-
Notifications
You must be signed in to change notification settings - Fork 185
Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
* Add muscle wrapper * Comment and lint MUSCLE Snakefile * Remove colon from MUSCLE meta.yaml * Remove thread from muscle snakefile
- Loading branch information
Showing
6 changed files
with
83 additions
and
0 deletions.
There are no files selected for viewing
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,5 @@ | ||
channels: | ||
- bioconda | ||
- conda-forge | ||
dependencies: | ||
- muscle ==3.8.1551 |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,10 @@ | ||
name: muscle | ||
description: build multiple sequence alignments using MUSCLE. Documentation found at https://www.drive5.com/muscle/manual/index.html | ||
authors: | ||
- Nikos Tsardakas Renhuldt | ||
input: | ||
- FASTA file | ||
output: | ||
- Alignment file, with FASTA as default file format | ||
notes: | | ||
* MUSCLE is a single-core program. It cannot utilize more than 1 thread. |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,24 @@ | ||
rule muscle_fasta: | ||
input: | ||
fasta="{sample}.fa", # Input fasta file | ||
output: | ||
alignment="{sample}.afa", # Output alignment file | ||
log: | ||
"logs/muscle/{sample}.log", | ||
params: | ||
extra="", # Additional arguments | ||
wrapper: | ||
"master/bio/muscle" | ||
|
||
|
||
rule muscle_clw: | ||
input: | ||
fasta="{sample}.fa", | ||
output: | ||
alignment="{sample}.clw", | ||
log: | ||
"logs/muscle/{sample}.log", | ||
params: | ||
extra="-clw", | ||
wrapper: | ||
"master/bio/muscle" |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,10 @@ | ||
>test_protein | ||
MVKYSREPDNPTKSCKARGSDLRVHFKNTRETAHAIRKMQLGKAKSYLEDVLAHKQAIPF | ||
RRFCRGVGRTAQAKNRQSNGQGRWPVKSANFILDLLKNAESNAEVKGLDVDSLYVSHIQV | ||
NQAQKQRRRTYRAHGRINPYMSSPCHIELVLSEKEEPVKKEPETQLAPRKSRKGQALHSG | ||
AS | ||
>test_protein2 | ||
MVKSREPDNPTKSCKARGSDLRVHFKNTRETAHAIRKMQLGKAKSYLEDVLAHKQAIPFR | ||
RFCRGVGRTAQAKNRQSNGQGRWPVKSANFILDLLKNAESNAEVKGLDVDSLYVSHIQVN | ||
QAQKQRRRTYRAHGRINPYMSSPCHIELVLSEKEEPVKKEPETQLAPRKSRKGQALHSGA | ||
S |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,18 @@ | ||
__author__ = "Nikos Tsardakas Renhuldt" | ||
__copyright__ = "Copyright 2021, Nikos Tsardakas Renhuldt" | ||
__email__ = "nikos.tsardakas_renhuldt@tbiokem.lth.se" | ||
__license__ = "MIT" | ||
|
||
|
||
from snakemake.shell import shell | ||
|
||
log = snakemake.log_fmt_shell(stdout=True, stderr=True) | ||
extra = snakemake.params.get("extra", "") | ||
|
||
shell( | ||
"muscle " | ||
"{extra} " | ||
"-in {snakemake.input.fasta} " | ||
"-out {snakemake.output.alignment} " | ||
"{log}" | ||
) |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters