0x0047, 0x6c3: 0x1c54, 0x6c5: 0x1be8, @@ -4922,7 +4926,7 @@ var nfkcValues = [5888]uint16{ 0x93c: 0x3fc0, 0x93d: 0x3fc8, // Block 0x25, offset 0x940 0x954: 0x3f00, - 0x959: 0x9903, 0x95a: 0x9903, 0x95b: 0x4372, 0x95c: 0x4378, 0x95d: 0xa000, + 0x959: 0x9903, 0x95a: 0x9903, 0x95b: 0x42dc, 0x95c: 0x42e2, 0x95d: 0xa000, 0x95e: 0x3fd0, 0x95f: 0x26b4, 0x966: 0xa000, 0x96b: 0xa000, 0x96c: 0x3fe0, 0x96d: 0xa000, 0x96e: 0x3fe8, 0x96f: 0xa000, @@ -4942,10 +4946,10 @@ var nfkcValues = [5888]uint16{ // Block 0x27, offset 0x9c0 0x9c0: 0x0367, 0x9c1: 0x032b, 0x9c2: 0x032f, 0x9c3: 0x0333, 0x9c4: 0x037b, 0x9c5: 0x0337, 0x9c6: 0x033b, 0x9c7: 0x033f, 0x9c8: 0x0343, 0x9c9: 0x0347, 0x9ca: 0x034b, 0x9cb: 0x034f, - 0x9cc: 0x0353, 0x9cd: 0x0357, 0x9ce: 0x035b, 0x9cf: 0x42dc, 0x9d0: 0x42e1, 0x9d1: 0x42e6, - 0x9d2: 0x42eb, 0x9d3: 0x42f0, 0x9d4: 0x42f5, 0x9d5: 0x42fa, 0x9d6: 0x42ff, 0x9d7: 0x4304, - 0x9d8: 0x4309, 0x9d9: 0x430e, 0x9da: 0x4313, 0x9db: 0x4318, 0x9dc: 0x431d, 0x9dd: 0x4322, - 0x9de: 0x4327, 0x9df: 0x432c, 0x9e0: 0x4331, 0x9e1: 0x4336, 0x9e2: 0x433b, 0x9e3: 0x4340, + 0x9cc: 0x0353, 0x9cd: 0x0357, 0x9ce: 0x035b, 0x9cf: 0x49bd, 0x9d0: 0x49c3, 0x9d1: 0x49c9, + 0x9d2: 0x49cf, 0x9d3: 0x49d5, 0x9d4: 0x49db, 0x9d5: 0x49e1, 0x9d6: 0x49e7, 0x9d7: 0x49ed, + 0x9d8: 0x49f3, 0x9d9: 0x49f9, 0x9da: 0x49ff, 0x9db: 0x4a05, 0x9dc: 0x4a0b, 0x9dd: 0x4a11, + 0x9de: 0x4a17, 0x9df: 0x4a1d, 0x9e0: 0x4a23, 0x9e1: 0x4a29, 0x9e2: 0x4a2f, 0x9e3: 0x4a35, 0x9e4: 0x03c3, 0x9e5: 0x035f, 0x9e6: 0x0363, 0x9e7: 0x03e7, 0x9e8: 0x03eb, 0x9e9: 0x03ef, 0x9ea: 0x03f3, 0x9eb: 0x03f7, 0x9ec: 0x03fb, 0x9ed: 0x03ff, 0x9ee: 0x036b, 0x9ef: 0x0403, 0x9f0: 0x0407, 0x9f1: 0x036f, 0x9f2: 0x0373, 0x9f3: 0x0377, 0x9f4: 0x037f, 0x9f5: 0x0383, @@ -5148,17 +5152,17 @@ var nfkcValues = [5888]uint16{ 0xe40: 0x19d5, 0xe41: 0x19d8, 0xe42: 0x19db, 0xe43: 0x1c08, 0xe44: 0x1c0c, 0xe45: 0x1a5f, 0xe46: 0x1a5f, 0xe53: 0x1d75, 0xe54: 0x1d66, 0xe55: 0x1d6b, 0xe56: 0x1d7a, 0xe57: 0x1d70, - 0xe5d: 0x4426, - 0xe5e: 0x8115, 0xe5f: 0x4498, 0xe60: 0x022d, 0xe61: 0x0215, 0xe62: 0x021e, 0xe63: 0x0221, + 0xe5d: 0x4390, + 0xe5e: 0x8115, 0xe5f: 0x4402, 0xe60: 0x022d, 0xe61: 0x0215, 0xe62: 0x021e, 0xe63: 0x0221, 0xe64: 0x0224, 0xe65: 0x0227, 0xe66: 0x022a, 0xe67: 0x0230, 0xe68: 0x0233, 0xe69: 0x0017, - 0xe6a: 0x4486, 0xe6b: 0x448c, 0xe6c: 0x458a, 0xe6d: 0x4592, 0xe6e: 0x43de, 0xe6f: 0x43e4, - 0xe70: 0x43ea, 0xe71: 0x43f0, 0xe72: 0x43fc, 0xe73: 0x4402, 0xe74: 0x4408, 0xe75: 0x4414, - 0xe76: 0x441a, 0xe78: 0x4420, 0xe79: 0x442c, 0xe7a: 0x4432, 0xe7b: 0x4438, - 0xe7c: 0x4444, 0xe7e: 0x444a, + 0xe6a: 0x43f0, 0xe6b: 0x43f6, 0xe6c: 0x44f4, 0xe6d: 0x44fc, 0xe6e: 0x4348, 0xe6f: 0x434e, + 0xe70: 0x4354, 0xe71: 0x435a, 0xe72: 0x4366, 0xe73: 0x436c, 0xe74: 0x4372, 0xe75: 0x437e, + 0xe76: 0x4384, 0xe78: 0x438a, 0xe79: 0x4396, 0xe7a: 0x439c, 0xe7b: 0x43a2, + 0xe7c: 0x43ae, 0xe7e: 0x43b4, // Block 0x3a, offset 0xe80 - 0xe80: 