Skip to content
New issue

Have a question about this project? Sign up for a free GitHub account to open an issue and contact its maintainers and the community.

By clicking “Sign up for GitHub”, you agree to our terms of service and privacy statement. We’ll occasionally send you account related emails.

Already on GitHub? Sign in to your account

Fix string split in glyco protein parsimony #2305

Merged
merged 14 commits into from
Sep 7, 2023
Merged
Show file tree
Hide file tree
Changes from all commits
Commits
File filter

Filter by extension

Filter by extension


Conversations
Failed to load comments.
Loading
Jump to
Jump to file
Failed to load files.
Loading
Diff view
Diff view
Original file line number Diff line number Diff line change
Expand Up @@ -41,10 +41,10 @@ public GlycoProteinParsimony(string proteinAccess, int proteinPos, char aminoAci

public double MaxProbability { get; set; }

public static Dictionary<string, GlycoProteinParsimony> ProteinLevelGlycoParsimony(List<GlycoSpectralMatch> allPsmsGly)
public static Dictionary<(string proteinAccession, string proteinPosition, int glycanId), GlycoProteinParsimony> ProteinLevelGlycoParsimony(List<GlycoSpectralMatch> allPsmsGly)
{
//key: proPosId
Dictionary<string, GlycoProteinParsimony> localizedGlycan = new Dictionary<string, GlycoProteinParsimony>();
Dictionary<(string proteinAccession, string proteinPosition, int glycanId), GlycoProteinParsimony> localizedGlycan = new Dictionary<(string proteinAccession, string proteinPosition, int glycanId), GlycoProteinParsimony>();

foreach (var gsm in allPsmsGly)
{
Expand All @@ -59,7 +59,7 @@ public static Dictionary<string, GlycoProteinParsimony> ProteinLevelGlycoParsimo
{
int proteinPos = local.Item1 + gsm.OneBasedStartResidueInProtein.Value - 2;

string proPosId = gsm.ProteinAccession + "-" + proteinPos.ToString() + "-" + local.Item2;
(string,string,int) proPosId = new (gsm.ProteinAccession, proteinPos.ToString(), local.Item2);

double prob = -1;
if (gsm.SiteSpeciLocalProb != null && gsm.SiteSpeciLocalProb.ContainsKey(local.Item1))
Expand Down
42 changes: 22 additions & 20 deletions MetaMorpheus/TaskLayer/XLSearchTask/WriteFile.cs
Original file line number Diff line number Diff line change
Expand Up @@ -9,6 +9,7 @@
using System.IO;
using System.Linq;
using System.Xml.Serialization;
using Easy.Common.Extensions;

namespace TaskLayer
{
Expand Down Expand Up @@ -452,50 +453,51 @@
}

//The function is to summarize localized glycan by protein site.
public static void WriteSeenProteinGlycoLocalization(Dictionary<string, GlycoProteinParsimony> glycoProteinParsimony, string outputPath)
public static void WriteSeenProteinGlycoLocalization(Dictionary<(string proteinAccession, string proteinPosition, int glycanId), GlycoProteinParsimony> glycoProteinParsimony, string outputPath)
{
if (glycoProteinParsimony.Count == 0)
if (glycoProteinParsimony.Keys.Count == 0)
{ return; }
var writtenFile = Path.Combine(outputPath);
using (StreamWriter output = new StreamWriter(writtenFile))
{
output.WriteLine("Protein Accession\tModification Site\tAminoAcid\tLocalized Glycans\tLocalized\tLowest Qvalue\tBest Localization Level\tMax Site Specific Probability");
foreach (var item in glycoProteinParsimony.OrderBy(p=>p.Key))
foreach (var item in glycoProteinParsimony.OrderBy(i=>i.Key.proteinAccession))
{
var x = item.Key.Split('-');
output.WriteLine(
x[0] + "\t" +
x[1] + "\t" +
item.Value.AminoAcid + "\t" +
GlycanBox.GlobalOGlycans[int.Parse(x[2])].Composition + "\t" +
item.Value.IsLocalized + "\t" +
item.Value.MinQValue.ToString("0.000") + "\t" +
item.Value.BestLocalizeLevel + "\t" +
item.Value.MaxProbability.ToString("0.000")
);
if (item.Value != null)
{
output.WriteLine(
item.Key.proteinAccession + "\t" +
item.Key.proteinPosition + "\t" +
item.Value.AminoAcid + "\t" +
GlycanBox.GlobalOGlycans[item.Key.glycanId].Composition + "\t" +
item.Value.IsLocalized + "\t" +
item.Value.MinQValue.ToString("0.000") + "\t" +
item.Value.BestLocalizeLevel + "\t" +
item.Value.MaxProbability.ToString("0.000"));

}
}
}
}

//The function is to summarize localized glycosylation of each protein site.
public static void WriteProteinGlycoLocalization(Dictionary<string, GlycoProteinParsimony> glycoProteinParsimony, string outputPath)
public static void WriteProteinGlycoLocalization(Dictionary<(string proteinAccession, string proteinPosition, int glycanId), GlycoProteinParsimony> glycoProteinParsimony, string outputPath)
{
if (glycoProteinParsimony.Count == 0)
{ return; }

Dictionary<string, HashSet<string>> localizedglycans = new Dictionary<string, HashSet<string>>();
foreach (var item in glycoProteinParsimony.Where(p=>p.Value.IsLocalized && p.Value.MinQValue <= 0.01))
{
var x = item.Key.Split('-');
var key = x[0] + "-" + x[1];
var key = item.Key.proteinAccession + "#" + item.Key.proteinPosition;
if ( localizedglycans.ContainsKey(key))
{
localizedglycans[key].Add(x[2]);
localizedglycans[key].Add(item.Key.glycanId.ToString());

Check warning on line 495 in MetaMorpheus/TaskLayer/XLSearchTask/WriteFile.cs

View check run for this annotation

Codecov / codecov/patch

MetaMorpheus/TaskLayer/XLSearchTask/WriteFile.cs#L495

Added line #L495 was not covered by tests
}
else
{
localizedglycans[key] = new HashSet<string>();
localizedglycans[key].Add(x[2]);
localizedglycans[key].Add(item.Key.glycanId.ToString());
}

}
Expand All @@ -506,7 +508,7 @@
output.WriteLine("Protein Accession\tModification Site\tLocalized Glycan Number\tLocalized Glycans");
foreach (var local in localizedglycans.OrderBy(p => p.Key))
{
var x = local.Key.Split('-');
var x = local.Key.Split('#');
output.WriteLine(
x[0] + "\t" +
x[1] + "\t" +
Expand Down
8 changes: 8 additions & 0 deletions MetaMorpheus/Test/GlycoTestData/P16150withHyphenInName.fasta
Original file line number Diff line number Diff line change
@@ -0,0 +1,8 @@
>sp|P16150|LEUK_HUMAN Leuko-sialin OS=Homo sapiens OX=9606 GN=SPN PE=1 SV=1
MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGD
QTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPI
TANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSK
GTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNA
STVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVV
DAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEE
LKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP
3 changes: 3 additions & 0 deletions MetaMorpheus/Test/Test.csproj
Original file line number Diff line number Diff line change
Expand Up @@ -132,6 +132,9 @@
<None Update="GlycoTestData\P02649.fasta">
<CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
</None>
<None Update="GlycoTestData\P16150withHyphenInName.fasta">
<CopyToOutputDirectory>Always</CopyToOutputDirectory>
</None>
<None Update="GlycoTestData\P16150.fasta">
<CopyToOutputDirectory>PreserveNewest</CopyToOutputDirectory>
</None>
Expand Down
12 changes: 0 additions & 12 deletions MetaMorpheus/Test/XLTestNGlyco.cs
Original file line number Diff line number Diff line change
Expand Up @@ -63,18 +63,6 @@ public static void GlyTest_GlyGetTheoreticalFragments()
var sites = GlycoSpectralMatch.GetPossibleModSites(aPeptideWithSetModifications.Last(), motifs);
Glycan glycan = Glycan.Struct2Glycan("(N(F)(N(H(H(N))(H(N)))))", 0);


//using (StreamWriter output = new StreamWriter(Path.Combine(TestContext.CurrentContext.TestDirectory, "GlycanFragmentions.txt")))
//{
// foreach (var product in fragmentIons)
// {
// foreach (var ion in product.Item2)
// {
// output.WriteLine(ion.Annotation + "\t" + ion.NeutralLoss.ToString() + "\t" + ion.NeutralMass.ToString());
// }
// }
//}

CommonParameters commonParameters = new CommonParameters(deconvolutionMassTolerance: new PpmTolerance(20), trimMsMsPeaks: false);
string filePath = Path.Combine(TestContext.CurrentContext.TestDirectory, @"GlycoTestData/Glyco_3383.mgf"); //"25170.mgf"
MyFileManager myFileManager = new MyFileManager(true);
Expand Down
26 changes: 21 additions & 5 deletions MetaMorpheus/Test/XLTestOGlyco.cs
Original file line number Diff line number Diff line change
@@ -1,7 +1,4 @@
using Chemistry;
using EngineLayer;
using EngineLayer.CrosslinkSearch;
using EngineLayer.Indexing;
using EngineLayer;
using MassSpectrometry;
using NUnit.Framework;
using Proteomics;
Expand All @@ -13,7 +10,6 @@
using System.Linq;
using TaskLayer;
using UsefulProteomicsDatabases;
using MzLibUtil;
using Nett;
using EngineLayer.GlycoSearch;

Expand Down Expand Up @@ -443,6 +439,26 @@ public static void OGlycoTest_Run3()
Directory.Delete(Path.Combine(Environment.CurrentDirectory, @"TESTGlycoData"), true);
}

//make sure that hyphens in protein names don't produce a crash during protein inference from glycopeptides
[Test]
public static void OGlycoTest_Run4()
{
string outputFolder = Path.Combine(TestContext.CurrentContext.TestDirectory, @"TESTGlycoData");
Directory.CreateDirectory(outputFolder);

var glycoSearchTask = Toml.ReadFile<GlycoSearchTask>(Path.Combine(TestContext.CurrentContext.TestDirectory, @"GlycoTestData\GlycoSearchTaskconfigOGlycoTest_Run.toml"), MetaMorpheusTask.tomlConfig);

DbForTask db = new(Path.Combine(TestContext.CurrentContext.TestDirectory, @"GlycoTestData\P16150withHyphenInName.fasta"), false);
string spectraFile = Path.Combine(TestContext.CurrentContext.TestDirectory, @"GlycoTestData\2019_09_16_StcEmix_35trig_EThcD25_rep1_9906.mgf");
new EverythingRunnerEngine(new List<(string, MetaMorpheusTask)> { ("Task", glycoSearchTask) }, new List<string> { spectraFile }, new List<DbForTask> { db }, outputFolder).Run();

var folders = Directory.GetDirectories(outputFolder).Select(b => Path.GetFileName(b)).ToList();
var folderContents = Directory.GetFiles(Path.Combine(outputFolder, folders[0])).ToList();
Assert.That(folderContents[6].Contains("_AllProteinGroups.tsv"));

Directory.Delete(outputFolder, true);
}

[Test]
public static void OGlycoTest_GetLeft()
{
Expand Down