0x4450, 0xe81: 0x4456, 0xe83: 0x445c, 0xe84: 0x4462, - 0xe86: 0x446e, 0xe87: 0x4474, 0xe88: 0x447a, 0xe89: 0x4480, 0xe8a: 0x4492, 0xe8b: 0x440e, - 0xe8c: 0x43f6, 0xe8d: 0x443e, 0xe8e: 0x4468, 0xe8f: 0x1d7f, 0xe90: 0x0299, 0xe91: 0x0299, + 0xe80: 0x43ba, 0xe81: 0x43c0, 0xe83: 0x43c6, 0xe84: 0x43cc, + 0xe86: 0x43d8, 0xe87: 0x43de, 0xe88: 0x43e4, 0xe89: 0x43ea, 0xe8a: 0x43fc, 0xe8b: 0x4378, + 0xe8c: 0x4360, 0xe8d: 0x43a8, 0xe8e: 0x43d2, 0xe8f: 0x1d7f, 0xe90: 0x0299, 0xe91: 0x0299, 0xe92: 0x02a2, 0xe93: 0x02a2, 0xe94: 0x02a2, 0xe95: 0x02a2, 0xe96: 0x02a5, 0xe97: 0x02a5, 0xe98: 0x02a5, 0xe99: 0x02a5, 0xe9a: 0x02ab, 0xe9b: 0x02ab, 0xe9c: 0x02ab, 0xe9d: 0x02ab, 0xe9e: 0x029f, 0xe9f: 0x029f, 0xea0: 0x029f, 0xea1: 0x029f, 0xea2: 0x02a8, 0xea3: 0x02a8, @@ -5174,9 +5178,9 @@ var nfkcValues = [5888]uint16{ 0xed2: 0x02db, 0xed3: 0x02db, 0xed4: 0x02db, 0xed5: 0x02db, 0xed6: 0x02e1, 0xed7: 0x02e1, 0xed8: 0x02e1, 0xed9: 0x02e1, 0xeda: 0x02de, 0xedb: 0x02de, 0xedc: 0x02de, 0xedd: 0x02de, 0xede: 0x02e4, 0xedf: 0x02e4, 0xee0: 0x02e7, 0xee1: 0x02e7, 0xee2: 0x02e7, 0xee3: 0x02e7, - 0xee4: 0x4504, 0xee5: 0x4504, 0xee6: 0x02ed, 0xee7: 0x02ed, 0xee8: 0x02ed, 0xee9: 0x02ed, + 0xee4: 0x446e, 0xee5: 0x446e, 0xee6: 0x02ed, 0xee7: 0x02ed, 0xee8: 0x02ed, 0xee9: 0x02ed, 0xeea: 0x02ea, 0xeeb: 0x02ea, 0xeec: 0x02ea, 0xeed: 0x02ea, 0xeee: 0x0308, 0xeef: 0x0308, - 0xef0: 0x44fe, 0xef1: 0x44fe, + 0xef0: 0x4468, 0xef1: 0x4468, // Block 0x3c, offset 0xf00 0xf13: 0x02d8, 0xf14: 0x02d8, 0xf15: 0x02d8, 0xf16: 0x02d8, 0xf17: 0x02f6, 0xf18: 0x02f6, 0xf19: 0x02f3, 0xf1a: 0x02f3, 0xf1b: 0x02f9, 0xf1c: 0x02f9, 0xf1d: 0x204f, @@ -5203,8 +5207,8 @@ var nfkcValues = [5888]uint16{ 0xf86: 0x1fb4, 0xf87: 0x1fb9, 0xf88: 0x1fbe, 0xf89: 0x1fc3, 0xf8a: 0x1fc8, 0xf8b: 0x1fcd, 0xf8c: 0x1fd2, 0xf8d: 0x1fd7, 0xf8e: 0x1fe6, 0xf8f: 0x1ff5, 0xf90: 0x1ffa, 0xf91: 0x1fff, 0xf92: 0x2004, 0xf93: 0x2009, 0xf94: 0x200e, 0xf95: 0x2018, 0xf96: 0x201d, 0xf97: 0x2022, - 0xf98: 0x2031, 0xf99: 0x2040, 0xf9a: 0x2045, 0xf9b: 0x44b6, 0xf9c: 0x44bc, 0xf9d: 0x44f2, - 0xf9e: 0x4549, 0xf9f: 0x4550, 0xfa0: 0x4557, 0xfa1: 0x455e, 0xfa2: 0x4565, 0xfa3: 0x456c, + 0xf98: 0x2031, 0xf99: 0x2040, 0xf9a: 0x2045, 0xf9b: 0x4420, 0xf9c: 0x4426, 0xf9d: 0x445c, + 0xf9e: 0x44b3, 0xf9f: 0x44ba, 0xfa0: 0x44c1, 0xfa1: 0x44c8, 0xfa2: 0x44cf, 0xfa3: 0x44d6, 0xfa4: 0x25c6, 0xfa5: 0x25cd, 0xfa6: 0x25d4, 0xfa7: 0x25db, 0xfa8: 0x25f0, 0xfa9: 0x25f7, 0xfaa: 0x1d98, 0xfab: 0x1d9d, 0xfac: 0x1da2, 0xfad: 0x1da7, 0xfae: 0x1db1, 0xfaf: 0x1db6, 0xfb0: 0x1dca, 0xfb1: 0x1dcf, 0xfb2: 0x1dd4, 0xfb3: 0x1dd9, 0xfb4: 0x1de3, 0xfb5: 0x1de8, @@ -5213,7 +5217,7 @@ var nfkcValues = [5888]uint16{ // Block 0x3f, offset 0xfc0 0xfc0: 0x1f5a, 0xfc1: 0x1f6e, 0xfc2: 0x1f73, 0xfc3: 0x1f78, 0xfc4: 0x1f7d, 0xfc5: 0x1f96, 0xfc6: 0x1fa0, 0xfc7: 0x1fa5, 0xfc8: 0x1faa, 0xfc9: 0x1fbe, 0xfca: 0x1fdc, 0xfcb: 0x1fe1, - 0xfcc: 0x1fe6, 0xfcd: 0x1feb, 0xfce: 0x1ff5, 0xfcf: 0x1ffa, 0xfd0: 0x44f2, 0xfd1: 0x2027, + 0xfcc: 0x1fe6, 0xfcd: 0x1feb, 0xfce: 0x1ff5, 0xfcf: 0x1ffa, 0xfd0: 0x445c, 0xfd1: 0x2027, 0xfd2: 0x202c, 0xfd3: 0x2031, 0xfd4: 0x2036, 0xfd5: 0x2040, 0xfd6: 0x2045, 0xfd7: 0x25b1, 0xfd8: 0x25b8, 0xfd9: 0x25bf, 0xfda: 0x25d4, 0xfdb: 0x25e2, 0xfdc: 0x1d89, 0xfdd: 0x1d8e, 0xfde: 0x1d93, 0xfdf: 0x1da2, 0xfe0: 0x1dac, 0xfe1: 0x1dbb, 0xfe2: 0x1dc0, 0xfe3: 0x1dc5, @@ -5227,11 +5231,11 @@ var nfkcValues = [5888]uint16{ 0x1006: 0x1f69, 0x1007: 0x1f6e, 0x1008: 0x1f73, 0x1009: 0x1f87, 0x100a: 0x1f8c, 0x100b: 0x1f91, 0x100c: 0x1f96, 0x100d: 0x1f9b, 0x100e: 0x1faf, 0x100f: 0x1fb4, 0x1010: 0x1fb9, 0x1011: 0x1fbe, 0x1012: 0x1fcd, 0x1013: 0x1fd2, 0x1014: 0x1fd7, 0x1015: 0x1fe6, 0x1016: 0x1ff0, 0x1017: 0x1fff, - 0x1018: 0x2004, 0x1019: 0x44e6, 0x101a: 0x2018, 0x101b: 0x201d, 0x101c: 0x2022, 0x101d: 0x2031, + 0x1018: 0x2004, 0x1019: 0x4450, 0x101a: 0x2018, 0x101b: 0x201d, 0x101c: 0x2022, 0x101d: 0x2031, 0x101e: 0x203b, 0x101f: 0x25d4, 0x1020: 0x25e2, 0x1021: 0x1da2, 0x1022: 0x1dac, 0x1023: 0x1dd4, 0x1024: 0x1dde, 0x1025: 0x1dfc, 0x1026: 0x1e06, 0x1027: 0x1e6a, 0x1028: 0x1e6f, 0x1029: 0x1e92, 0x102a: 0x1e97, 0x102b: 0x1f6e, 0x102c: 0x1f73, 0x102d: 0x1f96, 0x102e: 0x1fe6, 0x102f: 0x1ff0, - 0x1030: 0x2031, 0x1031: 0x203b, 0x1032: 0x459a, 0x1033: 0x45a2, 0x1034: 0x45aa, 0x1035: 0x1ef1, + 0x1030: 0x2031, 0x1031: 0x203b, 0x1032: 0x4504, 0x1033: 0x450c, 0x1034: 0x4514, 0x1035: 0x1ef1, 0x1036: 0x1ef6, 0x1037: 0x1f0a, 0x1038: 0x1f0f, 0x1039: 0x1f1e, 0x103a: 0x1f23, 0x103b: 0x1e74, 0x103c: 0x1e79, 0x103d: 0x1e9c, 0x103e: 0x1ea1, 0x103f: 0x1e33, // Block 0x41, offset 0x1040 @@ -5245,7 +5249,7 @@ var nfkcValues = [5888]uint16{ 0x106a: 0x1e65, 0x106b: 0x1eb0, 0x106c: 0x1ed3, 0x106d: 0x1e7e, 0x106e: 0x1e83, 0x106f: 0x1e88, 0x1070: 0x1e92, 0x1071: 0x1e6f, 0x1072: 0x1e97, 0x1073: 0x1eec, 0x1074: 0x1e56, 0x1075: 0x1e5b, 0x1076: 0x1e60, 0x1077: 0x1e7e, 0x1078: 0x1e83, 0x1079: 0x1e88, 0x107a: 0x1eec, 0x107b: 0x1efb, - 0x107c: 0x449e, 0x107d: 0x449e, + 0x107c: 0x4408, 0x107d: 0x4408, // Block 0x42, offset 0x1080 0x1090: 0x2311, 0x1091: 0x2326, 0x1092: 0x2326, 0x1093: 0x232d, 0x1094: 0x2334, 0x1095: 0x2349, 0x1096: 0x2350, 0x1097: 0x2357, @@ -5293,13 +5297,13 @@ var nfkcValues = [5888]uint16{ 0x119e: 0x04bb, 0x119f: 0x0007, 0x11a0: 0x000d, 0x11a1: 0x0015, 0x11a2: 0x0017, 0x11a3: 0x001b, 0x11a4: 0x0039, 0x11a5: 0x003d, 0x11a6: 0x003b, 0x11a8: 0x0079, 0x11a9: 0x0009, 0x11aa: 0x000b, 0x11ab: 0x0041, - 0x11b0: 0x42aa, 0x11b1: 0x44c2, 0x11b2: 0x42af, 0x11b4: 0x42b4, - 0x11b6: 0x42b9, 0x11b7: 0x44c8, 0x11b8: 0x42be, 0x11b9: 0x44ce, 0x11ba: 0x42c3, 0x11bb: 0x44d4, - 0x11bc: 0x42c8, 0x11bd: 0x44da, 0x11be: 0x42cd, 0x11bf: 0x44e0, + 0x11b0: 0x42aa, 0x11b1: 0x442c, 0x11b2: 0x42af, 0x11b4: 0x42b4, + 0x11b6: 0x42b9, 0x11b7: 0x4432, 0x11b8: 0x42be, 0x11b9: 0x4438, 0x11ba: 0x42c3, 0x11bb: 0x443e, + 0x11bc: 0x42c8, 0x11bd: 0x4444, 0x11be: 0x42cd, 0x11bf: 0x444a, // Block 0x47, offset 0x11c0 - 0x11c0: 0x0236, 0x11c1: 0x44a4, 0x11c2: 0x44a4, 0x11c3: 0x44aa, 0x11c4: 0x44aa, 0x11c5: 0x44ec, - 0x11c6: 0x44ec, 0x11c7: 0x44b0, 0x11c8: 0x44b0, 0x11c9: 0x44f8, 0x11ca: 0x44f8, 0x11cb: 0x44f8, - 0x11cc: 0x44f8, 0x11cd: 0x0239, 0x11ce: 0x0239, 0x11cf: 0x023c, 0x11d0: 0x023c, 0x11d1: 0x023c, + 0x11c0: 0x0236, 0x11c1: 0x440e, 0x11c2: 0x440e, 0x11c3: 0x4414, 0x11c4: 0x4414, 0x11c5: 0x4456, + 0x11c6: 0x4456, 0x11c7: 0x441a, 0x11c8: 0x441a, 0x11c9: 0x4462, 0x11ca: 0x4462, 0x11cb: 0x4462, + 0x11cc: 0x4462, 0x11cd: 0x0239, 0x11ce: 0x0239, 0x11cf: 0x023c, 0x11d0: 0x023c, 0x11d1: 0x023c, 0x11d2: 0x023c, 0x11d3: 0x023f, 0x11d4: 0x023f, 0x11d5: 0x0242, 0x11d6: 0x0242, 0x11d7: 0x0242, 0x11d8: 0x0242, 0x11d9: 0x0245, 0x11da: 0x0245, 0x11db: 0x0245, 0x11dc: 0x0245, 0x11dd: 0x0248, 0x11de: 0x0248, 0x11df: 0x0248, 0x11e0: 0x0248, 0x11e1: 0x024b, 0x11e2: 0x024b, 0x11e3: 0x024b, @@ -5338,18 +5342,18 @@ var nfkcValues = [5888]uint16{ 0x128c: 0x054b, 0x128d: 0x054f, 0x128e: 0x0553, 0x128f: 0x0557, 0x1290: 0x055b, 0x1291: 0x055f, 0x1292: 0x0563, 0x1293: 0x0567, 0x1294: 0x056f, 0x1295: 0x0577, 0x1296: 0x057f, 0x1297: 0x0583, 0x1298: 0x0587, 0x1299: 0x058b, 0x129a: 0x058f, 0x129b: 0x0593, 0x129c: 0x0597, 0x129d: 0x05a7, - 0x129e: 0x4a5a, 0x129f: 0x4a60, 0x12a0: 0x03c3, 0x12a1: 0x0313, 0x12a2: 0x0317, 0x12a3: 0x4345, - 0x12a4: 0x031b, 0x12a5: 0x434a, 0x12a6: 0x434f, 0x12a7: 0x031f, 0x12a8: 0x0323, 0x12a9: 0x0327, - 0x12aa: 0x4354, 0x12ab: 0x4359, 0x12ac: 0x435e, 0x12ad: 0x4363, 0x12ae: 0x4368, 0x12af: 0x436d, + 0x129e: 0x4a78, 0x129f: 0x4a7e, 0x12a0: 0x03c3, 0x12a1: 0x0313, 0x12a2: 0x0317, 0x12a3: 0x4a3b, + 0x12a4: 0x031b, 0x12a5: 0x4a41, 0x12a6: 0x4a47, 0x12a7: 0x031f, 0x12a8: 0x0323, 0x12a9: 0x0327, + 0x12aa: 0x4a4d, 0x12ab: 0x4a53, 0x12ac: 0x4a59, 0x12ad: 0x4a5f, 0x12ae: 0x4a65, 0x12af: 0x4a6b, 0x12b0: 0x0367, 0x12b1: 0x032b, 0x12b2: 0x032f, 0x12b3: 0x0333, 0x12b4: 0x037b, 0x12b5: 0x0337, 0x12b6: 0x033b, 0x12b7: 0x033f, 0x12b8: 0x0343, 0x12b9: 0x0347, 0x12ba: 0x034b, 0x12bb: 0x034f, 0x12bc: 0x0353, 0x12bd: 0x0357, 0x12be: 0x035b, // Block 0x4b, offset 0x12c0 - 0x12c2: 0x42dc, 0x12c3: 0x42e1, 0x12c4: 0x42e6, 0x12c5: 0x42eb, - 0x12c6: 0x42f0, 0x12c7: 0x42f5, 0x12ca: 0x42fa, 0x12cb: 0x42ff, - 0x12cc: 0x4304, 0x12cd: 0x4309, 0x12ce: 0x430e, 0x12cf: 0x4313, - 0x12d2: 0x4318, 0x12d3: 0x431d, 0x12d4: 0x4322, 0x12d5: 0x4327, 0x12d6: 0x432c, 0x12d7: 0x4331, - 0x12da: 0x4336, 0x12db: 0x433b, 0x12dc: 0x4340, + 0x12c2: 0x49bd, 0x12c3: 0x49c3, 0x12c4: 0x49c9, 0x12c5: 0x49cf, + 0x12c6: 0x49d5, 0x12c7: 0x49db, 0x12ca: 0x49e1, 0x12cb: 0x49e7, + 0x12cc: 0x49ed, 0x12cd: 0x49f3, 0x12ce: 0x49f9, 0x12cf: 0x49ff, + 0x12d2: 0x4a05, 0x12d3: 0x4a0b, 0x12d4: 0x4a11, 0x12d5: 0x4a17, 0x12d6: 0x4a1d, 0x12d7: 0x4a23, + 0x12da: 0x4a29, 0x12db: 0x4a2f, 0x12dc: 0x4a35, 0x12e0: 0x00bf, 0x12e1: 0x00c2, 0x12e2: 0x00cb, 0x12e3: 0x4264, 0x12e4: 0x00c8, 0x12e5: 0x00c5, 0x12e6: 0x0447, 0x12e8: 0x046b, 0x12e9: 0x044b, 0x12ea: 0x044f, 0x12eb: 0x0453, 0x12ec: 0x0457, 0x12ed: 0x046f, 0x12ee: 0x0473, @@ -5426,7 +5430,7 @@ var nfkcValues = [5888]uint16{ // Block 0x52, offset 0x1480 0x1480: 0x26ad, 0x1481: 0x26c2, 0x1482: 0x0503, 0x1490: 0x0c0f, 0x1491: 0x0a47, - 0x1492: 0x08d3, 0x1493: 0x465a, 0x1494: 0x071b, 0x1495: 0x09ef, 0x1496: 0x132f, 0x1497: 0x09ff, + 0x1492: 0x08d3, 0x1493: 0x45c4, 0x1494: 0x071b, 0x1495: 0x09ef, 0x1496: 0x132f, 0x1497: 0x09ff, 0x1498: 0x0727, 0x1499: 0x0cd7, 0x149a: 0x0eaf, 0x149b: 0x0caf, 0x149c: 0x0827, 0x149d: 0x0b6b, 0x149e: 0x07bf, 0x149f: 0x0cb7, 0x14a0: 0x0813, 0x14a1: 0x1117, 0x14a2: 0x0f83, 0x14a3: 0x138b, 0x14a4: 0x09d3, 0x14a5: 0x090b, 0x14a6: 0x0e63, 0x14a7: 0x0c1b, 0x14a8: 0x0c47, 0x14a9: 0x06bf, @@ -5665,8 +5669,8 @@ var nfkcSparseValues = [875]valueRange{ {value: 0x22b2, lo: 0xbe, hi: 0xbe}, // Block 0x1, offset 0xe {value: 0x0091, lo: 0x03}, - {value: 0x4778, lo: 0xa0, hi: 0xa1}, - {value: 0x47aa, lo: 0xaf, hi: 0xb0}, + {value: 0x46e2, lo: 0xa0, hi: 0xa1}, + {value: 0x4714, lo: 0xaf, hi: 0xb0}, {value: 0xa000, lo: 0xb7, hi: 0xb7}, // Block 0x2, offset 0x12 {value: 0x0003, lo: 0x08}, @@ -5814,7 +5818,7 @@ var nfkcSparseValues = [875]valueRange{ {value: 0x812d, lo: 0x92, hi: 0x92}, {value: 0x8132, lo: 0x93, hi: 0x93}, {value: 0x8132, lo: 0x94, hi: 0x94}, - {value: 0x45b2, lo: 0x98, hi: 0x9f}, + {value: 0x451c, lo: 0x98, hi: 0x9f}, // Block 0x11, offset 0x96 {value: 0x0000, lo: 0x02}, {value: 0x8102, lo: 0xbc, hi: 0xbc}, @@ -5825,18 +5829,18 @@ var nfkcSparseValues = [875]valueRange{ {value: 0x2c9e, lo: 0x8b, hi: 0x8c}, {value: 0x8104, lo: 0x8d, hi: 0x8d}, {value: 0x9900, lo: 0x97, hi: 0x97}, - {value: 0x45f2, lo: 0x9c, hi: 0x9d}, - {value: 0x4602, lo: 0x9f, hi: 0x9f}, + {value: 0x455c, lo: 0x9c, hi: 0x9d}, + {value: 0x456c, lo: 0x9f, hi: 0x9f}, // Block 0x13, offset 0xa0 {value: 0x0000, lo: 0x03}, - {value: 0x462a, lo: 0xb3, hi: 0xb3}, - {value: 0x4632, lo: 0xb6, hi: 0xb6}, + {value: 0x4594, lo: 0xb3, hi: 0xb3}, + {value: 0x459c, lo: 0xb6, hi: 0xb6}, {value: 0x8102, lo: 0xbc, hi: 0xbc}, // Block 0x14, offset 0xa4 {value: 0x0008, lo: 0x03}, {value: 0x8104, lo: 0x8d, hi: 0x8d}, - {value: 0x460a, lo: 0x99, hi: 0x9b}, - {value: 0x4622, lo: 0x9e, hi: 0x9e}, + {value: 0x4574, lo: 0x99, hi: 0x9b}, + {value: 0x458c, lo: 0x9e, hi: 0x9e}, // Block 0x15, offset 0xa8 {value: 0x0000, lo: 0x01}, {value: 0x8102, lo: 0xbc, hi: 0xbc}, @@ -5851,8 +5855,8 @@ var nfkcSparseValues = [875]valueRange{ {value: 0x2cbe, lo: 0x8c, hi: 0x8c}, {value: 0x8104, lo: 0x8d, hi: 0x8d}, {value: 0x9900, lo: 0x96, hi: 0x97}, - {value: 0x463a, lo: 0x9c, hi: 0x9c}, - {value: 0x4642, lo: 0x9d, hi: 0x9d}, + {value: 0x45a4, lo: 0x9c, hi: 0x9c}, + {value: 0x45ac, lo: 0x9d, hi: 0x9d}, // Block 0x18, offset 0xb5 {value: 0x0000, lo: 0x03}, {value: 0xa000, lo: 0x92, hi: 0x92}, @@ -5941,18 +5945,18 @@ var nfkcSparseValues = [875]valueRange{ {value: 0x263d, lo: 0xa9, hi: 0xa9}, {value: 0x8126, lo: 0xb1, hi: 0xb1}, {value: 0x8127, lo: 0xb2, hi: 0xb2}, - {value: 0x4a66, lo: 0xb3, hi: 0xb3}, + {value: 0x4a84, lo: 0xb3, hi: 0xb3}, {value: 0x8128, lo: 0xb4, hi: 0xb4}, - {value: 0x4a6f, lo: 0xb5, hi: 0xb5}, - {value: 0x464a, lo: 0xb6, hi: 0xb6}, - {value: 0x468a, lo: 0xb7, hi: 0xb7}, - {value: 0x4652, lo: 0xb8, hi: 0xb8}, - {value: 0x4695, lo: 0xb9, hi: 0xb9}, + {value: 0x4a8d, lo: 0xb5, hi: 0xb5}, + {value: 0x45b4, lo: 0xb6, hi: 0xb6}, + {value: 0x45f4, lo: 0xb7, hi: 0xb7}, + {value: 0x45bc, lo: 0xb8, hi: 0xb8}, + {value: 0x45ff, lo: 0xb9, hi: 0xb9}, {value: 0x8127, lo: 0xba, hi: 0xbd}, // Block 0x26, offset 0x107 {value: 0x0000, lo: 0x0b}, {value: 0x8127, lo: 0x80, hi: 0x80}, - {value: 0x4a78, lo: 0x81, hi: 0x81}, + {value: 0x4a96, lo: 0x81, hi: 0x81}, {value: 0x8132, lo: 0x82, hi: 0x83}, {value: 0x8104, lo: 0x84, hi: 0x84}, {value: 0x8132, lo: 0x86, hi: 0x87}, @@ -6199,7 +6203,7 @@ var nfkcSparseValues = [875]valueRange{ {value: 0x192d, lo: 0xb5, hi: 0xb6}, // Block 0x4a, offset 0x1db {value: 0x0000, lo: 0x01}, - {value: 0x4573, lo: 0x9c, hi: 0x9c}, + {value: 0x44dd, lo: 0x9c, hi: 0x9c}, // Block 0x4b, offset 0x1dd {value: 0x0000, lo: 0x02}, {value: 0x0095, lo: 0xbc, hi: 0xbc}, @@ -6245,16 +6249,16 @@ var nfkcSparseValues = [875]valueRange{ {value: 0x04b3, lo: 0xb6, hi: 0xb6}, {value: 0x0887, lo: 0xb8, hi: 0xba}, // Block 0x53, offset 0x201 - {value: 0x0005, lo: 0x09}, + {value: 0x0006, lo: 0x09}, {value: 0x0313, lo: 0xb1, hi: 0xb1}, {value: 0x0317, lo: 0xb2, hi: 0xb2}, - {value: 0x4345, lo: 0xb3, hi: 0xb3}, + {value: 0x4a3b, lo: 0xb3, hi: 0xb3}, {value: 0x031b, lo: 0xb4, hi: 0xb4}, - {value: 0x434a, lo: 0xb5, hi: 0xb6}, + {value: 0x4a41, lo: 0xb5, hi: 0xb6}, {value: 0x031f, lo: 0xb7, hi: 0xb7}, {value: 0x0323, lo: 0xb8, hi: 0xb8}, {value: 0x0327, lo: 0xb9, hi: 0xb9}, - {value: 0x4354, lo: 0xba, hi: 0xbf}, + {value: 0x4a4d, lo: 0xba, hi: 0xbf}, // Block 0x54, offset 0x20b {value: 0x0000, lo: 0x02}, {value: 0x8132, lo: 0xaf, hi: 0xaf}, @@ -6479,13 +6483,13 @@ var nfkcSparseValues = [875]valueRange{ {value: 0x8101, lo: 0x9e, hi: 0x9e}, // Block 0x83, offset 0x2ba {value: 0x0000, lo: 0x0c}, - {value: 0x4662, lo: 0x9e, hi: 0x9e}, - {value: 0x466c, lo: 0x9f, hi: 0x9f}, - {value: 0x46a0, lo: 0xa0, hi: 0xa0}, - {value: 0x46ae, lo: 0xa1, hi: 0xa1}, - {value: 0x46bc, lo: 0xa2, hi: 0xa2}, - {value: 0x46ca, lo: 0xa3, hi: 0xa3}, - {value: 0x46d8, lo: 0xa4, hi: 0xa4}, + {value: 0x45cc, lo: 0x9e, hi: 0x9e}, + {value: 0x45d6, lo: 0x9f, hi: 0x9f}, + {value: 0x460a, lo: 0xa0, hi: 0xa0}, + {value: 0x4618, lo: 0xa1, hi: 0xa1}, + {value: 0x4626, lo: 0xa2, hi: 0xa2}, + {value: 0x4634, lo: 0xa3, hi: 0xa3}, + {value: 0x4642, lo: 0xa4, hi: 0xa4}, {value: 0x812b, lo: 0xa5, hi: 0xa6}, {value: 0x8101, lo: 0xa7, hi: 0xa9}, {value: 0x8130, lo: 0xad, hi: 0xad}, @@ -6497,14 +6501,14 @@ var nfkcSparseValues = [875]valueRange{ {value: 0x8132, lo: 0x85, hi: 0x89}, {value: 0x812d, lo: 0x8a, hi: 0x8b}, {value: 0x8132, lo: 0xaa, hi: 0xad}, - {value: 0x4676, lo: 0xbb, hi: 0xbb}, - {value: 0x4680, lo: 0xbc, hi: 0xbc}, - {value: 0x46e6, lo: 0xbd, hi: 0xbd}, - {value: 0x4702, lo: 0xbe, hi: 0xbe}, - {value: 0x46f4, lo: 0xbf, hi: 0xbf}, + {value: 0x45e0, lo: 0xbb, hi: 0xbb}, + {value: 0x45ea, lo: 0xbc, hi: 0xbc}, + {value: 0x4650, lo: 0xbd, hi: 0xbd}, + {value: 0x466c, lo: 0xbe, hi: 0xbe}, + {value: 0x465e, lo: 0xbf, hi: 0xbf}, // Block 0x85, offset 0x2d1 {value: 0x0000, lo: 0x01}, - {value: 0x4710, lo: 0x80, hi: 0x80}, + {value: 0x467a, lo: 0x80, hi: 0x80}, // Block 0x86, offset 0x2d3 {value: 0x0000, lo: 0x01}, {value: 0x8132, lo: 0x82, hi: 0x84}, @@ -7624,4 +7628,4 @@ var recompMap = map[uint32]rune{ 0x15B915AF: 0x115BB, } -// Total size of tables: 53KB (53976 bytes) +// Total size of tables: 53KB (54006 bytes) diff --git a/vendor/golang.org/x/text/width/kind_string.go b/vendor/golang.org/x/text/width/kind_string.go index ab4fee5..49bfbf7 100644 --- a/vendor/golang.org/x/text/width/kind_string.go +++ b/vendor/golang.org/x/text/width/kind_string.go @@ -1,4 +1,4 @@ -// Code generated by "stringer -type=Kind"; DO NOT EDIT +// Code generated by "stringer -type=Kind"; DO NOT EDIT. package width diff --git a/vendor/golang.org/x/text/width/tables.go b/vendor/golang.org/x/text/width/tables.go index 242da0f..e21f0b8 100644 --- a/vendor/golang.org/x/text/width/tables.go +++ b/vendor/golang.org/x/text/width/tables.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package width diff --git a/vendor/golang.org/x/text/width/transform.go b/vendor/golang.org/x/text/width/transform.go index 2ed2509..0049f70 100644 --- a/vendor/golang.org/x/text/width/transform.go +++ b/vendor/golang.org/x/text/width/transform.go @@ -14,6 +14,32 @@ type foldTransform struct { transform.NopResetter } +func (foldTransform) Span(src []byte, atEOF bool) (n int, err error) { + for n < len(src) { + if src[n] < utf8.RuneSelf { + // ASCII fast path. + for n++; n < len(src) && src[n] < utf8.RuneSelf; n++ { + } + continue + } + v, size := trie.lookup(src[n:]) + if size == 0 { // incomplete UTF-8 encoding + if !atEOF { + err = transform.ErrShortSrc + } else { + n = len(src) + } + break + } + if elem(v)&tagNeedsFold != 0 { + err = transform.ErrEndOfSpan + break + } + n += size + } + return n, err +} + func (foldTransform) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { for nSrc < len(src) { if src[nSrc] < utf8.RuneSelf { @@ -70,6 +96,33 @@ type narrowTransform struct { transform.NopResetter } +func (narrowTransform) Span(src []byte, atEOF bool) (n int, err error) { + for n < len(src) { + if src[n] < utf8.RuneSelf { + // ASCII fast path. + for n++; n < len(src) && src[n] < utf8.RuneSelf; n++ { + } + continue + } + v, size := trie.lookup(src[n:]) + if size == 0 { // incomplete UTF-8 encoding + if !atEOF { + err = transform.ErrShortSrc + } else { + n = len(src) + } + break + } + if k := elem(v).kind(); byte(v) == 0 || k != EastAsianFullwidth && k != EastAsianWide && k != EastAsianAmbiguous { + } else { + err = transform.ErrEndOfSpan + break + } + n += size + } + return n, err +} + func (narrowTransform) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { for nSrc < len(src) { if src[nSrc] < utf8.RuneSelf { @@ -126,6 +179,30 @@ type wideTransform struct { transform.NopResetter } +func (wideTransform) Span(src []byte, atEOF bool) (n int, err error) { + for n < len(src) { + // TODO: Consider ASCII fast path. Special-casing ASCII handling can + // reduce the ns/op of BenchmarkWideASCII by about 30%. This is probably + // not enough to warrant the extra code and complexity. + v, size := trie.lookup(src[n:]) + if size == 0 { // incomplete UTF-8 encoding + if !atEOF { + err = transform.ErrShortSrc + } else { + n = len(src) + } + break + } + if k := elem(v).kind(); byte(v) == 0 || k != EastAsianHalfwidth && k != EastAsianNarrow { + } else { + err = transform.ErrEndOfSpan + break + } + n += size + } + return n, err +} + func (wideTransform) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { for nSrc < len(src) { // TODO: Consider ASCII fast path. Special-casing ASCII handling can diff --git a/vendor/golang.org/x/text/width/trieval.go b/vendor/golang.org/x/text/width/trieval.go index 0ecffb4..ca8e45f 100644 --- a/vendor/golang.org/x/text/width/trieval.go +++ b/vendor/golang.org/x/text/width/trieval.go @@ -1,4 +1,4 @@ -// This file was generated by go generate; DO NOT EDIT +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. package width diff --git a/vendor/golang.org/x/text/width/width.go b/vendor/golang.org/x/text/width/width.go index c32d772..0c9aec4 100644 --- a/vendor/golang.org/x/text/width/width.go +++ b/vendor/golang.org/x/text/width/width.go @@ -153,17 +153,22 @@ func (p Properties) Wide() rune { // Transformer implements the transform.Transformer interface. type Transformer struct { - t transform.Transformer + t transform.SpanningTransformer } // Reset implements the transform.Transformer interface. func (t Transformer) Reset() { t.t.Reset() } -// Transform implements the Transformer interface. +// Transform implements the transform.Transformer interface. func (t Transformer) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { return t.t.Transform(dst, src, atEOF) } +// Span implements the transform.SpanningTransformer interface. +func (t Transformer) Span(src []byte, atEOF bool) (n int, err error) { + return t.t.Span(src, atEOF) +} + // Bytes returns a new byte slice with the result of applying t to b. func (t Transformer) Bytes(b []byte) []byte { b, _, _ = transform.Bytes(t, b)